F453290

General Info

Members Datasets Scaffolds Average Seq Length
486 253 972 248

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10236349|Ga0307406_102363492
Length 279
Sequence MGSGWAPTECASPSDPADPMTATLEASRLAAAPRAPIPVLDRPLTSAELEDALRSFHGSYYVQHPFHRLMYEGRLTRRQFQGWVANRLAYQRAVPRKDGAILSNCPDQEVRREWIQRIVDHDGTEPGTGGIELWIRLGVALGVPREEMEDERHVLPAVRIICESYVYFCKTRPWVEAVAASLTELFAPRIHQQRIEAFPRYYPWIPPGGLDYFRSRLVQAPRDVRHGLAIVQRHCTTVESQRRAFEALAFKLDMLWAMIDTIHHAYAEGPEDRTEGRTA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
170 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
171 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
172 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
173 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
174 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.44
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10236349 3300031901 Bacteria 1368
2 MBSR1b_contig_110058 2162886012 Unclassified 1383
3 rootH2_10183864 3300003320 Unclassified 1172
4 Ga0065715_10109414 3300005293 Bacteria 2668
5 Ga0065715_10204674 3300005293 Bacteria 1343
6 Ga0070676_10310922 3300005328 Bacteria 1071
7 Ga0070690_100105929 3300005330 Bacteria 1870
8 Ga0070677_10012637 3300005333 Bacteria 2935
9 Ga0068869_100000567 3300005334 Bacteria 20714
10 Ga0070680_100211163 3300005336 Bacteria 1638
11 Ga0068868_100088181 3300005338 Bacteria 2496
12 Ga0070660_100303259 3300005339 Bacteria 1310
13 Ga0070691_10006166 3300005341 Bacteria 5471
14 Ga0070691_10020000 3300005341 Bacteria 3090
15 Ga0070661_100308223 3300005344 Bacteria 1234
16 Ga0070668_100045540 3300005347 Bacteria 3366
17 Ga0070668_100096867 3300005347 Bacteria 2332
18 Ga0070669_100050686 3300005353 Bacteria 3032
19 Ga0070669_100132842 3300005353 Bacteria 1912
20 Ga0070675_100252566 3300005354 Bacteria 1544
21 Ga0070671_100001161 3300005355 Bacteria 19625
22 Ga0070671_100242551 3300005355 Unclassified 1530
23 Ga0070674_100000037 3300005356 Bacteria 58487
24 Ga0070674_100076286 3300005356 Bacteria 2383
25 Ga0070673_100004524 3300005364 Bacteria 8805
26 Ga0070659_100085602 3300005366 Bacteria 2521
27 Ga0070667_100060781 3300005367 Bacteria 3198
28 Ga0070667_100416860 3300005367 Bacteria 1224
29 Ga0070709_10268338 3300005434 Bacteria 1236
30 Ga0070714_100097283 3300005435 Bacteria 2587
31 Ga0070705_100000440 3300005440 Bacteria 23852
32 Ga0070705_100038468 3300005440 Bacteria 2707
33 Ga0070694_100016870 3300005444 Bacteria 4605
34 Ga0070694_100095219 3300005444 Bacteria 2096
35 Ga0070694_100106973 3300005444 Bacteria 1987
36 Ga0070708_100002343 3300005445 Bacteria 14664
37 Ga0070708_100020222 3300005445 Bacteria 5610
38 Ga0070708_100059189 3300005445 Bacteria 3415
39 Ga0070678_100012043 3300005456 Bacteria 5360
40 Ga0070678_100113236 3300005456 Unclassified 2126
41 Ga0070662_100000534 3300005457 Bacteria 23034
42 Ga0070662_100507888 3300005457 Bacteria 1006
