F453399

General Info

Members Datasets Scaffolds Average Seq Length
487 301 442 169

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100259805|Ga0070670_1002598051
Length 198
Sequence MASEGPLEYPPSPQAPAAVALHQEPGMASTQDARNDRPPLVGIVMGSRSDWETMQHAAQKLEALGVPHEVRIVSAHRTPDVLFDYAATAESRGLRAIIAGAGGAAHLPGMLAAKTAVPVLGVPVQSKALNGMDSLLSIVQMPAGIPVATFAIGNAGASNAALFAAALLAPYDSAIAEALAAFRQRQTDDVAKNDDPRK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
17 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
18 2818991457 Xanthomonas translucens 569 Isolate Unclassified
19 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
20 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
21 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
22 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
23 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
24 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
25 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
26 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
27 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
28 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
29 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
30 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
31 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
32 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
33 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
34 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
35 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
36 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
37 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
38 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
39 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
40 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
41 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
42 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
103 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
108 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
269 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
281 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
282 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
283 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
284 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
299 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
300 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
301 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 0
Isolates 9.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 18.48
Nodule 0.21
Rhizoplane 3.9
Rhizosphere 63.24
Stem 0
Stem Tuber 0
Unclassified 13.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2802288 2162886007 Bacteria 1523
2 JGI25152J39213_1000106 3300002773 Bacteria 58139
3 JGI25150J39212_1000127 3300002774 Bacteria 42935
4 JGI25151J46595_10000196 3300003187 Bacteria 74530
5 JGI25151J46595_10000363 3300003187 Bacteria 47709
6 JGI25153J46596_10000089 3300003215 Bacteria 106651
7 Ga0055526_1001472 3300003771 Bacteria 16701
8 Ga0055526_1007545 3300003771 Bacteria 5624
9 Ga0055526_1023493 3300003771 Bacteria 2055
10 Ga0055526_1033820 3300003771 Bacteria 1410
11 Ga0055537_1000401 3300003773 Bacteria 28940
12 Ga0055537_1001051 3300003773 Bacteria 12381
13 Ga0055524_1000447 3300003775 Bacteria 34134
14 Ga0055524_1012430 3300003775 Bacteria 3268
15 Ga0055524_1017363 3300003775 Bacteria 2541
16 Ga0055536_1002133 3300003781 Bacteria 11260
17 Ga0055536_1004205 3300003781 Bacteria 7435
18 Ga0055536_1008695 3300003781 Bacteria 4316
19 Ga0055536_1009947 3300003781 Bacteria 3851
20 Ga0055536_1016869 3300003781 Bacteria 2418
21 Ga0055534_1000003 3300003784 Bacteria 300063
22 Ga0055534_1000155 3300003784 Bacteria 51103
23 Ga0055534_1000717 3300003784 Bacteria 16215
24 Ga0055528_1000004 3300003790 Bacteria 285772
25 Ga0055528_1004159 3300003790 Bacteria 7043
26 Ga0055530_10001056 3300003791 Bacteria 21844
27 Ga0055530_10003046 3300003791 Bacteria 10003
28 Ga0055531_10013086 3300003794 Bacteria 3851
29 Ga0055531_10024173 3300003794 Bacteria 2251
30 Ga0055531_10039620 3300003794 Bacteria 1396
31 Ga0055531_10073677 3300003794 Bacteria 777
32 Ga0058692_1000002 3300003856 Bacteria 508401
33 Ga0058692_1000018 3300003856 Bacteria 264544
34 Ga0065704_10071976 3300005289 Bacteria 9473
35 Ga0070658_10414199 3300005327 Bacteria 1158
36 Ga0070658_11355809 3300005327 Bacteria 617
37 Ga0070676_10153594 3300005328 Bacteria 1476
38 Ga0070670_100259805 3300005331 Bacteria 1514
39 Ga0070660_100072787 3300005339 Bacteria 2686
40 Ga0070668_100025792 3300005347 Bacteria 4459
41 Ga0070668_100206437 3300005347 Bacteria 1614
42 Ga0070669_100019164 3300005353 Bacteria 4889
43 Ga0070669_100876586 3300005353 Bacteria 766
44 Ga0070671_100175434 3300005355 Bacteria 1813
45 Ga0070659_100398869 3300005366 Bacteria 1161
46 Ga0070713_100113761 3300005436 Bacteria 2363
47 Ga0070694_100264798 3300005444 Bacteria 1305
48 Ga0070678_100177118 3300005456 Bacteria 1742
49 Ga0070662_100297967 3300005457 Bacteria 1309
50 Ga0070681_10484442 3300005458 Bacteria 1150
51 Ga0070706_100258081 3300005467 Bacteria 1627
52 Ga0070679_100042128 3300005530 Bacteria 4546
53 Ga0070679_100157453 3300005530 Bacteria 2246
54 Ga0070679_100191553 3300005530 Bacteria 2013
55 Ga0068853_100121906 3300005539 Bacteria 2326
56 Ga0070672_100013221 3300005543 Bacteria 5823
57 Ga0070665_100181235 3300005548 Bacteria 2107
58 Ga0070665_100349213 3300005548 Bacteria 1484
59 Ga0070665_100633773 3300005548 Bacteria 1082
60 Ga0070665_101537629 3300005548 Bacteria 674
61 Ga0068855_100780131 3300005563 Bacteria 1017
62 Ga0070664_100247463 3300005564 Bacteria 1602
63 Ga0070664_100346254 3300005564 Bacteria 1351
64 Ga0068852_100021581 3300005616 Bacteria 5146
65 Ga0068852_100078963 3300005616 Bacteria 2913
66 Ga0068859_101253635 3300005617 Bacteria 817
67 Ga0068864_100005870 3300005618 Bacteria 10060
68 Ga0068864_100269358 3300005618 Bacteria 1586
69 Ga0068863_100080207 3300005841 Bacteria 3091
70 Ga0068860_100023574 3300005843 Bacteria 5948
71 Ga0068860_100068292 3300005843 Bacteria 3377
72 Ga0068862_100370079 3300005844 Bacteria 1334
73 Ga0081539_10020508 3300005985 Bacteria 4463
74 Ga0075365_10126458 3300006038 Bacteria 1766
75 Ga0075364_10002393 3300006051 Bacteria 10519
76 Ga0075364_10059108 3300006051 Bacteria 2513
77 Ga0075364_10174462 3300006051 Bacteria 1454
78 Ga0075364_10211754 3300006051 Bacteria 1314
79 Ga0075364_10442948 3300006051 Bacteria 887
80 Ga0070716_100049287 3300006173 Bacteria 2385
81 Ga0070716_100251608 3300006173 Bacteria 1204
82 Ga0075367_10122644 3300006178 Bacteria 1602
83 Ga0075369_10213677 3300006186 Bacteria 892
84 Ga0075433_10012239 3300006852 Bacteria 6918
85 Ga0075434_100049122 3300006871 Bacteria 4188
86 Ga0068865_100191176 3300006881 Bacteria 1583
