F453643

General Info

Members Datasets Scaffolds Average Seq Length
488 332 976 133

Family's Representative Sequence

Representative Sequence 3300041507|Ga0451851_0114106|Ga0451851_0114106_39_518
Length 159
Sequence MLSCDEGSVAGTIDILQFASATKGFGMTTTRIIAVALLIVGSGLVLNLAQAQQPGIKRTDLQRHDLSVPGREVVQVRVDFAPGAAFPKHRHPGEEIINVLEGSLEYEVEGKPPVTLKAGDVLFIPAGTIHAAKNVGSGNAAELATYVLEKGKPPLELIK

Samples

Sample ID Description Type Environment
1 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
248 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
302 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
303 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
304 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
305 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
306 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
307 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
308 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
309 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
310 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
311 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
312 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
313 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
314 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
315 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
316 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
317 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
318 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
319 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
320 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
321 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
322 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
323 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
324 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
325 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
326 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
327 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
328 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
329 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
330 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
331 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
332 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 0
Isolates 6.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 5.94
Rhizoplane 8.81
Rhizosphere 73.57
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451851_0114106 3300041507 Bacteria 582
2 JGI24746J21847_1063338 3300001977 Bacteria 531
3 JGI24743J22301_10046283 3300001991 Bacteria 880
4 JGI24738J21930_10007072 3300002075 Bacteria 2606
5 JGI24749J21850_1022303 3300002076 Bacteria 898
6 JGI24744J21845_10014554 3300002077 Bacteria 1578
7 JGI24033J26618_1007031 3300002155 Bacteria 1271
8 JGI24034J26672_10032088 3300002239 Bacteria 859
9 JGI24742J22300_10026450 3300002244 Bacteria 1004
10 JGI24751J29686_10007778 3300002459 Bacteria 2190
11 Ga0055526_1101460 3300003771 Bacteria 527
12 Ga0065715_10109770 3300005293 Bacteria 2650
13 Ga0070676_10852159 3300005328 Unclassified 676
14 Ga0070690_100094806 3300005330 Bacteria 1970
15 Ga0070670_100010619 3300005331 Bacteria 7865
16 Ga0070670_100053049 3300005331 Bacteria 3482
17 Ga0070670_100697697 3300005331 Bacteria 913
18 Ga0068869_100050187 3300005334 Bacteria 3023
19 Ga0068869_100104447 3300005334 Bacteria 2147
20 Ga0068869_100203134 3300005334 Bacteria 1563
21 Ga0070666_11089529 3300005335 Bacteria 594
22 Ga0068868_100075750 3300005338 Bacteria 2689
23 Ga0068868_100239617 3300005338 Bacteria 1523
24 Ga0070660_100008526 3300005339 Bacteria 7176
25 Ga0070660_101314637 3300005339 Bacteria 614
26 Ga0070660_101870167 3300005339 Bacteria 512
27 Ga0070689_100067783 3300005340 Bacteria 2782
28 Ga0070691_10599003 3300005341 Bacteria 650
29 Ga0070661_100179640 3300005344 Bacteria 1610
30 Ga0070692_10001520 3300005345 Bacteria 8497
31 Ga0070692_10270399 3300005345 Bacteria 1026
32 Ga0070668_100544590 3300005347 Bacteria 1009
33 Ga0070669_100041630 3300005353 Bacteria 3341
34 Ga0070669_100753789 3300005353 Bacteria 825
35 Ga0070675_100070264 3300005354 Bacteria 2902
36 Ga0070675_100201635 3300005354 Bacteria 1727
37 Ga0070671_100063017 3300005355 Bacteria 3087
38 Ga0070674_100061218 3300005356 Bacteria 2626
39 Ga0070674_100108012 3300005356 Bacteria 2038
40 Ga0070673_100432397 3300005364 Bacteria 1182
41 Ga0070673_101183797 3300005364 Bacteria 716
42 Ga0070659_100020651 3300005366 Bacteria 5006
43 Ga0070659_100779518 3300005366 Bacteria 830
44 Ga0070667_100640819 3300005367 Bacteria 981
45 Ga0070667_101036403 3300005367 Bacteria 766
46 Ga0070713_101171416 3300005436 Bacteria 744
47 Ga0070701_10565909 3300005438 Bacteria 748
48 Ga0070705_100913520 3300005440 Bacteria 707