43 Ga0070681_10513503 3300005458 Bacteria 1111
44 Ga0068867_100006910 3300005459 Bacteria 8032
45 Ga0068867_100231394 3300005459 Bacteria 1494
46 Ga0070706_100001152 3300005467 Bacteria 28450
47 Ga0070706_100595434 3300005467 Bacteria 1027
48 Ga0070707_100000281 3300005468 Bacteria 50088
49 Ga0070698_100055270 3300005471 Bacteria 4026
50 Ga0070698_100282705 3300005471 Bacteria 1590
51 Ga0070699_100001115 3300005518 Bacteria 25014
52 Ga0070699_100019978 3300005518 Bacteria 5773
53 Ga0070699_100427245 3300005518 Bacteria 1200
54 Ga0070679_100146316 3300005530 Bacteria 2340
55 Ga0070679_100347311 3300005530 Bacteria 1431
56 Ga0070684_100238150 3300005535 Bacteria 1662
57 Ga0070697_100029061 3300005536 Bacteria 4430
58 Ga0070697_100032661 3300005536 Bacteria 4190
59 Ga0070697_100062093 3300005536 Bacteria 3048
60 Ga0070697_100652446 3300005536 Bacteria 927
61 Ga0070672_100002483 3300005543 Bacteria 11727
62 Ga0070686_100352125 3300005544 Bacteria 1107
63 Ga0070695_100010705 3300005545 Bacteria 5481
64 Ga0070695_100052232 3300005545 Bacteria 2626
65 Ga0070695_100127205 3300005545 Unclassified 1751
66 Ga0070696_100000578 3300005546 Bacteria 23368
67 Ga0070696_100025065 3300005546 Bacteria 4054
68 Ga0070696_100084297 3300005546 Bacteria 2255
69 Ga0070693_100004632 3300005547 Bacteria 6528
70 Ga0070693_100246912 3300005547 Unclassified 1181
71 Ga0070665_100163661 3300005548 Bacteria 2227
72 Ga0070665_100243130 3300005548 Bacteria 1800
73 Ga0070704_100070414 3300005549 Bacteria 2537
74 Ga0070704_100107738 3300005549 Bacteria 2114
75 Ga0068855_100541736 3300005563 Bacteria 1261
76 Ga0068855_100684168 3300005563 Unclassified 1099
77 Ga0068855_100694495 3300005563 Bacteria 1089
78 Ga0070664_100009225 3300005564 Bacteria 8010
79 Ga0070664_100065529 3300005564 Bacteria 3100
80 Ga0070664_100503160 3300005564 Unclassified 1117
81 Ga0070664_100738108 3300005564 Bacteria 919
82 Ga0068857_100013076 3300005577 Bacteria 7232
83 Ga0068854_100004209 3300005578 Bacteria 9061
84 Ga0068856_100223737 3300005614 Bacteria 1897
85 Ga0068852_100035762 3300005616 Bacteria 4146
86 Ga0068864_100001973 3300005618 Bacteria 16889
87 Ga0068866_10000023 3300005718 Bacteria 60315
88 Ga0068861_100006544 3300005719 Bacteria 7948
89 Ga0068861_100348857 3300005719 Bacteria 1298
90 Ga0068851_10000982 3300005834 Bacteria 12372
91 Ga0068863_100158621 3300005841 Bacteria 2166
92 Ga0068858_100074320 3300005842 Bacteria 3156
93 Ga0068860_100056190 3300005843 Bacteria 3743
94 Ga0081455_10018997 3300005937 Bacteria 6517
95 Ga0081538_10136666 3300005981 Bacteria 1140
96 Ga0070717_10611121 3300006028 Unclassified 989
97 Ga0070715_10122417 3300006163 Bacteria 1242
98 Ga0070715_10149353 3300006163 Bacteria 1143
99 Ga0097621_100197509 3300006237 Bacteria 1745
100 Ga0068871_100016675 3300006358 Bacteria 5541
101 Ga0075431_100025367 3300006847 Bacteria 6077