87 Ga0075436_100001504 3300006914 Bacteria 15905
88 Ga0097620_101253676 3300006931 Bacteria 817
89 Ga0075435_100020597 3300007076 Bacteria 5058
90 Ga0105251_10000473 3300009011 Bacteria 38223
91 Ga0105251_10030266 3300009011 Bacteria 2720
92 Ga0105244_10026759 3300009036 Bacteria 3118
93 Ga0105240_11092957 3300009093 Bacteria 849
94 Ga0111539_10115362 3300009094 Bacteria 3150
95 Ga0105243_10843292 3300009148 Bacteria 907
96 Ga0105241_10432975 3300009174 Bacteria 1160
97 Ga0105249_10055264 3300009553 Bacteria 3631
98 Ga0105148_103727 3300009978 Bacteria 1083
99 Ga0105032_103938 3300009979 Bacteria 1277
100 Ga0105239_10517062 3300010375 Bacteria 1358
101 Ga0157318_1002580 3300012482 Bacteria 998
102 Ga0157342_1018815 3300012507 Bacteria 786
103 Ga0157315_1006611 3300012508 Bacteria 913
104 Ga0157327_1011430 3300012512 Bacteria 857
105 Ga0157373_10059188 3300013100 Bacteria 2714
106 Ga0157373_10097327 3300013100 Bacteria 2071
107 Ga0157373_10529090 3300013100 Bacteria 853
108 Ga0157371_10000314 3300013102 Bacteria 63006
109 Ga0157371_10038774 3300013102 Bacteria 3408
110 Ga0157371_10719111 3300013102 Bacteria 748
111 Ga0157369_10181102 3300013105 Bacteria 2217
112 Ga0157378_10001533 3300013297 Bacteria 20885
113 Ga0157372_10292764 3300013307 Bacteria 1893
114 Ga0157372_12148324 3300013307 Bacteria 641
115 Ga0163163_10025833 3300014325 Bacteria 5603
116 Ga0157380_10294417 3300014326 Bacteria 1492
117 Ga0157380_10640883 3300014326 Bacteria 1058
118 Ga0182008_10000269 3300014497 Bacteria 40734
119 Ga0182008_10144032 3300014497 Bacteria 1193
120 Ga0157379_10012683 3300014968 Bacteria 7366
121 Ga0182006_1013353 3300015261 Bacteria 3566
122 Ga0182005_1000168 3300015265 Bacteria 45063
123 Ga0183360_10001 3300015689 Bacteria 3943671
124 Ga0163161_10200157 3300017792 Bacteria 1539
125 Ga0207425_1000030 3300025245 Bacteria 268200
126 Ga0209129_1000063 3300025258 Bacteria 240205
127 Ga0209565_1000001 3300025263 Bacteria 2950419
128 Ga0209565_1000014 3300025263 Bacteria 530302
129 Ga0209673_1000001 3300025273 Bacteria 3176258
130 Ga0209673_1000570 3300025273 Bacteria 58750
131 Ga0209673_1012309 3300025273 Bacteria 3454
132 Ga0209130_1004885 3300025284 Bacteria 4880
133 Ga0209675_1000001 3300025291 Bacteria 2950293
134 Ga0209675_1000021 3300025291 Bacteria 334833
135 Ga0209676_1000027 3300025292 Bacteria 560222
136 Ga0209676_1000047 3300025292 Bacteria 408645
137 Ga0209676_1000079 3300025292 Bacteria 290447
138 Ga0209676_1004494 3300025292 Bacteria 7748
139 Ga0209676_1006710 3300025292 Bacteria 5605
140 Ga0209676_1024017 3300025292 Bacteria 1983
141 Ga0209676_1024390 3300025292 Bacteria 1960
142 Ga0209025_1000013 3300025294 Bacteria 871757
143 Ga0209025_1000102 3300025294 Bacteria 228393
144 Ga0209025_1008994 3300025294 Bacteria 7056
145 Ga0209025_1024990 3300025294 Bacteria 3059
146 Ga0209025_1034946 3300025294 Bacteria 2281
147 Ga0209564_1000001 3300025295 Bacteria 3176258
148 Ga0209564_1000263 3300025295 Bacteria 112148
149 Ga0209564_1020630 3300025295 Bacteria 2405
150 Ga0209758_1000014 3300025297 Bacteria 871757
151 Ga0209758_1006900 3300025297 Bacteria 7930
152 Ga0209758_1061319 3300025297 Bacteria 1240
153 Ga0209758_1065882 3300025297 Bacteria 1167
154 Ga0209050_1000153 3300025298 Bacteria 160851
155 Ga0209050_1000311 3300025298 Bacteria 98948
156 Ga0209050_1001466 3300025298 Bacteria 25237
157 Ga0209050_1009954 3300025298 Bacteria 4768
158 Ga0209050_1025263 3300025298 Bacteria 2025
159 Ga0209256_1000002 3300025299 Bacteria 1906740
160 Ga0209256_1003979 3300025299 Bacteria 9703
161 Ga0209256_1009438 3300025299 Bacteria 4279
162 Ga0209256_1010213 3300025299 Bacteria 3966
163 Ga0209256_1024944 3300025299 Bacteria 1751
164 Ga0209051_1005263 3300025303 Bacteria 7622
165 Ga0209051_1009855 3300025303 Bacteria 4886
166 Ga0209257_1000081 3300025304 Bacteria 306577
167 Ga0209257_1002586 3300025304 Bacteria 17596
168 Ga0209257_1010696 3300025304 Bacteria 4584
169 Ga0209257_1011801 3300025304 Bacteria 4144
170 Ga0209257_1011826 3300025304 Bacteria 4133
171 Ga0207713_1000534 3300025735 Bacteria 38233
172 Ga0207713_1025593 3300025735 Bacteria 2720
173 Ga0207705_10493067 3300025909 Bacteria 951
174 Ga0207684_10658814 3300025910 Bacteria 892
175 Ga0207695_10277106 3300025913 Bacteria 1571
176 Ga0207695_10555419 3300025913 Bacteria 1030
177 Ga0207695_10760075 3300025913 Bacteria 849
178 Ga0207660_10010000 3300025917 Bacteria 6145
179 Ga0207657_10022384 3300025919 Bacteria 5914
180 Ga0207652_10127937 3300025921 Bacteria 2264
181 Ga0207652_10326455 3300025921 Bacteria 1385
182 Ga0207681_10022404 3300025923 Bacteria 4029
183 Ga0207681_10077882 3300025923 Bacteria 2332
184 Ga0207650_10473453 3300025925 Bacteria 1044
185 Ga0207700_10188062 3300025928 Bacteria 1734
186 Ga0207644_10149441 3300025931 Bacteria 1806
187 Ga0207644_10209279 3300025931 Bacteria 1541
188 Ga0207690_10641485 3300025932 Bacteria 870
189 Ga0207706_10636092 3300025933 Bacteria 915
190 Ga0207709_10007372 3300025935 Bacteria 6128
191 Ga0207709_10267166 3300025935 Bacteria 1257
192 Ga0207669_10924892 3300025937 Bacteria 730
193 Ga0207665_10113277 3300025939 Bacteria 1908
194 Ga0207665_10278122 3300025939 Bacteria 1245
195 Ga0207691_10013383 3300025940 Bacteria 7855
196 Ga0207711_10402555 3300025941 Bacteria 1272
197 Ga0207679_10461748 3300025945 Bacteria 1128
198 Ga0207679_10767520 3300025945 Bacteria 878
199 Ga0207667_11334563 3300025949 Bacteria 693
200 Ga0207712_10199376 3300025961 Bacteria 1586
201 Ga0207668_10414051 3300025972 Bacteria 1142
202 Ga0207677_10123975 3300026023 Bacteria 1949
203 Ga0207639_10014456 3300026041 Bacteria 5554
204 Ga0207639_11128836 3300026041 Bacteria 735
205 Ga0207641_10019365 3300026088 Bacteria 5585
206 Ga0207641_10292845 3300026088 Bacteria 1535
207 Ga0207676_10011821 3300026095 Bacteria 6245
208 Ga0207676_10159790 3300026095 Bacteria 1951
209 Ga0207675_100516247 3300026118 Bacteria 1191
210 Ga0207675_101056086 3300026118 Bacteria 831
211 Ga0207683_10106007 3300026121 Bacteria 2513
212 Ga0207698_10005789 3300026142 Bacteria 7671
213 Ga0207698_10058158 3300026142 Bacteria 2995
214 Ga0209371_1000004 3300027312 Bacteria 1098197
215 Ga0209371_1000011 3300027312 Bacteria 848456
216 Ga0209967_1002702 3300027364 Bacteria 2309
217 Ga0268266_10255621 3300028379 Bacteria 1622
218 Ga0268266_10468910 3300028379 Bacteria 1199
219 Ga0268264_10010146 3300028381 Bacteria 7795
220 Ga0268264_10064001 3300028381 Bacteria 3094
221 Ga0265323_10000121 3300028653 Bacteria 44525
222 Ga0265323_10030064 3300028653 Bacteria 2026
223 Ga0265322_10000456 3300028654 Bacteria 16379
224 Ga0307515_10152575 3300028794 Bacteria 2406
225 Ga0307515_10276719 3300028794 Bacteria 1391
226 Ga0268256_1000005 3300030500 Bacteria 1082342
227 Ga0268256_1000011 3300030500 Bacteria 848625
228 Ga0316176_1115957 3300030732 Bacteria 1523