49 Ga0070694_100046478 3300005444 Plasmid 2914
50 Ga0070663_100061742 3300005455 Bacteria 2699
51 Ga0070663_100184286 3300005455 Bacteria 1621
52 Ga0070662_100297408 3300005457 Bacteria 1310
53 Ga0068867_100183160 3300005459 Bacteria 1666
54 Ga0070685_10005395 3300005466 Bacteria 6476
55 Ga0070707_100120557 3300005468 Bacteria 2547
56 Ga0070698_100481111 3300005471 Bacteria 1178
57 Ga0070679_101513457 3300005530 Bacteria 618
58 Ga0070684_101783583 3300005535 Bacteria 581
59 Ga0070697_100249152 3300005536 Bacteria 1518
60 Ga0068853_100095503 3300005539 Bacteria 2621
61 Ga0068853_100123106 3300005539 Bacteria 2315
62 Ga0070672_100084865 3300005543 Bacteria 2544
63 Ga0070686_100009530 3300005544 Bacteria 5460
64 Ga0070695_100185837 3300005545 Bacteria 1476
65 Ga0070696_101011763 3300005546 Bacteria 695
66 Ga0070693_100510889 3300005547 Bacteria 854
67 Ga0070665_100139155 3300005548 Bacteria 2431
68 Ga0070665_100219706 3300005548 Bacteria 1901
69 Ga0068855_100011948 3300005563 Bacteria 10497
70 Ga0068855_101798444 3300005563 Bacteria 623
71 Ga0070664_100269848 3300005564 Bacteria 1532
72 Ga0068857_100348583 3300005577 Bacteria 1371
73 Ga0068854_100103341 3300005578 Bacteria 2139
74 Ga0068854_100326319 3300005578 Unclassified 1249
75 Ga0068854_101497094 3300005578 Bacteria 612
76 Ga0070702_100141344 3300005615 Bacteria 1534
77 Ga0068852_101565377 3300005616 Bacteria 681
78 Ga0068859_100018943 3300005617 Bacteria 6914
79 Ga0068859_101889844 3300005617 Bacteria 659
80 Ga0068864_100117736 3300005618 Bacteria 2372
81 Ga0068864_101823713 3300005618 Bacteria 614
82 Ga0068866_10021347 3300005718 Bacteria 2981
83 Ga0068861_100075483 3300005719 Bacteria 2624
84 Ga0068851_10823469 3300005834 Bacteria 578
85 Ga0068863_100130986 3300005841 Bacteria 2395
86 Ga0068863_100175544 3300005841 Unclassified 2056
87 Ga0068863_101474097 3300005841 Bacteria 689
88 Ga0068858_100020313 3300005842 Bacteria 6212
89 Ga0068858_100129951 3300005842 Bacteria 2361
90 Ga0068860_100033151 3300005843 Bacteria 4957
91 Ga0068860_101059573 3300005843 Bacteria 830
92 Ga0068862_100095083 3300005844 Bacteria 2599
93 Ga0068862_100126301 3300005844 Bacteria 2258
94 Ga0068862_100855562 3300005844 Unclassified 891
95 Ga0081455_10066824 3300005937 Bacteria 3000
96 Ga0081455_10124196 3300005937 Bacteria 2029
97 Ga0075365_10075215 3300006038 Unclassified 2279
98 Ga0075368_10004346 3300006042 Bacteria 4793
99 Ga0075368_10060311 3300006042 Bacteria 1518
100 Ga0075363_100409058 3300006048 Bacteria 798
101 Ga0075363_100528862 3300006048 Bacteria 702
102 Ga0075364_10083913 3300006051 Bacteria 2109
103 Ga0070716_101016781 3300006173 Bacteria 656
104 Ga0075362_10061954 3300006177 Bacteria 1694
105 Ga0075367_10035698 3300006178 Bacteria 2879
106 Ga0075367_10452643 3300006178 Bacteria 813
107 Ga0075369_10215260 3300006186 Bacteria 889
108 Ga0075366_10046160 3300006195 Bacteria 2581
109 Ga0097621_100100547 3300006237 Bacteria 2432
110 Ga0097621_100265951 3300006237 Bacteria 1506
111 Ga0075370_10127418 3300006353 Bacteria 1484
112 Ga0075433_10033499 3300006852 Bacteria 4404
113 Ga0075433_10917738 3300006852 Bacteria 764
114 Ga0075434_100076839 3300006871 Bacteria 3334
115 Ga0068865_100071971 3300006881 Bacteria 2454
116 Ga0075436_101489310 3300006914 Bacteria 514
117 Ga0097620_100018944 3300006931 Bacteria 6914
118 Ga0097620_100620933 3300006931 Bacteria 1174
119 Ga0097620_101890959 3300006931 Bacteria 659
120 Ga0075435_100197386 3300007076 Bacteria 1704
121 Ga0099794_10002141 3300007265 Bacteria 7183
122 Ga0099794_10631749 3300007265 Bacteria 568
123 Ga0099795_10035775 3300007788 Bacteria 1738
124 Ga0105244_10413197 3300009036 Bacteria 621
125 Ga0111539_11580056 3300009094 Bacteria 761
126 Ga0105245_10063201 3300009098 Bacteria 3342
127 Ga0105245_10123037 3300009098 Bacteria 2425
128 Ga0105247_10011110 3300009101 Bacteria 5430
129 Ga0105247_10045127 3300009101 Bacteria 2704
130 Ga0105243_10065617 3300009148 Bacteria 2917
131 Ga0105243_10180617 3300009148 Bacteria 1835
132 Ga0105241_10340940 3300009174 Bacteria 1298
133 Ga0105241_10741829 3300009174 Unclassified 900
134 Ga0105242_11267805 3300009176 Bacteria 759
135 Ga0105238_10262480 3300009551 Bacteria 1707
136 Ga0105249_10038145 3300009553 Bacteria 4359
137 Ga0105249_10416625 3300009553 Bacteria 1376
138 Ga0105249_12213100 3300009553 Bacteria 623
139 Ga0105249_12526019 3300009553 Bacteria 586
140 Ga0099796_10001394 3300010159 Bacteria 4836
141 Ga0105239_10243144 3300010375 Bacteria 2020
142 Ga0105239_10279604 3300010375 Bacteria 1879
143 Ga0105239_10967861 3300010375 Bacteria 978
144 Ga0105246_10054748 3300011119 Bacteria 2751
145 Ga0105246_10107740 3300011119 Bacteria 2041
146 Ga0105246_10361770 3300011119 Bacteria 1192
147 Ga0105246_10421823 3300011119 Bacteria 1114