102 Ga0075431_100353904 3300006847 Bacteria 1476
103 Ga0075433_10004838 3300006852 Bacteria 10528
104 Ga0075433_10032681 3300006852 Bacteria 4458
105 Ga0075433_10094353 3300006852 Bacteria 2648
106 Ga0075433_10120309 3300006852 Bacteria 2331
107 Ga0075434_100056209 3300006871 Bacteria 3911
108 Ga0075434_100102739 3300006871 Bacteria 2866
109 Ga0075434_100169893 3300006871 Bacteria 2201
110 Ga0075434_100202621 3300006871 Unclassified 2004
111 Ga0075434_100346128 3300006871 Bacteria 1507
112 Ga0075429_100022199 3300006880 Bacteria 5506
113 Ga0068865_100001083 3300006881 Bacteria 15716
114 Ga0075436_100003464 3300006914 Bacteria 10816
115 Ga0075436_100091729 3300006914 Bacteria 2112
116 Ga0075435_100227342 3300007076 Bacteria 1585
117 Ga0075435_100239746 3300007076 Bacteria 1542
118 Ga0075435_100388840 3300007076 Bacteria 1199
119 Ga0105240_10020377 3300009093 Bacteria 8847
120 Ga0105240_10165946 3300009093 Bacteria 2619
121 Ga0105240_11163834 3300009093 Bacteria 818
122 Ga0111539_10809568 3300009094 Bacteria 1090
123 Ga0111539_10827820 3300009094 Bacteria 1077
124 Ga0105245_10047790 3300009098 Bacteria 3826
125 Ga0105245_10703233 3300009098 Bacteria 1044
126 Ga0114129_10037926 3300009147 Bacteria 6799
127 Ga0114129_10040891 3300009147 Bacteria 6534
128 Ga0114129_10099441 3300009147 Bacteria 4026
129 Ga0114129_10157814 3300009147 Bacteria 3101
130 Ga0114129_10323352 3300009147 Bacteria 2050
131 Ga0114129_10513200 3300009147 Bacteria 1564
132 Ga0114129_10613838 3300009147 Bacteria 1408
133 Ga0105243_10003530 3300009148 Bacteria 12639
134 Ga0105241_10005284 3300009174 Bacteria 9537
135 Ga0105241_10148857 3300009174 Unclassified 1913
136 Ga0105242_10000266 3300009176 Bacteria 41458
137 Ga0105248_10014234 3300009177 Bacteria 8758
138 Ga0105248_10054431 3300009177 Bacteria 4487
139 Ga0105248_10157765 3300009177 Bacteria 2560
140 Ga0105248_10261825 3300009177 Bacteria 1947
141 Ga0105237_10443047 3300009545 Unclassified 1305
142 Ga0105238_10616329 3300009551 Bacteria 1094
143 Ga0105249_10018728 3300009553 Bacteria 6166
144 Ga0105249_10207415 3300009553 Bacteria 1921
145 Ga0105249_10336512 3300009553 Bacteria 1525
146 Ga0105239_10003684 3300010375 Bacteria 18684
147 Ga0105239_10467907 3300010375 Bacteria 1431
148 Ga0105246_10077744 3300011119 Bacteria 2355
149 Ga0105246_10088684 3300011119 Bacteria 2223
150 Ga0157373_10075430 3300013100 Bacteria 2379
151 Ga0157373_10196003 3300013100 Bacteria 1424
152 Ga0157371_10126600 3300013102 Bacteria 1817
153 Ga0157370_10052715 3300013104 Bacteria 3883
154 Ga0157370_10125827 3300013104 Bacteria 2392
155 Ga0157369_10003415 3300013105 Bacteria 18836
156 Ga0157374_10046464 3300013296 Bacteria 4020
157 Ga0157378_10000329 3300013297 Bacteria 46850
158 Ga0163162_10011676 3300013306 Bacteria 8564
159 Ga0163162_10018740 3300013306 Bacteria 6783
160 Ga0157372_10024372 3300013307 Bacteria 6571