229 Ga0314311_1239643 3300030733 Bacteria 3558
230 Ga0316180_1116347 3300030736 Bacteria 1263
231 Ga0316183_1125611 3300030742 Bacteria 7258
232 Ga0316181_1108000 3300030744 Bacteria 2662
233 Ga0265330_10029242 3300031235 Bacteria 2479
234 Ga0265331_10216339 3300031250 Bacteria 862
235 Ga0265327_10073316 3300031251 Bacteria 1708
236 Ga0265316_10078372 3300031344 Bacteria 2536
237 Ga0265316_10422253 3300031344 Bacteria 958
238 Ga0265316_10430979 3300031344 Bacteria 947
239 Ga0265316_10736594 3300031344 Bacteria 693
240 Ga0265316_10892861 3300031344 Bacteria 621
241 Ga0307513_10004594 3300031456 Bacteria 18392
242 Ga0307408_100064306 3300031548 Bacteria 2686
243 Ga0307408_100334748 3300031548 Bacteria 1279
244 Ga0307408_100444470 3300031548 Bacteria 1123
245 Ga0307516_10096882 3300031730 Bacteria 2770
246 Ga0307405_10055034 3300031731 Bacteria 2488
247 Ga0307405_10261489 3300031731 Bacteria 1293
248 Ga0307413_10019405 3300031824 Bacteria 3592
249 Ga0307413_10041607 3300031824 Bacteria 2692
250 Ga0307410_10575440 3300031852 Bacteria 936
251 Ga0307410_10834816 3300031852 Bacteria 786
252 Ga0307406_10004519 3300031901 Bacteria 7579
253 Ga0307406_10123422 3300031901 Bacteria 1805
254 Ga0307406_10263437 3300031901 Bacteria 1305
255 Ga0307406_10294936 3300031901 Bacteria 1243
256 Ga0307406_10400995 3300031901 Bacteria 1087
257 Ga0307406_10474472 3300031901 Bacteria 1009
258 Ga0307407_10035356 3300031903 Bacteria 2744
259 Ga0307407_10093927 3300031903 Bacteria 1845
260 Ga0307412_10293620 3300031911 Bacteria 1281
261 Ga0307412_10422005 3300031911 Bacteria 1091
262 Ga0307412_10438464 3300031911 Bacteria 1073
263 Ga0307412_10500129 3300031911 Bacteria 1012
264 Ga0307412_10753052 3300031911 Bacteria 841
265 Ga0307409_100925666 3300031995 Bacteria 886
266 Ga0307416_100212493 3300032002 Bacteria 1847
267 Ga0307414_10001542 3300032004 Bacteria 11978
268 Ga0307414_10005468 3300032004 Bacteria 6999
269 Ga0307414_10033993 3300032004 Bacteria 3375
270 Ga0307414_10036259 3300032004 Bacteria 3291
271 Ga0307414_10064172 3300032004 Bacteria 2613
272 Ga0307414_10085480 3300032004 Bacteria 2324
273 Ga0307414_10241179 3300032004 Bacteria 1496
274 Ga0307414_10311926 3300032004 Bacteria 1335
275 Ga0307414_10466296 3300032004 Bacteria 1111
276 Ga0307414_10673319 3300032004 Bacteria 934
277 Ga0307414_10685416 3300032004 Bacteria 926
278 Ga0307411_10003100 3300032005 Bacteria 7607
279 Ga0307411_10384323 3300032005 Bacteria 1155
280 Ga0307415_100287281 3300032126 Bacteria 1356
281 Ga0373941_0000601 3300035115 Bacteria 7284
282 Ga0373927_0050836 3300035695 Bacteria 2681
283 Ga0395900_0099624 3300037418 Bacteria 2985
284 Ga0395900_0139802 3300037418 Bacteria 2480
285 Ga0395898_1288895 3300037466 Bacteria 660
286 Ga0395905_0000030 3300037471 Bacteria 289430
287 Ga0395905_0044110 3300037471 Bacteria 4184
288 Ga0395905_0931062 3300037471 Bacteria 772
289 Ga0436364_1498783 3300037853 Bacteria 3711
290 Ga0395901_0610461 3300038443 Bacteria 1099
291 Ga0237819_03470 3300038705 Bacteria 2784
292 Ga0439436_0026710 3300041404 Bacteria 1691
293 Ga0439436_0038012 3300041404 Bacteria 1385
294 Ga0439436_0089832 3300041404 Bacteria 855
295 Ga0439465_0001393 3300041413 Bacteria 7807
296 Ga0451791_0009035 3300041451 Bacteria 1607
297 Ga0451797_0896119 3300041453 Bacteria 1775
298 Ga0451795_0013074 3300041456 Bacteria 1195
299 Ga0451837_1091997 3300041494 Bacteria 719
300 Ga0451839_0957326 3300041496 Bacteria 643
301 Ga0451841_0512690 3300041498 Bacteria 858
302 Ga0451841_1233105 3300041498 Bacteria 1412
303 Ga0451843_0084997 3300041509 Bacteria 1359
304 Ga0451843_0483042 3300041509 Bacteria 865
305 Ga0439445_0003339 3300042004 Bacteria 3604
306 Ga0439432_005316 3300042006 Bacteria 4648
307 Ga0439432_028187 3300042006 Bacteria 1830
308 Ga0439432_060972 3300042006 Bacteria 1163
309 Ga0439449_0000083 3300042007 Bacteria 30479
310 Ga0439449_0017319 3300042007 Bacteria 2705
311 Ga0439449_0028158 3300042007 Bacteria 2094
312 Ga0439449_0032348 3300042007 Bacteria 1950
313 Ga0439449_0033606 3300042007 Bacteria 1910
314 Ga0439457_042294 3300042014 Bacteria 1016
315 Ga0439462_0015190 3300042015 Bacteria 1984
316 Ga0439462_0016841 3300042015 Bacteria 1892
317 Ga0439462_0018728 3300042015 Bacteria 1799
318 Ga0451577_0003130 3300042876 Bacteria 18664
319 Ga0451577_0006884 3300042876 Bacteria 11241
320 Ga0451577_0197159 3300042876 Bacteria 1817
321 Ga0451577_1644011 3300042876 Bacteria 566
322 Ga0466972_0000617 3300044658 Bacteria 17384
323 Ga0466965_0000826 3300044683 Bacteria 11707
324 Ga0453684_0001232 3300044712 Bacteria 78122
325 Ga0453684_0031975 3300044712 Bacteria 7378
326 Ga0453684_0093011 3300044712 Bacteria 3715
327 Ga0453684_0260564 3300044712 Bacteria 1986
328 Ga0453684_0533832 3300044712 Bacteria 1294
329 Ga0466968_0008224 3300044735 Bacteria 3990
330 Ga0466960_0067585 3300044901 Bacteria 1770
331 Ga0466959_0024322 3300045049 Bacteria 4486
332 Ga0451576_0741422 3300045051 Bacteria 1032
333 Ga0495627_147497 3300046453 Bacteria 657
334 Ga0495638_0007840 3300046460 Bacteria 7621
335 Ga0495605_0044396 3300046474 Bacteria 2198
336 Ga0495607_0095658 3300046501 Bacteria 1600
337 Ga0495606_0024532 3300046507 Bacteria 4342
338 Ga0495610_0001232 3300046512 Bacteria 22998
339 Ga0495632_0118344 3300046519 Bacteria 1239
340 Ga0495643_0000925 3300046522 Bacteria 30684
341 Ga0495663_0003675 3300046525 Bacteria 4392
342 Ga0495663_0096329 3300046525 Bacteria 970
343 Ga0495663_0099187 3300046525 Bacteria 957
344 Ga0495633_0004179 3300046558 Bacteria 9270
345 Ga0495633_0004483 3300046558 Bacteria 8859
346 Ga0495656_0007956 3300046615 Bacteria 3769
347 Ga0495656_0009357 3300046615 Bacteria 3521
348 Ga0495668_0019371 3300046616 Bacteria 3924
349 Ga0495659_0015053 3300046664 Bacteria 2539
350 Ga0495661_0251393 3300046665 Bacteria 902
351 Ga0495588_0226644 3300046674 Bacteria 986
352 Ga0495670_0057630 3300046691 Bacteria 1950
353 Ga0495671_0040666 3300046692 Bacteria 2344
354 Ga0495636_0003821 3300047318 Bacteria 5867
355 Ga0495636_0049139 3300047318 Bacteria 1763
356 Ga0495636_0109406 3300047318 Bacteria 1215
357 Ga0495672_0000134 3300047320 Bacteria 110142
358 Ga0495685_005048 3300047447 Bacteria 4296
359 Ga0495686_0010849 3300047472 Bacteria 6456
360 Ga0495615_0192383 3300048090 Bacteria 626
361 Ga0496100_0347717 3300048903 Bacteria 1119
362 Ga0496101_0557832 3300048904 Bacteria 906
363 Ga0496102_0287304 3300048905 Bacteria 1550
364 Ga0496105_0052872 3300048908 Bacteria 3355
365 Ga0496107_0210351 3300048910 Bacteria 1446
366 Ga0496108_0184477 3300048911 Bacteria 1807
367 Ga0496108_1465921 3300048911 Bacteria 569
368 Ga0496109_0225324 3300048912 Bacteria 1763
369 Ga0496109_0578170 3300048912 Bacteria 1059
370 Ga0496112_0006646 3300048915 Bacteria 10181
371 Ga0496112_0911622 3300048915 Bacteria 800
372 Ga0496113_0222451 3300048916 Bacteria 1504