148 Ga0157329_1015799 3300012491 Bacteria 656
149 Ga0157327_1025004 3300012512 Unclassified 704
150 Ga0157374_10193322 3300013296 Bacteria 1990
151 Ga0157378_10029107 3300013297 Bacteria 4876
152 Ga0157378_10248141 3300013297 Bacteria 1703
153 Ga0157378_10508131 3300013297 Unclassified 1205
154 Ga0157378_11154489 3300013297 Bacteria 813
155 Ga0163162_10017467 3300013306 Bacteria 7019
156 Ga0163162_10045615 3300013306 Bacteria 4391
157 Ga0163162_10486000 3300013306 Bacteria 1366
158 Ga0163162_10529752 3300013306 Unclassified 1307
159 Ga0157372_10959872 3300013307 Bacteria 991
160 Ga0157375_10812441 3300013308 Bacteria 1083
161 Ga0163163_10010489 3300014325 Bacteria 8335
162 Ga0163163_10168343 3300014325 Bacteria 2238
163 Ga0157380_10026301 3300014326 Bacteria 4418
164 Ga0157380_11005187 3300014326 Bacteria 868
165 Ga0157377_10007782 3300014745 Bacteria 5193
166 Ga0157377_10757974 3300014745 Bacteria 711
167 Ga0157379_10294110 3300014968 Bacteria 1479
168 Ga0157379_11260503 3300014968 Bacteria 713
169 Ga0157379_12198775 3300014968 Bacteria 548
170 Ga0157376_10202545 3300014969 Bacteria 1827
171 Ga0163161_10707867 3300017792 Bacteria 839
172 Ga0213872_10008745 3300021361 Bacteria 4888
173 Ga0209564_1007172 3300025295 Bacteria 5809
174 Ga0209758_1000173 3300025297 Bacteria 147509
175 Ga0209256_1029307 3300025299 Bacteria 1536
176 Ga0207697_10156514 3300025315 Bacteria 993
177 Ga0207642_10201803 3300025899 Bacteria 1099
178 Ga0207710_10654351 3300025900 Bacteria 550
179 Ga0207688_10068365 3300025901 Bacteria 2011
180 Ga0207688_10273859 3300025901 Bacteria 1027
181 Ga0207680_10054472 3300025903 Bacteria 2406
182 Ga0207647_10006168 3300025904 Bacteria 8733
183 Ga0207647_10009395 3300025904 Bacteria 6949
184 Ga0207647_10084699 3300025904 Bacteria 1897
185 Ga0207645_10051285 3300025907 Bacteria 2636
186 Ga0207684_10014543 3300025910 Bacteria 6780
187 Ga0207671_10140886 3300025914 Bacteria 1858
188 Ga0207693_11461374 3300025915 Bacteria 505
189 Ga0207662_10074838 3300025918 Bacteria 2056
190 Ga0207657_10054588 3300025919 Bacteria 3455
191 Ga0207657_10153538 3300025919 Bacteria 1874
192 Ga0207646_10827665 3300025922 Bacteria 823
193 Ga0207681_10009905 3300025923 Bacteria 5831
194 Ga0207681_10119477 3300025923 Bacteria 1931
195 Ga0207681_10151436 3300025923 Bacteria 1739
196 Ga0207650_10023448 3300025925 Bacteria 4375
197 Ga0207650_10081032 3300025925 Bacteria 2462
198 Ga0207650_11368986 3300025925 Bacteria 602
199 Ga0207659_10069215 3300025926 Bacteria 2569
200 Ga0207659_10549654 3300025926 Bacteria 981
201 Ga0207687_10105752 3300025927 Bacteria 2079
202 Ga0207687_10123361 3300025927 Bacteria 1941
203 Ga0207687_10308340 3300025927 Bacteria 1277
204 Ga0207644_10080247 3300025931 Bacteria 2409
205 Ga0207644_10232281 3300025931 Bacteria 1466
206 Ga0207690_10013127 3300025932 Bacteria 4970
207 Ga0207706_10010577 3300025933 Bacteria 8426
208 Ga0207706_10039777 3300025933 Bacteria 4169
209 Ga0207709_10019730 3300025935 Bacteria 3795
210 Ga0207709_10191160 3300025935 Bacteria 1454
211 Ga0207670_10040813 3300025936 Bacteria 3048
212 Ga0207669_10092830 3300025937 Bacteria 1970
213 Ga0207669_10640057 3300025937 Bacteria 868
214 Ga0207704_10116794 3300025938 Bacteria 1816
215 Ga0207665_10830971 3300025939 Bacteria 731
216 Ga0207691_10079734 3300025940 Bacteria 2946
217 Ga0207711_10109122 3300025941 Bacteria 2459
218 Ga0207711_10689393 3300025941 Bacteria 953
219 Ga0207689_10029750 3300025942 Bacteria 4556
220 Ga0207689_10079890 3300025942 Bacteria 2688
221 Ga0207689_10909780 3300025942 Bacteria 742
222 Ga0207661_10303967 3300025944 Bacteria 1431
223 Ga0207667_10012166 3300025949 Bacteria 9938
224 Ga0207667_10606354 3300025949 Bacteria 1103
225 Ga0207651_10447600 3300025960 Bacteria 1108
226 Ga0207712_10008007 3300025961 Bacteria 6682
227 Ga0207668_10134425 3300025972 Unclassified 1893
228 Ga0207668_10357722 3300025972 Bacteria 1222
229 Ga0207668_10854486 3300025972 Bacteria 808
230 Ga0207640_10134772 3300025981 Bacteria 1791
231 Ga0207640_10236781 3300025981 Bacteria 1408
232 Ga0207640_10295621 3300025981 Bacteria 1279
233 Ga0207658_10688619 3300025986 Bacteria 923
234 Ga0207658_10991904 3300025986 Bacteria 766
235 Ga0207677_10132993 3300026023 Bacteria 1892
236 Ga0207703_10001629 3300026035 Bacteria 20226
237 Ga0207703_10053330 3300026035 Bacteria 3286
238 Ga0207703_10457419 3300026035 Bacteria 1193
239 Ga0207639_10320671 3300026041 Bacteria 1376
240 Ga0207639_10497252 3300026041 Bacteria 1113
241 Ga0207639_11215465 3300026041 Bacteria 707
242 Ga0207678_10235587 3300026067 Bacteria 1567
243 Ga0207708_10024107 3300026075 Bacteria 4600
244 Ga0207641_10184655 3300026088 Unclassified 1912
245 Ga0207641_10446150 3300026088 Bacteria 1250
246 Ga0207641_10468874 3300026088 Unclassified 1219
247 Ga0207641_10634801 3300026088 Bacteria 1048
248 Ga0207641_11747128 3300026088 Bacteria 624
249 Ga0207648_10699406 3300026089 Bacteria 939
250 Ga0207676_10079967 3300026095 Bacteria 2652
251 Ga0207676_10100396 3300026095 Bacteria 2398
252 Ga0207674_10026609 3300026116 Bacteria 6138
253 Ga0207674_10104181 3300026116 Bacteria 2816
254 Ga0207675_100003967 3300026118 Bacteria 14363
255 Ga0207675_100185703 3300026118 Bacteria 1993
256 Ga0209588_1000515 3300027671 Bacteria 9898
257 Ga0209813_10054559 3300027866 Bacteria 1260
258 Ga0209813_10367805 3300027866 Bacteria 573
259 Ga0268265_10002417 3300028380 Bacteria 14102
260 Ga0268265_10140829 3300028380 Bacteria 2019
261 Ga0268265_10763387 3300028380 Bacteria 939
262 Ga0268265_10859351 3300028380 Unclassified 888
263 Ga0268265_11222339 3300028380 Bacteria 749
264 Ga0268264_10000080 3300028381 Bacteria 249126
265 Ga0268264_10001941 3300028381 Bacteria 18608
266 Ga0268264_10082549 3300028381 Bacteria 2750
267 Ga0307517_10029095 3300028786 Bacteria 6544
268 Ga0307513_10008025 3300031456 Bacteria 13562
269 Ga0307513_10155669 3300031456 Bacteria 2186
270 Ga0307513_10199408 3300031456 Bacteria 1844
271 Ga0307408_100034255 3300031548 Bacteria 3555
272 Ga0307408_100600722 3300031548 Bacteria 978
273 Ga0307405_10062865 3300031731 Bacteria 2352
274 Ga0307413_10005180 3300031824 Bacteria 5782
275 Ga0307413_10012836 3300031824 Bacteria 4184
276 Ga0307413_10768360 3300031824 Bacteria 807
277 Ga0307410_10000171 3300031852 Bacteria 23683
278 Ga0307406_10559269 3300031901 Bacteria 937
279 Ga0307406_10999396 3300031901 Bacteria 718
280 Ga0307407_10011957 3300031903 Bacteria 4155
281 Ga0307407_10018062 3300031903 Bacteria 3556
282 Ga0307412_10177506 3300031911 Bacteria 1598
283 Ga0307412_10179521 3300031911 Bacteria 1591
284 Ga0307409_100030101 3300031995 Bacteria 3895
285 Ga0307409_100621845 3300031995 Unclassified 1070
286 Ga0307409_101322694 3300031995 Bacteria 746
287 Ga0307416_100273773 3300032002 Bacteria 1659
288 Ga0307416_101390400 3300032002 Bacteria 808
289 Ga0307414_10003418 3300032004 Bacteria 8470
290 Ga0307411_10016187 3300032005 Bacteria 4216
291 Ga0307411_10106131 3300032005 Bacteria 1998
292 Ga0307415_100026068 3300032126 Bacteria 3680
293 Ga0307415_100325103 3300032126 Bacteria 1284
294 Ga0373940_0278613 3300035088 Bacteria 571
295 Ga0373932_0072556 3300035112 Bacteria 1071
296 Ga0395901_0545036 3300038443 Bacteria 1176
297 Ga0436360_0942008 3300039438 Bacteria 3040
298 Ga0436361_0150954 3300039447 Bacteria 12640
299 Ga0439465_0111271 3300041413 Bacteria 953
300 Ga0451797_1443354 3300041453 Bacteria 887
301 Ga0451837_0903276 3300041494 Bacteria 3379
302 Ga0451577_0235754 3300042876 Bacteria 1655
303 Ga0451577_0841724 3300042876 Bacteria 828
304 Ga0453683_0015570 3300044673 Bacteria 4922
305 Ga0453684_0089205 3300044712 Bacteria 3815
306 Ga0495627_082147 3300046453 Bacteria 933
307 Ga0495591_117534 3300046458 Bacteria 650
308 Ga0495638_0025184 3300046460 Bacteria 3871
309 Ga0495638_0175723 3300046460 Bacteria 1225
310 Ga0495605_0275506 3300046474 Bacteria 716
311 Ga0495584_0000160 3300046491 Bacteria 47133
312 Ga0495584_0053084 3300046491 Bacteria 2040
313 Ga0495585_0000398 3300046492 Bacteria 42060
314 Ga0495585_0083869 3300046492 Bacteria 1724
315 Ga0495596_0000659 3300046500 Bacteria 21597
316 Ga0495596_0109568 3300046500 Bacteria 1072
317 Ga0495607_0192178 3300046501 Bacteria 1016
318 Ga0495583_0416596 3300046506 Bacteria 527
319 Ga0495610_0292264 3300046512 Bacteria 631
320 Ga0495616_0007412 3300046513 Bacteria 6565
321 Ga0495616_0056544 3300046513 Bacteria 1937
322 Ga0495616_0460190 3300046513 Bacteria 514
323 Ga0495620_0198455 3300046515 Bacteria 772
324 Ga0495628_0182625 3300046516 Bacteria 1586
325 Ga0495631_0153245 3300046518 Bacteria 989
326 Ga0495643_0015528 3300046522 Bacteria 4497
327 Ga0495644_0047458 3300046523 Bacteria 1613
328 Ga0495648_0083210 3300046524 Bacteria 1814
329 Ga0495587_0201092 3300046536 Bacteria 1127
330 Ga0495598_0025190 3300046537 Bacteria 1620
331 Ga0495609_0047627 3300046538 Bacteria 1918
332 Ga0495621_0527939 3300046539 Bacteria 511
333 Ga0495622_0112390 3300046557 Bacteria 1247
334 Ga0495633_0001540 3300046558 Bacteria 17708
335 Ga0495656_0395466 3300046615 Unclassified 722
336 Ga0495668_0029781 3300046616 Bacteria 3084
337 Ga0495659_0207828 3300046664 Bacteria 805
338 Ga0495669_0307188 3300046684 Bacteria 765
339 Ga0495670_0364528 3300046691 Unclassified 778
340 Ga0495671_0158035 3300046692 Bacteria 1103
341 Ga0495649_0367482 3300046694 Bacteria 725
342 Ga0495649_0468523 3300046694 Bacteria 628
343 Ga0495674_0454633 3300047319 Bacteria 1029
344 Ga0495672_0124474 3300047320 Bacteria 1365
345 Ga0495683_0000342 3300047323 Bacteria 38556
346 Ga0495687_008059 3300047443 Bacteria 6087
347 Ga0495679_169536 3300047446 Bacteria 581