373 Ga0496113_0276122 3300048916 Bacteria 1343
374 Ga0496114_0005495 3300048917 Bacteria 9922
375 Ga0496114_0052341 3300048917 Bacteria 3402
376 Ga0496114_0859544 3300048917 Bacteria 787
377 Ga0496116_0039960 3300048919 Bacteria 3235
378 Ga0496116_0290121 3300048919 Bacteria 786
379 Ga0496117_0002078 3300048920 Bacteria 26449
380 Ga0496117_0021211 3300048920 Bacteria 5265
381 Ga0496117_0026488 3300048920 Bacteria 4537
382 Ga0496118_0000145 3300048921 Bacteria 123886
383 Ga0496118_0000573 3300048921 Bacteria 60932
384 Ga0496118_0010191 3300048921 Bacteria 9333
385 Ga0496118_0097096 3300048921 Bacteria 2006
386 Ga0496119_0000211 3300048922 Bacteria 83064
387 Ga0496119_0009334 3300048922 Bacteria 8438
388 Ga0496120_0000525 3300048923 Bacteria 59273
389 Ga0496120_0001043 3300048923 Bacteria 37032
390 Ga0496122_0000220 3300048925 Bacteria 127065
391 Ga0496122_0000976 3300048925 Bacteria 51333
392 Ga0496122_0017868 3300048925 Bacteria 6591
393 Ga0496123_0000151 3300048926 Bacteria 141062
394 Ga0496123_0000359 3300048926 Bacteria 85669
395 Ga0496123_0084991 3300048926 Bacteria 1905
396 Ga0496124_0000018 3300048927 Bacteria 442940
397 Ga0496124_0000255 3300048927 Bacteria 102645
398 Ga0496124_0000437 3300048927 Bacteria 73878
399 Ga0496124_0033787 3300048927 Bacteria 4496
400 Ga0496124_0047915 3300048927 Bacteria 3653
401 Ga0496124_0079473 3300048927 Bacteria 2700
402 Ga0496124_0156921 3300048927 Bacteria 1778
403 Ga0496125_0013202 3300048928 Bacteria 8136
404 Ga0496126_0000806 3300048929 Bacteria 56104
405 Ga0496126_0010633 3300048929 Bacteria 9624
406 Ga0496126_0451160 3300048929 Bacteria 1035
407 Ga0501290_002504 3300049513 Bacteria 2367
408 Ga0501303_014635 3300049526 Bacteria 778
409 Ga0501033_0001911 3300049570 Bacteria 18129
410 Ga0501034_0000571 3300049571 Bacteria 58421
411 Ga0501034_0012086 3300049571 Bacteria 8926
412 Ga0501034_0031589 3300049571 Bacteria 5379
413 Ga0501034_0756117 3300049571 Bacteria 867
414 Ga0501036_0496865 3300049572 Bacteria 1015
415 Ga0501038_0482189 3300049574 Bacteria 950
416 Ga0501043_0014316 3300049579 Bacteria 6207
417 Ga0501043_0049940 3300049579 Bacteria 3289
418 Ga0501046_0385680 3300049580 Bacteria 1013
419 Ga0501047_0006534 3300049581 Bacteria 10975
420 Ga0501202_056384 3300049652 Bacteria 880
421 Ga0501223_023442 3300049663 Bacteria 1204
422 Ga0501257_122864 3300049686 Bacteria 697
423 Ga0501241_048841 3300049758 Bacteria 833
424 Ga0501265_010636 3300049762 Bacteria 1126
425 Ga0501266_017291 3300049763 Bacteria 963
426 Ga0501268_020442 3300049765 Bacteria 1128
427 Ga0501275_000463 3300049772 Bacteria 4563
428 Ga0501035_0000744 3300049822 Bacteria 35093
429 Ga0501044_0000049 3300049823 Bacteria 145043
430 Ga0501044_0304824 3300049823 Bacteria 1521
431 Ga0501045_0933335 3300049824 Bacteria 637
432 nmdc:mga00v17_236530_c1 3300050491 Bacteria 1184
433 nmdc:mga00v17_401_c1 3300050491 Bacteria 24490
434 nmdc:mga05p37_543487_c1 3300050507 Bacteria 1324
435 nmdc:mga0n895_12163_c1 3300050512 Bacteria 7705
436 nmdc:mga0rr50_130865_c1 3300050513 Bacteria 2009
437 nmdc:mga08x19_2257_c1 3300050514 Bacteria 11736
438 nmdc:mga0a205_12466_c1 3300050515 Bacteria 7866
439 Ga0500646_0026450 3300053090 Bacteria 1573
440 Ga0500616_0000642 3300053153 Bacteria 42060
441 Ga0500634_0000083 3300053161 Bacteria 37070
442 Ga0500645_007498 3300053730 Bacteria 3793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10719111 Ga0157371_107191111 151
2 3300005457 Ga0070662_100297967 Ga0070662_1002979671 158
3 3300005543 Ga0070672_100013221 Ga0070672_1000132212 158
4 3300006881 Ga0068865_100191176 Ga0068865_1001911762 158
5 3300025923 Ga0207681_10077882 Ga0207681_100778822 158
6 3300025940 Ga0207691_10013383 Ga0207691_100133839 158
7 3300025945 Ga0207679_10461748 Ga0207679_104617482 159
8 3300005458 Ga0070681_10484442 Ga0070681_104844422 160
9 3300005530 Ga0070679_100157453 Ga0070679_1001574532 160
10 3300013105 Ga0157369_10181102 Ga0157369_101811022 160
11 3300025913 Ga0207695_10555419 Ga0207695_105554191 160
12 3300025921 Ga0207652_10326455 Ga0207652_103264552 160
13 3300037418 Ga0395900_0099624 Ga0395900_0099624_1231_1749 160
14 3300037466 Ga0395898_1288895 Ga0395898_1288895_32_550 160
15 3300037471 Ga0395905_0044110 Ga0395905_0044110_813_1331 160
16 3300005467 Ga0070706_100258081 Ga0070706_1002580813 161
17 3300005563 Ga0068855_100780131 Ga0068855_1007801312 161
18 3300005564 Ga0070664_100247463 Ga0070664_1002474633 161
19 3300025910 Ga0207684_10658814 Ga0207684_106588141 161
20 3300026118 Ga0207675_101056086 Ga0207675_1010560861 161
21 3300028653 Ga0265323_10000121 Ga0265323_1000012114 161
22 3300028653 Ga0265323_10030064 Ga0265323_100300642 161
23 3300028654 Ga0265322_10000456 Ga0265322_1000045614 161
24 3300028794 Ga0307515_10152575 Ga0307515_101525752 161
25 3300031235 Ga0265330_10029242 Ga0265330_100292423 161
26 3300031344 Ga0265316_10078372 Ga0265316_100783723 161
27 3300031344 Ga0265316_10422253 Ga0265316_104222531 161
28 3300031344 Ga0265316_10430979 Ga0265316_104309791 161
29 3300031344 Ga0265316_10736594 Ga0265316_107365941 161
30 3300031344 Ga0265316_10892861 Ga0265316_108928611 161
31 3300037471 Ga0395905_0000030 Ga0395905_0000030_98528_99016 161
32 3300049571 Ga0501034_0012086 Ga0501034_0012086_7199_7684 161
33 3300049572 Ga0501036_0496865 Ga0501036_0496865_124_609 161
34 3300049574 Ga0501038_0482189 Ga0501038_0482189_454_939 161
35 3300049579 Ga0501043_0049940 Ga0501043_0049940_2452_2937 161
36 3300049580 Ga0501046_0385680 Ga0501046_0385680_262_747 161
37 3300049581 Ga0501047_0006534 Ga0501047_0006534_10_495 161
38 3300049822 Ga0501035_0000744 Ga0501035_0000744_11051_11536 161
39 3300049823 Ga0501044_0000049 Ga0501044_0000049_34812_35297 161
40 3300049824 Ga0501045_0933335 Ga0501045_0933335_103_588 161
41 3300009093 Ga0105240_11092957 Ga0105240_110929572 162
42 3300010375 Ga0105239_10517062 Ga0105239_105170622 162
43 3300012512 Ga0157327_1011430 Ga0157327_10114301 162
44 3300025913 Ga0207695_10277106 Ga0207695_102771062 162
45 3300025913 Ga0207695_10760075 Ga0207695_107600751 162
46 3300031250 Ga0265331_10216339 Ga0265331_102163391 162
47 3300031251 Ga0265327_10073316 Ga0265327_100733162 162
48 3300037853 Ga0436364_1498783 Ga0436364_1498783_1429_1917 162
49 3300042876 Ga0451577_0003130 Ga0451577_0003130_2555_3043 162
50 3300042876 Ga0451577_1644011 Ga0451577_1644011_62_553 162
51 3300044658 Ga0466972_0000617 Ga0466972_0000617_15853_16350 162
52 3300044683 Ga0466965_0000826 Ga0466965_0000826_4340_4837 162
53 3300044712 Ga0453684_0001232 Ga0453684_0001232_37375_37872 162
54 3300044712 Ga0453684_0093011 Ga0453684_0093011_2617_3114 162
55 3300044735 Ga0466968_0008224 Ga0466968_0008224_3245_3742 162
56 3300044901 Ga0466960_0067585 Ga0466960_0067585_818_1315 162
57 3300053153 Ga0500616_0000642 Ga0500616_0000642_41494_42033 162