348 Ga0495626_0325991 3300048091 Bacteria 603
349 Ga0496100_0107650 3300048903 Bacteria 1931
350 Ga0496100_0588108 3300048903 Bacteria 863
351 Ga0496100_0748173 3300048903 Bacteria 764
352 Ga0496100_0804445 3300048903 Bacteria 736
353 Ga0496100_0966020 3300048903 Bacteria 670
354 Ga0496101_0127776 3300048904 Bacteria 1927
355 Ga0496101_0154011 3300048904 Bacteria 1759
356 Ga0496101_0188227 3300048904 Bacteria 1592
357 Ga0496102_0012160 3300048905 Bacteria 7441
358 Ga0496102_0035080 3300048905 Bacteria 4514
359 Ga0496102_1462311 3300048905 Bacteria 602
360 Ga0496103_0040888 3300048906 Bacteria 2849
361 Ga0496103_0050708 3300048906 Bacteria 2567
362 Ga0496104_0000611 3300048907 Bacteria 30606
363 Ga0496104_0024513 3300048907 Bacteria 5549
364 Ga0496104_1235077 3300048907 Bacteria 650
365 Ga0496105_0012172 3300048908 Bacteria 6810
366 Ga0496105_0052199 3300048908 Bacteria 3376
367 Ga0496105_0145595 3300048908 Bacteria 1948
368 Ga0496106_0225130 3300048909 Bacteria 1496
369 Ga0496106_0357361 3300048909 Bacteria 1173
370 Ga0496107_0006189 3300048910 Bacteria 8222
371 Ga0496107_0125121 3300048910 Bacteria 1896
372 Ga0496107_0274240 3300048910 Bacteria 1255
373 Ga0496108_0230597 3300048911 Bacteria 1610
374 Ga0496108_1236717 3300048911 Bacteria 630
375 Ga0496109_0029129 3300048912 Bacteria 4942
376 Ga0496110_0007155 3300048913 Bacteria 8885
377 Ga0496110_0056957 3300048913 Bacteria 3439
378 Ga0496110_0237960 3300048913 Bacteria 1656
379 Ga0496110_1693222 3300048913 Bacteria 542
380 Ga0496111_0363992 3300048914 Bacteria 1070
381 Ga0496111_0790625 3300048914 Bacteria 687
382 Ga0496111_0844753 3300048914 Bacteria 661
383 Ga0496113_0003753 3300048916 Bacteria 9163
384 Ga0496113_0788312 3300048916 Bacteria 755
385 Ga0496113_0850709 3300048916 Bacteria 723
386 Ga0496114_0010090 3300048917 Bacteria 7512
387 Ga0496114_0226087 3300048917 Bacteria 1643
388 Ga0496115_0028427 3300048918 Bacteria 4383
389 Ga0496115_0104504 3300048918 Bacteria 2324
390 Ga0496115_1062987 3300048918 Bacteria 615
391 Ga0496118_0043025 3300048921 Bacteria 3555
392 Ga0496119_0428596 3300048922 Bacteria 626
393 Ga0496121_0158844 3300048924 Bacteria 1655
394 Ga0496123_0480185 3300048926 Bacteria 547
395 Ga0496124_0181554 3300048927 Bacteria 1619
396 Ga0496124_0191234 3300048927 Bacteria 1566
397 Ga0495682_0076445 3300049460 Bacteria 1204
398 Ga0501291_136983 3300049514 Bacteria 544
399 Ga0501303_028536 3300049526 Bacteria 639
400 Ga0501036_0104004 3300049572 Bacteria 2401
401 Ga0501037_0034767 3300049573 Bacteria 3718
402 Ga0501038_0008587 3300049574 Bacteria 9376
403 Ga0501040_0000127 3300049576 Bacteria 40573
404 Ga0501041_0003680 3300049577 Bacteria 8814
405 Ga0501042_0000246 3300049578 Bacteria 26241
406 Ga0501043_0122236 3300049579 Bacteria 2042
407 Ga0501048_0189482 3300049582 Bacteria 1457
408 Ga0501068_0028671 3300049584 Bacteria 3294
409 Ga0501070_0036468 3300049586 Bacteria 4106
410 Ga0501071_0021368 3300049587 Bacteria 4505
411 Ga0501072_0003073 3300049588 Bacteria 12583
412 Ga0501074_0050791 3300049590 Bacteria 2993
413 Ga0501075_0000313 3300049591 Bacteria 27151
414 Ga0501076_0004044 3300049592 Bacteria 10363
415 Ga0501077_0093889 3300049593 Bacteria 1901
416 Ga0501219_000020 3300049703 Bacteria 25032
417 Ga0501079_0004665 3300049741 Bacteria 10152
418 Ga0501080_0044977 3300049742 Bacteria 4110
419 Ga0501081_0009936 3300049743 Bacteria 6200
420 Ga0501045_0002209 3300049824 Bacteria 13199
421 Ga0501284_00030 3300050005 Bacteria 71858
422 nmdc:mga03683_264457_c1 3300050489 Bacteria 801
423 nmdc:mga03683_296585_c1 3300050489 Bacteria 757
424 nmdc:mga00v17_331373_c1 3300050491 Bacteria 989
425 nmdc:mga0yw44_21882_c1 3300050492 Bacteria 3575
426 nmdc:mga0k408_414896_c1 3300050493 Bacteria 801
427 nmdc:mga0k408_437109_c1 3300050493 Bacteria 777
428 nmdc:mga06z11_205085_c1 3300050494 Bacteria 1147
429 nmdc:mga06z11_700739_c1 3300050494 Bacteria 617
430 nmdc:mga04h51_178827_c1 3300050495 Bacteria 825
431 nmdc:mga04h51_295189_c1 3300050495 Bacteria 659
432 nmdc:mga07m45_87057_c1 3300050496 Bacteria 1787
433 nmdc:mga05p37_381852_c1 3300050507 Bacteria 1650
434 nmdc:mga08y16_827749_c1 3300050511 Bacteria 916
435 nmdc:mga0n895_65191_c1 3300050512 Bacteria 3605
436 nmdc:mga0rr50_128802_c1 3300050513 Bacteria 2024
437 nmdc:mga0a205_284476_c1 3300050515 Bacteria 1529
438 nmdc:mga0a205_52452_c1 3300050515 Bacteria 3936
439 nmdc:mga0sz30_134551_c1 3300050516 Bacteria 1090
440 Ga0495601_0822270 3300053077 Bacteria 589
441 Ga0495655_0113445 3300053083 Bacteria 817
442 Ga0500643_000032 3300053087 Bacteria 200350
443 Ga0500583_0028191 3300053092 Bacteria 2433
444 Ga0500555_022149 3300053103 Bacteria 1827
445 Ga0500556_0005113 3300053104 Bacteria 3712
446 Ga0500642_0034622 3300053130 Bacteria 2139
447 Ga0500658_0022257 3300053134 Bacteria 2408
448 Ga0500568_0010604 3300053139 Bacteria 4303
449 Ga0500589_071389 3300053147 Bacteria 1570
450 Ga0500616_0055048 3300053153 Bacteria 2082
451 Ga0500620_158521 3300053155 Bacteria 786
452 Ga0500627_0071441 3300053158 Bacteria 1538
453 Ga0500645_001376 3300053730 Bacteria 12466
454 Ga0501084_0106336 3300054114 Bacteria 2357
455 Ga0501082_0027608 3300060353 Bacteria 4886
456 Ga0530510_0003459 3300061734 Bacteria 10856
457 2824687417 2824679649 Bacteria 8248951
458 2879105703 2879099564 Bacteria 10442239
459 2885412497 2885409591 Bacteria 9235467
460 2888384268 2888378607 Bacteria 9652610
461 2922400598 2922393267 Bacteria 8285685
462 2932790572 2932784394 Bacteria 9704911
463 2932810993 2932809354 Bacteria 9135765
464 2932823677 2932818245 Bacteria 9955613
465 2932830203 2932828146 Bacteria 9745859
466 2935622571 2935616580 Bacteria 9032984
467 2935642629 2935638405 Bacteria 10015038
468 2935668067 2935665750 Bacteria 9571747
469 2935676100 2935675223 Bacteria 9928132
470 2935701290 2935694250 Bacteria 9291695
471 2935705927 2935703347 Bacteria 10242284
472 2935766397 2935760218 Bacteria 9817913
473 2935814243 2935810662 Bacteria 9401221
474 2935831380 2935827899 Bacteria 10038562
475 2935838240 2935837841 Bacteria 9454360
476 2935860820 2935855204 Bacteria 9035059
477 2935869843 2935864058 Bacteria 9784707
478 2935878738 2935873716 Bacteria 9632195
479 2935994866 2935992306 Bacteria 9802711
480 2936003509 2936002035 Bacteria 9362176
481 2936039799 2936037263 Bacteria 9446081
482 2941539092 2941538514 Bacteria 9402094
483 8016522106 8016511872 Bacteria 9921665
484 8017063562 8017057580 Bacteria 10023680
485 8019582881 8019576017 Bacteria 10049540
486 8019590675 8019586578 Bacteria 10212056
487 8019600673 8019597564 Bacteria 10041141
488 8019617873 8019608314 Bacteria 10042931
489 Ga0451851_0114106
490 JGI24746J21847_1063338
491 JGI24743J22301_10046283
492 JGI24738J21930_10007072
493 JGI24749J21850_1022303
494 JGI24744J21845_10014554
495 JGI24033J26618_1007031
496 JGI24034J26672_10032088
497 JGI24742J22300_10026450
498 JGI24751J29686_10007778
499 Ga0055526_1101460
500 Ga0065715_10109770
501 Ga0070676_10852159
502 Ga0070690_100094806
503 Ga0070670_100010619
504 Ga0070670_100053049
505 Ga0070670_100697697
506 Ga0068869_100050187
507 Ga0068869_100104447
508 Ga0068869_100203134
509 Ga0070666_11089529
510 Ga0068868_100075750
511 Ga0068868_100239617
512 Ga0070660_100008526
513 Ga0070660_101314637
514 Ga0070660_101870167
515 Ga0070689_100067783
516 Ga0070691_10599003
517 Ga0070661_100179640
518 Ga0070692_10001520
519 Ga0070692_10270399
520 Ga0070668_100544590
521 Ga0070669_100041630
522 Ga0070669_100753789
523 Ga0070675_100070264
524 Ga0070675_100201635
525 Ga0070671_100063017
526 Ga0070674_100061218
527 Ga0070674_100108012
528 Ga0070673_100432397
529 Ga0070673_101183797
530 Ga0070659_100020651
531 Ga0070659_100779518
532 Ga0070667_100640819
533 Ga0070667_101036403
534 Ga0070713_101171416
535 Ga0070701_10565909
536 Ga0070705_100913520
537 Ga0070694_100046478
538 Ga0070663_100061742
539 Ga0070663_100184286
540 Ga0070662_100297408
541 Ga0068867_100183160
542 Ga0070685_10005395
543 Ga0070707_100120557
544 Ga0070698_100481111
545 Ga0070679_101513457
546 Ga0070684_101783583
547 Ga0070697_100249152
548 Ga0068853_100095503
549 Ga0068853_100123106
550 Ga0070672_100084865
551 Ga0070686_100009530
552 Ga0070695_100185837
553 Ga0070696_101011763
554 Ga0070693_100510889
555 Ga0070665_100139155
556 Ga0070665_100219706
557 Ga0068855_100011948
558 Ga0068855_101798444
559 Ga0070664_100269848
560 Ga0068857_100348583
561 Ga0068854_100103341
562 Ga0068854_100326319
563 Ga0068854_101497094
564 Ga0070702_100141344
565 Ga0068852_101565377
566 Ga0068859_100018943
567 Ga0068859_101889844
568 Ga0068864_100117736
569 Ga0068864_101823713
570 Ga0068866_10021347
571 Ga0068861_100075483
572 Ga0068851_10823469
573 Ga0068863_100130986
574 Ga0068863_100175544
575 Ga0068863_101474097
576 Ga0068858_100020313
577 Ga0068858_100129951
578 Ga0068860_100033151
579 Ga0068860_101059573
580 Ga0068862_100095083
581 Ga0068862_100126301
582 Ga0068862_100855562
583 Ga0081455_10066824
584 Ga0081455_10124196
585 Ga0075365_10075215
586 Ga0075368_10004346
587 Ga0075368_10060311
588 Ga0075363_100409058
589 Ga0075363_100528862
590 Ga0075364_10083913
591 Ga0070716_101016781
592 Ga0075362_10061954
593 Ga0075367_10035698
594 Ga0075367_10452643
595 Ga0075369_10215260
596 Ga0075366_10046160
597 Ga0097621_100100547
598 Ga0097621_100265951
599 Ga0075370_10127418
600 Ga0075433_10033499
601 Ga0075433_10917738
602 Ga0075434_100076839
603 Ga0068865_100071971
604 Ga0075436_101489310
605 Ga0097620_100018944
606 Ga0097620_100620933
607 Ga0097620_101890959
608 Ga0075435_100197386
609 Ga0099794_10002141
610 Ga0099794_10631749
611 Ga0099795_10035775
612 Ga0105244_10413197