58 iso_pu_bacteria 2643221573 2643881531 162
59 iso_pu_bacteria 2643221720 2644662667 162
60 iso_pu_bacteria 2643221728 2644698379 162
61 iso_pu_bacteria 8003014200 8003016631 162
62 3300005328 Ga0070676_10153594 Ga0070676_101535942 163
63 3300005444 Ga0070694_100264798 Ga0070694_1002647982 163
64 3300005530 Ga0070679_100042128 Ga0070679_1000421283 163
65 3300005548 Ga0070665_100181235 Ga0070665_1001812352 163
66 3300006852 Ga0075433_10012239 Ga0075433_100122394 163
67 3300006871 Ga0075434_100049122 Ga0075434_1000491227 163
68 3300007076 Ga0075435_100020597 Ga0075435_1000205973 163
69 3300013100 Ga0157373_10097327 Ga0157373_100973272 163
70 3300013307 Ga0157372_12148324 Ga0157372_121483242 163
71 3300014326 Ga0157380_10294417 Ga0157380_102944173 163
72 3300025917 Ga0207660_10010000 Ga0207660_100100005 163
73 3300026023 Ga0207677_10123975 Ga0207677_101239751 163
74 3300026041 Ga0207639_11128836 Ga0207639_111288361 163
75 3300028379 Ga0268266_10255621 Ga0268266_102556212 163
76 3300035115 Ga0373941_0000601 Ga0373941_0000601_4114_4617 163
77 3300042876 Ga0451577_0006884 Ga0451577_0006884_6299_6799 163
78 3300042876 Ga0451577_0197159 Ga0451577_0197159_834_1334 163
79 3300044712 Ga0453684_0031975 Ga0453684_0031975_6015_6515 163
80 3300044712 Ga0453684_0260564 Ga0453684_0260564_956_1456 163
81 3300044712 Ga0453684_0533832 Ga0453684_0533832_554_1054 163
82 3300045049 Ga0466959_0024322 Ga0466959_0024322_2527_3018 163
83 3300045051 Ga0451576_0741422 Ga0451576_0741422_27_530 163
84 3300048911 Ga0496108_1465921 Ga0496108_1465921_24_527 163
85 3300048915 Ga0496112_0006646 Ga0496112_0006646_5917_6420 163
86 3300050507 nmdc:mga05p37_543487_c1 nmdc:mga05p37_543487_c1_486_989 163
87 3300050512 nmdc:mga0n895_12163_c1 nmdc:mga0n895_12163_c1_1798_2301 163
88 3300050513 nmdc:mga0rr50_130865_c1 nmdc:mga0rr50_130865_c1_1169_1672 163
89 3300050515 nmdc:mga0a205_12466_c1 nmdc:mga0a205_12466_c1_302_805 163
90 iso_pu_bacteria 2547132130 2547500895 163
91 iso_pu_bacteria 2571042365 2572255397 163
92 iso_pu_bacteria 2576861471 2578458911 163
93 iso_pu_bacteria 2643221559 2643816346 163
94 iso_pu_bacteria 2643221586 2643938967 163
95 iso_pu_bacteria 2643221612 2644077290 163
96 iso_pu_bacteria 2643221695 2644529818 163
97 iso_pu_bacteria 2643221727 2644694400 163
98 iso_pu_bacteria 2747842428 2747948755 163
99 iso_pu_bacteria 2747842501 2748018252 163
100 iso_pu_bacteria 2765235840 2765578455 163
101 iso_pu_bacteria 2816332141 2816516472 163
102 iso_pu_bacteria 2818991457 2819662802 163
103 iso_pu_bacteria 2842391507 2842392814 163
104 iso_pu_bacteria 2842780639 2842781533 163
105 iso_pu_bacteria 2852649853 2852651262 163
106 iso_pu_bacteria 2852684882 2852686205 163
107 iso_pu_bacteria 2874220319 2874221078 163
108 iso_pu_bacteria 2919089067 2919091288 163
109 iso_pu_bacteria 2919130084 2919132333 163
110 iso_pu_bacteria 2919134579 2919136372 163
111 iso_pu_bacteria 2928496128 2928497920 163
112 iso_pu_bacteria 2929195423 2929197202 163
113 iso_pu_bacteria 2931380184 2931381276 163
114 iso_pu_bacteria 2937610967 2937611900 163
115 iso_pu_bacteria 2939589442 2939590579 163
116 iso_pu_bacteria 2939622612 2939622747 163
117 iso_pu_bacteria 2939626828 2939629632 163
118 iso_pu_bacteria 2941475908 2941477793 163
119 iso_pu_bacteria 2941489479 2941489889 163
120 iso_pu_bacteria 2961047084 2961047843 163
121 iso_pu_bacteria 2961064222 2961067182 163
122 iso_pu_bacteria 2974307012 2974309374 163
123 iso_pu_bacteria 2977247770 2977250094 163
124 iso_pu_bacteria 2984514374 2984515416 163
125 iso_pu_bacteria 2987605356 2987605868 163
126 iso_pu_bacteria 2995948881 2995950577 163
127 iso_pu_bacteria 8021622325 8021623063 163
128 iso_pu_bacteria 8021626552 8021627303 163
129 iso_pu_bacteria 8021648035 8021649787 163
130 3300025937 Ga0207669_10924892 Ga0207669_109248922 164
131 3300046674 Ga0495588_0226644 Ga0495588_0226644_116_610 164
132 3300048908 Ga0496105_0052872 Ga0496105_0052872_1010_1504 164
133 3300048917 Ga0496114_0859544 Ga0496114_0859544_205_699 164
134 3300049571 Ga0501034_0000571 Ga0501034_0000571_15685_16209 164
135 3300003771 Ga0055526_1023493 Ga0055526_10234932 165
136 3300003771 Ga0055526_1033820 Ga0055526_10338203 165
137 3300003775 Ga0055524_1017363 Ga0055524_10173631 165
138 3300003781 Ga0055536_1016869 Ga0055536_10168693 165
139 3300003791 Ga0055530_10003046 Ga0055530_100030467 165
140 3300003794 Ga0055531_10024173 Ga0055531_100241732 165
141 3300006051 Ga0075364_10002393 Ga0075364_100023932 165
142 3300009094 Ga0111539_10115362 Ga0111539_101153622 165
143 3300009979 Ga0105032_103938 Ga0105032_1039382 165
144 3300014326 Ga0157380_10640883 Ga0157380_106408832 165
145 3300025273 Ga0209673_1012309 Ga0209673_10123093 165
146 3300025284 Ga0209130_1004885 Ga0209130_10048853 165
147 3300025292 Ga0209676_1006710 Ga0209676_10067108 165
148 3300025292 Ga0209676_1024017 Ga0209676_10240171 165
149 3300025292 Ga0209676_1024390 Ga0209676_10243901 165
150 3300025294 Ga0209025_1008994 Ga0209025_10089945 165
151 3300025294 Ga0209025_1024990 Ga0209025_10249902 165
152 3300025294 Ga0209025_1034946 Ga0209025_10349463 165
153 3300025295 Ga0209564_1020630 Ga0209564_10206302 165
154 3300025297 Ga0209758_1061319 Ga0209758_10613192 165
155 3300025297 Ga0209758_1065882 Ga0209758_10658822 165
156 3300025298 Ga0209050_1001466 Ga0209050_10014664 165
157 3300025298 Ga0209050_1025263 Ga0209050_10252633 165
158 3300025299 Ga0209256_1009438 Ga0209256_10094384 165
159 3300025299 Ga0209256_1010213 Ga0209256_10102133 165
160 3300025303 Ga0209051_1009855 Ga0209051_10098555 165
161 3300025304 Ga0209257_1011801 Ga0209257_10118013 165
162 3300025304 Ga0209257_1011826 Ga0209257_10118263 165
163 3300025925 Ga0207650_10473453 Ga0207650_104734532 165
164 3300025931 Ga0207644_10149441 Ga0207644_101494412 165
165 3300025941 Ga0207711_10402555 Ga0207711_104025552 165
166 3300026118 Ga0207675_100516247 Ga0207675_1005162472 165
167 3300031731 Ga0307405_10055034 Ga0307405_100550344 165
168 3300031731 Ga0307405_10261489 Ga0307405_102614893 165
169 3300031852 Ga0307410_10575440 Ga0307410_105754401 165
170 3300031901 Ga0307406_10004519 Ga0307406_100045198 165
171 3300031901 Ga0307406_10400995 Ga0307406_104009953 165
172 3300031901 Ga0307406_10474472 Ga0307406_104744723 165
173 3300031911 Ga0307412_10753052 Ga0307412_107530522 165
174 3300032004 Ga0307414_10311926 Ga0307414_103119261 165
175 3300032004 Ga0307414_10466296 Ga0307414_104662961 165
176 3300041404 Ga0439436_0038012 Ga0439436_0038012_411_929 165
177 3300041498 Ga0451841_0512690 Ga0451841_0512690_21_518 165
178 3300042007 Ga0439449_0017319 Ga0439449_0017319_1972_2478 165
179 3300048903 Ga0496100_0347717 Ga0496100_0347717_514_1032 165
180 3300048904 Ga0496101_0557832 Ga0496101_0557832_280_798 165
181 3300048911 Ga0496108_0184477 Ga0496108_0184477_344_862 165