613 Ga0111539_11580056
614 Ga0105245_10063201
615 Ga0105245_10123037
616 Ga0105247_10011110
617 Ga0105247_10045127
618 Ga0105243_10065617
619 Ga0105243_10180617
620 Ga0105241_10340940
621 Ga0105241_10741829
622 Ga0105242_11267805
623 Ga0105238_10262480
624 Ga0105249_10038145
625 Ga0105249_10416625
626 Ga0105249_12213100
627 Ga0105249_12526019
628 Ga0099796_10001394
629 Ga0105239_10243144
630 Ga0105239_10279604
631 Ga0105239_10967861
632 Ga0105246_10054748
633 Ga0105246_10107740
634 Ga0105246_10361770
635 Ga0105246_10421823
636 Ga0157329_1015799
637 Ga0157327_1025004
638 Ga0157374_10193322
639 Ga0157378_10029107
640 Ga0157378_10248141
641 Ga0157378_10508131
642 Ga0157378_11154489
643 Ga0163162_10017467
644 Ga0163162_10045615
645 Ga0163162_10486000
646 Ga0163162_10529752
647 Ga0157372_10959872
648 Ga0157375_10812441
649 Ga0163163_10010489
650 Ga0163163_10168343
651 Ga0157380_10026301
652 Ga0157380_11005187
653 Ga0157377_10007782
654 Ga0157377_10757974
655 Ga0157379_10294110
656 Ga0157379_11260503
657 Ga0157379_12198775
658 Ga0157376_10202545
659 Ga0163161_10707867
660 Ga0213872_10008745
661 Ga0209564_1007172
662 Ga0209758_1000173
663 Ga0209256_1029307
664 Ga0207697_10156514
665 Ga0207642_10201803
666 Ga0207710_10654351
667 Ga0207688_10068365
668 Ga0207688_10273859
669 Ga0207680_10054472
670 Ga0207647_10006168
671 Ga0207647_10009395
672 Ga0207647_10084699
673 Ga0207645_10051285
674 Ga0207684_10014543
675 Ga0207671_10140886
676 Ga0207693_11461374
677 Ga0207662_10074838
678 Ga0207657_10054588
679 Ga0207657_10153538
680 Ga0207646_10827665
681 Ga0207681_10009905
682 Ga0207681_10119477
683 Ga0207681_10151436
684 Ga0207650_10023448
685 Ga0207650_10081032
686 Ga0207650_11368986
687 Ga0207659_10069215
688 Ga0207659_10549654
689 Ga0207687_10105752
690 Ga0207687_10123361
691 Ga0207687_10308340
692 Ga0207644_10080247
693 Ga0207644_10232281
694 Ga0207690_10013127
695 Ga0207706_10010577
696 Ga0207706_10039777
697 Ga0207709_10019730
698 Ga0207709_10191160
699 Ga0207670_10040813
700 Ga0207669_10092830
701 Ga0207669_10640057
702 Ga0207704_10116794
703 Ga0207665_10830971
704 Ga0207691_10079734
705 Ga0207711_10109122
706 Ga0207711_10689393
707 Ga0207689_10029750
708 Ga0207689_10079890
709 Ga0207689_10909780
710 Ga0207661_10303967
711 Ga0207667_10012166
712 Ga0207667_10606354
713 Ga0207651_10447600
714 Ga0207712_10008007
715 Ga0207668_10134425
716 Ga0207668_10357722
717 Ga0207668_10854486
718 Ga0207640_10134772
719 Ga0207640_10236781
720 Ga0207640_10295621
721 Ga0207658_10688619
722 Ga0207658_10991904
723 Ga0207677_10132993
724 Ga0207703_10001629
725 Ga0207703_10053330
726 Ga0207703_10457419
727 Ga0207639_10320671
728 Ga0207639_10497252
729 Ga0207639_11215465
730 Ga0207678_10235587
731 Ga0207708_10024107
732 Ga0207641_10184655
733 Ga0207641_10446150
734 Ga0207641_10468874
735 Ga0207641_10634801
736 Ga0207641_11747128
737 Ga0207648_10699406
738 Ga0207676_10079967
739 Ga0207676_10100396
740 Ga0207674_10026609
741 Ga0207674_10104181
742 Ga0207675_100003967
743 Ga0207675_100185703
744 Ga0209588_1000515
745 Ga0209813_10054559
746 Ga0209813_10367805
747 Ga0268265_10002417
748 Ga0268265_10140829
749 Ga0268265_10763387
750 Ga0268265_10859351
751 Ga0268265_11222339
752 Ga0268264_10000080
753 Ga0268264_10001941
754 Ga0268264_10082549
755 Ga0307517_10029095
756 Ga0307513_10008025
757 Ga0307513_10155669
758 Ga0307513_10199408
759 Ga0307408_100034255
760 Ga0307408_100600722
761 Ga0307405_10062865
762 Ga0307413_10005180
763 Ga0307413_10012836
764 Ga0307413_10768360
765 Ga0307410_10000171
766 Ga0307406_10559269
767 Ga0307406_10999396
768 Ga0307407_10011957
769 Ga0307407_10018062
770 Ga0307412_10177506
771 Ga0307412_10179521
772 Ga0307409_100030101
773 Ga0307409_100621845
774 Ga0307409_101322694
775 Ga0307416_100273773
776 Ga0307416_101390400
777 Ga0307414_10003418
778 Ga0307411_10016187
779 Ga0307411_10106131
780 Ga0307415_100026068
781 Ga0307415_100325103
782 Ga0373940_0278613
783 Ga0373932_0072556
784 Ga0395901_0545036
785 Ga0436360_0942008
786 Ga0436361_0150954
787 Ga0439465_0111271
788 Ga0451797_1443354
789 Ga0451837_0903276
790 Ga0451577_0235754
791 Ga0451577_0841724
792 Ga0453683_0015570
793 Ga0453684_0089205
794 Ga0495627_082147
795 Ga0495591_117534
796 Ga0495638_0025184
797 Ga0495638_0175723
798 Ga0495605_0275506
799 Ga0495584_0000160
800 Ga0495584_0053084
801 Ga0495585_0000398
802 Ga0495585_0083869
803 Ga0495596_0000659
804 Ga0495596_0109568
805 Ga0495607_0192178
806 Ga0495583_0416596
807 Ga0495610_0292264
808 Ga0495616_0007412
809 Ga0495616_0056544
810 Ga0495616_0460190
811 Ga0495620_0198455
812 Ga0495628_0182625
813 Ga0495631_0153245
814 Ga0495643_0015528
815 Ga0495644_0047458
816 Ga0495648_0083210
817 Ga0495587_0201092
818 Ga0495598_0025190
819 Ga0495609_0047627
820 Ga0495621_0527939
821 Ga0495622_0112390