182 3300048912 Ga0496109_0578170 Ga0496109_0578170_35_553 165
183 3300048915 Ga0496112_0911622 Ga0496112_0911622_110_628 165
184 3300048916 Ga0496113_0222451 Ga0496113_0222451_13_531 165
185 3300049579 Ga0501043_0014316 Ga0501043_0014316_1683_2183 165
186 3300050491 nmdc:mga00v17_401_c1 nmdc:mga00v17_401_c1_6133_6645 165
187 3300053730 Ga0500645_007498 Ga0500645_007498_1911_2414 165
188 2162886007 SwRhRL2b_contig_2802288 SwRhRL2b_0226.00005020 167
189 3300002773 JGI25152J39213_1000106 JGI25152J39213_100010625 167
190 3300002774 JGI25150J39212_1000127 JGI25150J39212_100012725 167
191 3300003187 JGI25151J46595_10000196 JGI25151J46595_1000019668 167
192 3300003187 JGI25151J46595_10000363 JGI25151J46595_1000036330 167
193 3300003215 JGI25153J46596_10000089 JGI25153J46596_1000008961 167
194 3300003771 Ga0055526_1001472 Ga0055526_10014725 167
195 3300003771 Ga0055526_1007545 Ga0055526_10075454 167
196 3300003773 Ga0055537_1000401 Ga0055537_10004018 167
197 3300003773 Ga0055537_1001051 Ga0055537_100105111 167
198 3300003775 Ga0055524_1000447 Ga0055524_10004478 167
199 3300003775 Ga0055524_1012430 Ga0055524_10124303 167
200 3300003781 Ga0055536_1002133 Ga0055536_100213310 167
201 3300003781 Ga0055536_1004205 Ga0055536_10042054 167
202 3300003781 Ga0055536_1008695 Ga0055536_10086955 167
203 3300003781 Ga0055536_1009947 Ga0055536_10099471 167
204 3300003784 Ga0055534_1000003 Ga0055534_1000003140 167
205 3300003784 Ga0055534_1000155 Ga0055534_10001552 167
206 3300003784 Ga0055534_1000717 Ga0055534_10007175 167
207 3300003790 Ga0055528_1000004 Ga0055528_10000048 167
208 3300003790 Ga0055528_1004159 Ga0055528_10041596 167
209 3300003791 Ga0055530_10001056 Ga0055530_100010561 167
210 3300003794 Ga0055531_10013086 Ga0055531_100130861 167
211 3300003794 Ga0055531_10039620 Ga0055531_100396202 167
212 3300003794 Ga0055531_10073677 Ga0055531_100736772 167
213 3300003856 Ga0058692_1000002 Ga0058692_1000002252 167
214 3300003856 Ga0058692_1000018 Ga0058692_1000018195 167
215 3300005289 Ga0065704_10071976 Ga0065704_1007197612 167
216 3300005327 Ga0070658_10414199 Ga0070658_104141992 167
217 3300005327 Ga0070658_11355809 Ga0070658_113558091 167
218 3300005331 Ga0070670_100259805 Ga0070670_1002598051 167
219 3300005339 Ga0070660_100072787 Ga0070660_1000727873 167
220 3300005347 Ga0070668_100025792 Ga0070668_1000257923 167
221 3300005347 Ga0070668_100206437 Ga0070668_1002064373 167
222 3300005353 Ga0070669_100019164 Ga0070669_1000191648 167
223 3300005353 Ga0070669_100876586 Ga0070669_1008765861 167
224 3300005355 Ga0070671_100175434 Ga0070671_1001754342 167
225 3300005366 Ga0070659_100398869 Ga0070659_1003988692 167
226 3300005436 Ga0070713_100113761 Ga0070713_1001137612 167
227 3300005456 Ga0070678_100177118 Ga0070678_1001771183 167
228 3300005530 Ga0070679_100191553 Ga0070679_1001915533 167
229 3300005539 Ga0068853_100121906 Ga0068853_1001219062 167
230 3300005548 Ga0070665_100349213 Ga0070665_1003492132 167
231 3300005548 Ga0070665_100633773 Ga0070665_1006337732 167
232 3300005548 Ga0070665_101537629 Ga0070665_1015376291 167
233 3300005564 Ga0070664_100346254 Ga0070664_1003462543 167
234 3300005616 Ga0068852_100021581 Ga0068852_1000215811 167
235 3300005616 Ga0068852_100078963 Ga0068852_1000789633 167
236 3300005617 Ga0068859_101253635 Ga0068859_1012536352 167
237 3300005618 Ga0068864_100005870 Ga0068864_1000058707 167
238 3300005618 Ga0068864_100269358 Ga0068864_1002693582 167
239 3300005841 Ga0068863_100080207 Ga0068863_1000802073 167
240 3300005843 Ga0068860_100023574 Ga0068860_1000235742 167
241 3300005843 Ga0068860_100068292 Ga0068860_1000682923 167
242 3300005844 Ga0068862_100370079 Ga0068862_1003700792 167
243 3300005985 Ga0081539_10020508 Ga0081539_100205085 167
244 3300006038 Ga0075365_10126458 Ga0075365_101264582 167
245 3300006051 Ga0075364_10059108 Ga0075364_100591082 167
246 3300006051 Ga0075364_10174462 Ga0075364_101744622 167
247 3300006051 Ga0075364_10211754 Ga0075364_102117542 167
248 3300006051 Ga0075364_10442948 Ga0075364_104429482 167
249 3300006173 Ga0070716_100049287 Ga0070716_1000492872 167
250 3300006173 Ga0070716_100251608 Ga0070716_1002516082 167
251 3300006178 Ga0075367_10122644 Ga0075367_101226441 167
252 3300006186 Ga0075369_10213677 Ga0075369_102136772 167
253 3300006914 Ga0075436_100001504 Ga0075436_10000150412 167
254 3300006931 Ga0097620_101253676 Ga0097620_1012536762 167
255 3300009011 Ga0105251_10000473 Ga0105251_1000047335 167
256 3300009011 Ga0105251_10030266 Ga0105251_100302664 167
257 3300009036 Ga0105244_10026759 Ga0105244_100267591 167
258 3300009148 Ga0105243_10843292 Ga0105243_108432922 167
259 3300009174 Ga0105241_10432975 Ga0105241_104329751 167
260 3300009553 Ga0105249_10055264 Ga0105249_100552643 167
261 3300009978 Ga0105148_103727 Ga0105148_1037272 167
262 3300012482 Ga0157318_1002580 Ga0157318_10025801 167
263 3300012507 Ga0157342_1018815 Ga0157342_10188151 167
264 3300012508 Ga0157315_1006611 Ga0157315_10066111 167
265 3300013100 Ga0157373_10059188 Ga0157373_100591883 167
266 3300013100 Ga0157373_10529090 Ga0157373_105290902 167
267 3300013102 Ga0157371_10000314 Ga0157371_100003147 167
268 3300013102 Ga0157371_10038774 Ga0157371_100387741 167
269 3300013297 Ga0157378_10001533 Ga0157378_1000153318 167
270 3300013307 Ga0157372_10292764 Ga0157372_102927642 167
271 3300014325 Ga0163163_10025833 Ga0163163_100258332 167
272 3300014497 Ga0182008_10000269 Ga0182008_1000026931 167
273 3300014497 Ga0182008_10144032 Ga0182008_101440322 167
274 3300014968 Ga0157379_10012683 Ga0157379_100126836 167
275 3300015261 Ga0182006_1013353 Ga0182006_10133533 167
276 3300015265 Ga0182005_1000168 Ga0182005_100016818 167
277 3300015689 Ga0183360_10001 Ga0183360_100012557 167
278 3300017792 Ga0163161_10200157 Ga0163161_102001572 167
279 3300025245 Ga0207425_1000030 Ga0207425_100003084 167
280 3300025258 Ga0209129_1000063 Ga0209129_1000063138 167
281 3300025263 Ga0209565_1000001 Ga0209565_10000011310 167
282 3300025263 Ga0209565_1000014 Ga0209565_1000014280 167
283 3300025273 Ga0209673_1000001 Ga0209673_10000011310 167
284 3300025273 Ga0209673_1000570 Ga0209673_100057025 167
285 3300025291 Ga0209675_1000001 Ga0209675_10000011223 167
286 3300025291 Ga0209675_1000021 Ga0209675_1000021208 167
287 3300025292 Ga0209676_1000027 Ga0209676_1000027108 167
288 3300025292 Ga0209676_1000047 Ga0209676_1000047227 167
289 3300025292 Ga0209676_1000079 Ga0209676_100007976 167
290 3300025292 Ga0209676_1004494 Ga0209676_10044949 167
291 3300025294 Ga0209025_1000013 Ga0209025_1000013710 167
292 3300025294 Ga0209025_1000102 Ga0209025_100010265 167
293 3300025295 Ga0209564_1000001 Ga0209564_10000011385 167
294 3300025295 Ga0209564_1000263 Ga0209564_100026313 167
295 3300025297 Ga0209758_1000014 Ga0209758_1000014710 167
296 3300025297 Ga0209758_1006900 Ga0209758_10069008 167