822 Ga0495633_0001540
823 Ga0495656_0395466
824 Ga0495668_0029781
825 Ga0495659_0207828
826 Ga0495669_0307188
827 Ga0495670_0364528
828 Ga0495671_0158035
829 Ga0495649_0367482
830 Ga0495649_0468523
831 Ga0495674_0454633
832 Ga0495672_0124474
833 Ga0495683_0000342
834 Ga0495687_008059
835 Ga0495679_169536
836 Ga0495626_0325991
837 Ga0496100_0107650
838 Ga0496100_0588108
839 Ga0496100_0748173
840 Ga0496100_0804445
841 Ga0496100_0966020
842 Ga0496101_0127776
843 Ga0496101_0154011
844 Ga0496101_0188227
845 Ga0496102_0012160
846 Ga0496102_0035080
847 Ga0496102_1462311
848 Ga0496103_0040888
849 Ga0496103_0050708
850 Ga0496104_0000611
851 Ga0496104_0024513
852 Ga0496104_1235077
853 Ga0496105_0012172
854 Ga0496105_0052199
855 Ga0496105_0145595
856 Ga0496106_0225130
857 Ga0496106_0357361
858 Ga0496107_0006189
859 Ga0496107_0125121
860 Ga0496107_0274240
861 Ga0496108_0230597
862 Ga0496108_1236717
863 Ga0496109_0029129
864 Ga0496110_0007155
865 Ga0496110_0056957
866 Ga0496110_0237960
867 Ga0496110_1693222
868 Ga0496111_0363992
869 Ga0496111_0790625
870 Ga0496111_0844753
871 Ga0496113_0003753
872 Ga0496113_0788312
873 Ga0496113_0850709
874 Ga0496114_0010090
875 Ga0496114_0226087
876 Ga0496115_0028427
877 Ga0496115_0104504
878 Ga0496115_1062987
879 Ga0496118_0043025
880 Ga0496119_0428596
881 Ga0496121_0158844
882 Ga0496123_0480185
883 Ga0496124_0181554
884 Ga0496124_0191234
885 Ga0495682_0076445
886 Ga0501291_136983
887 Ga0501303_028536
888 Ga0501036_0104004
889 Ga0501037_0034767
890 Ga0501038_0008587
891 Ga0501040_0000127
892 Ga0501041_0003680
893 Ga0501042_0000246
894 Ga0501043_0122236
895 Ga0501048_0189482
896 Ga0501068_0028671
897 Ga0501070_0036468
898 Ga0501071_0021368
899 Ga0501072_0003073
900 Ga0501074_0050791
901 Ga0501075_0000313
902 Ga0501076_0004044
903 Ga0501077_0093889
904 Ga0501219_000020
905 Ga0501079_0004665
906 Ga0501080_0044977
907 Ga0501081_0009936
908 Ga0501045_0002209
909 Ga0501284_00030
910 nmdc:mga03683_264457_c1
911 nmdc:mga03683_296585_c1
912 nmdc:mga00v17_331373_c1
913 nmdc:mga0yw44_21882_c1
914 nmdc:mga0k408_414896_c1
915 nmdc:mga0k408_437109_c1
916 nmdc:mga06z11_205085_c1
917 nmdc:mga06z11_700739_c1
918 nmdc:mga04h51_178827_c1
919 nmdc:mga04h51_295189_c1
920 nmdc:mga07m45_87057_c1
921 nmdc:mga05p37_381852_c1
922 nmdc:mga08y16_827749_c1
923 nmdc:mga0n895_65191_c1
924 nmdc:mga0rr50_128802_c1
925 nmdc:mga0a205_284476_c1
926 nmdc:mga0a205_52452_c1
927 nmdc:mga0sz30_134551_c1
928 Ga0495601_0822270
929 Ga0495655_0113445
930 Ga0500643_000032
931 Ga0500583_0028191
932 Ga0500555_022149
933 Ga0500556_0005113
934 Ga0500642_0034622
935 Ga0500658_0022257
936 Ga0500568_0010604
937 Ga0500589_071389
938 Ga0500616_0055048
939 Ga0500620_158521
940 Ga0500627_0071441
941 Ga0500645_001376
942 Ga0501084_0106336
943 Ga0501082_0027608
944 Ga0530510_0003459
945 2824687417
946 2879105703
947 2885412497
948 2888384268
949 2922400598
950 2932790572
951 2932810993
952 2932823677
953 2932830203
954 2935622571
955 2935642629
956 2935668067
957 2935676100
958 2935701290
959 2935705927
960 2935766397
961 2935814243
962 2935831380
963 2935838240
964 2935860820
965 2935869843
966 2935878738
967 2935994866
968 2936003509
969 2936039799
970 2941539092
971 8016522106
972 8017063562
973 8019582881
974 8019590675
975 8019600673
976 8019617873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

76

147

0.92

PF02311

AraC_binding

AraC-like ligand binding domain

77

149

0.89

PF05899

Cupin_3

EutQ-like cupin domain

71

148

0.85

PF00190

Cupin_1

Cupin

46

152

0.82

PF12973

Cupin_7

ChrR Cupin-like domain

48

145

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.9201 30 123
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9194 30 123
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.9172 47 119
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.9156 47 119
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.9151 29 120
ID Description Score Start End Superfamily
3kscB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9302 47 120 2.60.120.10
af_Q4DVQ0_817_1084_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9245 49 120 2.60.120.650
3kglF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9166 47 120 2.60.120.10
5cadA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9139 47 132 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9074 47 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V8F7R1-F1-model_v4 Dimethlysulfonioproprionate lyase DddQ 0.99 28 133 GO:0016829
AF-A0A7Y2MIC3-F1-model_v4 Cupin domain-containing protein 0.9898 29 133
AF-A0A0T6AEB5-F1-model_v4 Cupin type-2 domain-containing protein 0.9896 30 133
AF-A0A4P6FSA4-F1-model_v4 Cupin domain-containing protein 0.9892 25 133
AF-A0A853CH82-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9891 29 133 GO:0051213

Map