297 3300025298 Ga0209050_1000153 Ga0209050_100015391 167
298 3300025298 Ga0209050_1000311 Ga0209050_100031153 167
299 3300025298 Ga0209050_1009954 Ga0209050_10099546 167
300 3300025299 Ga0209256_1000002 Ga0209256_1000002168 167
301 3300025299 Ga0209256_1003979 Ga0209256_10039796 167
302 3300025299 Ga0209256_1024944 Ga0209256_10249442 167
303 3300025303 Ga0209051_1005263 Ga0209051_10052639 167
304 3300025304 Ga0209257_1000081 Ga0209257_100008186 167
305 3300025304 Ga0209257_1002586 Ga0209257_10025866 167
306 3300025304 Ga0209257_1010696 Ga0209257_10106963 167
307 3300025735 Ga0207713_1000534 Ga0207713_10005345 167
308 3300025735 Ga0207713_1025593 Ga0207713_10255934 167
309 3300025909 Ga0207705_10493067 Ga0207705_104930672 167
310 3300025919 Ga0207657_10022384 Ga0207657_100223848 167
311 3300025921 Ga0207652_10127937 Ga0207652_101279373 167
312 3300025923 Ga0207681_10022404 Ga0207681_100224041 167
313 3300025928 Ga0207700_10188062 Ga0207700_101880622 167
314 3300025931 Ga0207644_10209279 Ga0207644_102092792 167
315 3300025932 Ga0207690_10641485 Ga0207690_106414851 167
316 3300025933 Ga0207706_10636092 Ga0207706_106360922 167
317 3300025935 Ga0207709_10007372 Ga0207709_100073723 167
318 3300025935 Ga0207709_10267166 Ga0207709_102671662 167
319 3300025939 Ga0207665_10113277 Ga0207665_101132771 167
320 3300025939 Ga0207665_10278122 Ga0207665_102781222 167
321 3300025945 Ga0207679_10767520 Ga0207679_107675202 167
322 3300025949 Ga0207667_11334563 Ga0207667_113345631 167
323 3300025961 Ga0207712_10199376 Ga0207712_101993762 167
324 3300025972 Ga0207668_10414051 Ga0207668_104140512 167
325 3300026041 Ga0207639_10014456 Ga0207639_100144562 167
326 3300026088 Ga0207641_10019365 Ga0207641_100193652 167
327 3300026088 Ga0207641_10292845 Ga0207641_102928453 167
328 3300026095 Ga0207676_10011821 Ga0207676_100118212 167
329 3300026095 Ga0207676_10159790 Ga0207676_101597902 167
330 3300026121 Ga0207683_10106007 Ga0207683_101060072 167
331 3300026142 Ga0207698_10005789 Ga0207698_100057895 167
332 3300026142 Ga0207698_10058158 Ga0207698_100581582 167
333 3300027312 Ga0209371_1000004 Ga0209371_1000004460 167
334 3300027312 Ga0209371_1000011 Ga0209371_1000011234 167
335 3300027364 Ga0209967_1002702 Ga0209967_10027022 167
336 3300028379 Ga0268266_10468910 Ga0268266_104689102 167
337 3300028381 Ga0268264_10010146 Ga0268264_100101466 167
338 3300028381 Ga0268264_10064001 Ga0268264_100640013 167
339 3300028794 Ga0307515_10276719 Ga0307515_102767193 167
340 3300030500 Ga0268256_1000005 Ga0268256_1000005586 167
341 3300030500 Ga0268256_1000011 Ga0268256_1000011234 167
342 3300030732 Ga0316176_1115957 Ga0316176_11159572 167
343 3300030733 Ga0314311_1239643 Ga0314311_12396431 167
344 3300030736 Ga0316180_1116347 Ga0316180_11163471 167
345 3300030742 Ga0316183_1125611 Ga0316183_11256117 167
346 3300030744 Ga0316181_1108000 Ga0316181_11080003 167
347 3300031456 Ga0307513_10004594 Ga0307513_100045948 167
348 3300031548 Ga0307408_100064306 Ga0307408_1000643063 167
349 3300031548 Ga0307408_100334748 Ga0307408_1003347482 167
350 3300031548 Ga0307408_100444470 Ga0307408_1004444702 167
351 3300031730 Ga0307516_10096882 Ga0307516_100968822 167
352 3300031824 Ga0307413_10019405 Ga0307413_100194053 167
353 3300031824 Ga0307413_10041607 Ga0307413_100416072 167
354 3300031852 Ga0307410_10834816 Ga0307410_108348161 167
355 3300031901 Ga0307406_10123422 Ga0307406_101234222 167
356 3300031901 Ga0307406_10263437 Ga0307406_102634372 167
357 3300031901 Ga0307406_10294936 Ga0307406_102949362 167
358 3300031903 Ga0307407_10035356 Ga0307407_100353563 167
359 3300031903 Ga0307407_10093927 Ga0307407_100939271 167
360 3300031911 Ga0307412_10293620 Ga0307412_102936203 167
361 3300031911 Ga0307412_10422005 Ga0307412_104220053 167
362 3300031911 Ga0307412_10438464 Ga0307412_104384641 167
363 3300031911 Ga0307412_10500129 Ga0307412_105001292 167
364 3300031995 Ga0307409_100925666 Ga0307409_1009256662 167
365 3300032002 Ga0307416_100212493 Ga0307416_1002124932 167
366 3300032004 Ga0307414_10001542 Ga0307414_100015427 167
367 3300032004 Ga0307414_10005468 Ga0307414_100054686 167
368 3300032004 Ga0307414_10033993 Ga0307414_100339935 167
369 3300032004 Ga0307414_10036259 Ga0307414_100362595 167
370 3300032004 Ga0307414_10064172 Ga0307414_100641722 167
371 3300032004 Ga0307414_10085480 Ga0307414_100854803 167
372 3300032004 Ga0307414_10241179 Ga0307414_102411791 167
373 3300032004 Ga0307414_10673319 Ga0307414_106733192 167
374 3300032004 Ga0307414_10685416 Ga0307414_106854161 167
375 3300032005 Ga0307411_10003100 Ga0307411_100031003 167
376 3300032005 Ga0307411_10384323 Ga0307411_103843233 167
377 3300032126 Ga0307415_100287281 Ga0307415_1002872812 167
378 3300035695 Ga0373927_0050836 Ga0373927_0050836_1827_2390 167
379 3300037418 Ga0395900_0139802 Ga0395900_0139802_1950_2468 167
380 3300037471 Ga0395905_0931062 Ga0395905_0931062_196_714 167
381 3300038443 Ga0395901_0610461 Ga0395901_0610461_448_966 167
382 3300038705 Ga0237819_03470 Ga0237819_03470_1154_1657 167
383 3300041404 Ga0439436_0026710 Ga0439436_0026710_680_1183 167
384 3300041404 Ga0439436_0089832 Ga0439436_0089832_92_607 167
385 3300041413 Ga0439465_0001393 Ga0439465_0001393_3005_3526 167
386 3300041451 Ga0451791_0009035 Ga0451791_0009035_584_1117 167
387 3300041453 Ga0451797_0896119 Ga0451797_0896119_1135_1668 167
388 3300041456 Ga0451795_0013074 Ga0451795_0013074_151_684 167
389 3300041494 Ga0451837_1091997 Ga0451837_1091997_47_571 167
390 3300041496 Ga0451839_0957326 Ga0451839_0957326_48_554 167
391 3300041498 Ga0451841_1233105 Ga0451841_1233105_143_649 167
392 3300041509 Ga0451843_0084997 Ga0451843_0084997_381_884 167
393 3300041509 Ga0451843_0483042 Ga0451843_0483042_252_785 167
394 3300042004 Ga0439445_0003339 Ga0439445_0003339_1173_1694 167
395 3300042006 Ga0439432_005316 Ga0439432_005316_839_1354 167
396 3300042006 Ga0439432_028187 Ga0439432_028187_858_1373 167
397 3300042006 Ga0439432_060972 Ga0439432_060972_632_1147 167
398 3300042007 Ga0439449_0000083 Ga0439449_0000083_21693_22214 167
399 3300042007 Ga0439449_0028158 Ga0439449_0028158_947_1462 167
400 3300042007 Ga0439449_0032348 Ga0439449_0032348_1071_1604 167
401 3300042007 Ga0439449_0033606 Ga0439449_0033606_870_1373 167
402 3300042014 Ga0439457_042294 Ga0439457_042294_64_567 167
403 3300042015 Ga0439462_0015190 Ga0439462_0015190_1328_1861 167
404 3300042015 Ga0439462_0016841 Ga0439462_0016841_1253_1756 167
405 3300042015 Ga0439462_0018728 Ga0439462_0018728_33_548 167
406 3300046453 Ga0495627_147497 Ga0495627_147497_101_604 167
407 3300046460 Ga0495638_0007840 Ga0495638_0007840_4059_4562 167
408 3300046474 Ga0495605_0044396 Ga0495605_0044396_682_1185 167
409 3300046501 Ga0495607_0095658 Ga0495607_0095658_617_1120 167
410 3300046507 Ga0495606_0024532 Ga0495606_0024532_2802_3305 167
411 3300046512 Ga0495610_0001232 Ga0495610_0001232_5390_5893 167
412 3300046519 Ga0495632_0118344 Ga0495632_0118344_310_813 167
413 3300046522 Ga0495643_0000925 Ga0495643_0000925_9056_9559 167
414 3300046525 Ga0495663_0003675 Ga0495663_0003675_750_1253 167
415 3300046525 Ga0495663_0096329 Ga0495663_0096329_425_943 167
416 3300046525 Ga0495663_0099187 Ga0495663_0099187_400_903 167
417 3300046558 Ga0495633_0004179 Ga0495633_0004179_6721_7224 167
418 3300046558 Ga0495633_0004483 Ga0495633_0004483_776_1279 167
419 3300046615 Ga0495656_0007956 Ga0495656_0007956_1852_2370 167
420 3300046615 Ga0495656_0009357 Ga0495656_0009357_1849_2352 167
421 3300046616 Ga0495668_0019371 Ga0495668_0019371_2199_2714 167
422 3300046664 Ga0495659_0015053 Ga0495659_0015053_1774_2277 167
423 3300046665 Ga0495661_0251393 Ga0495661_0251393_322_825 167
424 3300046691 Ga0495670_0057630 Ga0495670_0057630_308_811 167
425 3300046692 Ga0495671_0040666 Ga0495671_0040666_1008_1538 167
426 3300047318 Ga0495636_0003821 Ga0495636_0003821_2287_2790 167
427 3300047318 Ga0495636_0049139 Ga0495636_0049139_556_1059 167
428 3300047318 Ga0495636_0109406 Ga0495636_0109406_189_707 167
429 3300047320 Ga0495672_0000134 Ga0495672_0000134_53666_54169 167
430 3300047447 Ga0495685_005048 Ga0495685_005048_1855_2358 167
431 3300047472 Ga0495686_0010849 Ga0495686_0010849_5630_6133 167
432 3300048090 Ga0495615_0192383 Ga0495615_0192383_76_579 167
433 3300048905 Ga0496102_0287304 Ga0496102_0287304_78_611 167
434 3300048910 Ga0496107_0210351 Ga0496107_0210351_436_954 167
435 3300048912 Ga0496109_0225324 Ga0496109_0225324_74_592 167
436 3300048916 Ga0496113_0276122 Ga0496113_0276122_656_1174 167
437 3300048917 Ga0496114_0005495 Ga0496114_0005495_3476_3985 167
438 3300048917 Ga0496114_0052341 Ga0496114_0052341_2671_3189 167
439 3300048919 Ga0496116_0039960 Ga0496116_0039960_1872_2375 167
440 3300048919 Ga0496116_0290121 Ga0496116_0290121_202_705 167
441 3300048920 Ga0496117_0002078 Ga0496117_0002078_16726_17229 167
442 3300048920 Ga0496117_0021211 Ga0496117_0021211_3405_3908 167
443 3300048920 Ga0496117_0026488 Ga0496117_0026488_89_592 167
444 3300048921 Ga0496118_0000145 Ga0496118_0000145_27319_27822 167
445 3300048921 Ga0496118_0000573 Ga0496118_0000573_51232_51735 167
446 3300048921 Ga0496118_0010191 Ga0496118_0010191_7641_8144 167
447 3300048921 Ga0496118_0097096 Ga0496118_0097096_922_1425 167
448 3300048922 Ga0496119_0000211 Ga0496119_0000211_73786_74289 167
449 3300048922 Ga0496119_0009334 Ga0496119_0009334_6598_7101 167
450 3300048923 Ga0496120_0000525 Ga0496120_0000525_6753_7256 167
451 3300048923 Ga0496120_0001043 Ga0496120_0001043_1359_1862 167
452 3300048925 Ga0496122_0000220 Ga0496122_0000220_35898_36401 167
453 3300048925 Ga0496122_0000976 Ga0496122_0000976_38214_38717 167
454 3300048925 Ga0496122_0017868 Ga0496122_0017868_2793_3296 167
455 3300048926 Ga0496123_0000151 Ga0496123_0000151_90654_91157 167
456 3300048926 Ga0496123_0000359 Ga0496123_0000359_50204_50707 167
457 3300048926 Ga0496123_0084991 Ga0496123_0084991_1365_1868 167
458 3300048927 Ga0496124_0000018 Ga0496124_0000018_331088_331591 167
459 3300048927 Ga0496124_0000255 Ga0496124_0000255_53467_53970 167
460 3300048927 Ga0496124_0000437 Ga0496124_0000437_38202_38705 167
461 3300048927 Ga0496124_0033787 Ga0496124_0033787_39_542 167
462 3300048927 Ga0496124_0047915 Ga0496124_0047915_2346_2849 167
463 3300048927 Ga0496124_0079473 Ga0496124_0079473_259_762 167
464 3300048927 Ga0496124_0156921 Ga0496124_0156921_125_628 167
465 3300048928 Ga0496125_0013202 Ga0496125_0013202_3364_3867 167
466 3300048929 Ga0496126_0000806 Ga0496126_0000806_46696_47199 167
467 3300048929 Ga0496126_0010633 Ga0496126_0010633_7804_8313 167
468 3300048929 Ga0496126_0451160 Ga0496126_0451160_300_803 167
469 3300049513 Ga0501290_002504 Ga0501290_002504_909_1424 167
470 3300049526 Ga0501303_014635 Ga0501303_014635_229_744 167
471 3300049570 Ga0501033_0001911 Ga0501033_0001911_14923_15429 167
472 3300049571 Ga0501034_0031589 Ga0501034_0031589_2391_2894 167
473 3300049571 Ga0501034_0756117 Ga0501034_0756117_281_787 167
474 3300049652 Ga0501202_056384 Ga0501202_056384_269_784 167
475 3300049663 Ga0501223_023442 Ga0501223_023442_569_1096 167
476 3300049686 Ga0501257_122864 Ga0501257_122864_101_616 167
477 3300049758 Ga0501241_048841 Ga0501241_048841_291_818 167
478 3300049762 Ga0501265_010636 Ga0501265_010636_126_641 167
479 3300049763 Ga0501266_017291 Ga0501266_017291_251_766 167
480 3300049765 Ga0501268_020442 Ga0501268_020442_420_947 167
481 3300049772 Ga0501275_000463 Ga0501275_000463_3682_4197 167
482 3300049823 Ga0501044_0304824 Ga0501044_0304824_972_1475 167
483 3300050491 nmdc:mga00v17_236530_c1 nmdc:mga00v17_236530_c1_262_765 167
484 3300050514 nmdc:mga08x19_2257_c1 nmdc:mga08x19_2257_c1_5066_5611 167
485 3300053090 Ga0500646_0026450 Ga0500646_0026450_729_1259 167
486 3300053161 Ga0500634_0000083 Ga0500634_0000083_23679_24182 167
487 iso_pu_bacteria 2643221593 2643977735 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

40

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fw8-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8 0.9852 6 157
5clf-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5 0.9846 6 157
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9844 7 157
2fwi-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59d, from the acidophilic bacterium acetobacter aceti, complexed with 5-aminoimidazole ribonucleotide (air) 0.9843 6 157
2fwa-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89n from the acidophilic bacterium acetobacter aceti, at ph 7 0.9841 6 157
ID Description Score Start End Superfamily
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9813 6 157 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9638 6 162 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9558 14 162 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9418 10 163 3.40.50.1970
3trhI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9348 10 163 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A017HSY8-F1-model_v4 Multifunctional fusion protein [Includes: N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase); N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase)] 0.9941 8 133 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034023
GO:0034028
GO:0046872
AF-H6SRU5-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9909 7 157 GO:0006189
GO:0016829
GO:0034023
AF-T0Y1U6-F1-model_v4 Phosphoribosylaminoimidazole carboxylase catalytic subunit 0.9908 6 147 GO:0006189
GO:0016853
AF-A0A353P8S8-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9902 6 135 GO:0006189
GO:0016853
AF-L8GN82-F1-model_v4 Phosphoribosylaminoimidazole carboxylase, ATPase subunit 0.9896 6 156 GO:0004638
GO:0004639
GO:0005524
GO:0005829
GO:0006189
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map