161 Ga0157372_10778046 3300013307 Bacteria 1112
162 Ga0157375_10099008 3300013308 Bacteria 2994
163 Ga0163163_10320264 3300014325 Bacteria 1604
164 Ga0157380_10340253 3300014326 Bacteria 1399
165 Ga0182008_10010897 3300014497 Bacteria 4850
166 Ga0157377_10178222 3300014745 Bacteria 1334
167 Ga0157379_10072249 3300014968 Bacteria 3086
168 Ga0157379_10158867 3300014968 Bacteria 2040
169 Ga0163161_10011926 3300017792 Bacteria 6030
170 Ga0197907_11369355 3300020069 Bacteria 1526
171 Ga0206356_11090931 3300020070 Bacteria 1649
172 Ga0206353_11695212 3300020082 Bacteria 1013
173 Ga0224712_10055213 3300022467 Bacteria 1562
174 Ga0207656_10003017 3300025321 Bacteria 5758
175 Ga0207682_10013678 3300025893 Bacteria 3159
176 Ga0207642_10000824 3300025899 Bacteria 9655
177 Ga0207699_10089750 3300025906 Bacteria 1927
178 Ga0207645_10062024 3300025907 Bacteria 2388
179 Ga0207643_10012076 3300025908 Bacteria 4665
180 Ga0207684_10011546 3300025910 Bacteria 7719
181 Ga0207684_10411228 3300025910 Bacteria 1163
182 Ga0207684_10455120 3300025910 Bacteria 1099
183 Ga0207654_10374333 3300025911 Unclassified 985
184 Ga0207707_10065762 3300025912 Bacteria 3157
185 Ga0207695_10029251 3300025913 Bacteria 6094
186 Ga0207695_10048595 3300025913 Bacteria 4479
187 Ga0207695_10065287 3300025913 Bacteria 3742
188 Ga0207695_10191386 3300025913 Bacteria 1963
189 Ga0207671_10255335 3300025914 Unclassified 1379
190 Ga0207663_10120889 3300025916 Unclassified 1793
191 Ga0207649_10063581 3300025920 Bacteria 2331
192 Ga0207652_10034625 3300025921 Bacteria 4257
193 Ga0207652_10102078 3300025921 Bacteria 2534
194 Ga0207652_10191186 3300025921 Unclassified 1841
195 Ga0207652_10206877 3300025921 Bacteria 1767
196 Ga0207646_10006209 3300025922 Bacteria 12417
197 Ga0207646_10574577 3300025922 Bacteria 1013
198 Ga0207681_10055573 3300025923 Bacteria 2697
199 Ga0207681_10450722 3300025923 Unclassified 1047
200 Ga0207694_10511911 3300025924 Bacteria 1005
201 Ga0207687_10040350 3300025927 Bacteria 3199
202 Ga0207687_10497324 3300025927 Bacteria 1017
203 Ga0207690_10030135 3300025932 Bacteria 3457
204 Ga0207706_10000011 3300025933 Bacteria 196033
205 Ga0207706_10141305 3300025933 Bacteria 2118
206 Ga0207686_10000049 3300025934 Bacteria 115396
207 Ga0207709_10006305 3300025935 Bacteria 6658
208 Ga0207669_10082455 3300025937 Bacteria 2064
209 Ga0207669_10104541 3300025937 Bacteria 1881
210 Ga0207704_10006599 3300025938 Bacteria 5428
211 Ga0207691_10014705 3300025940 Bacteria 7461
212 Ga0207711_10096600 3300025941 Bacteria 2608
213 Ga0207689_10000895 3300025942 Bacteria 28650
214 Ga0207679_10147688 3300025945 Unclassified 1909
215 Ga0207667_10404643 3300025949 Bacteria 1389
216 Ga0207651_10056034 3300025960 Bacteria 2711
217 Ga0207651_10063834 3300025960 Bacteria 2574
218 Ga0207651_10116002 3300025960 Bacteria 2021
219 Ga0207651_10203000 3300025960 Bacteria 1590
220 Ga0207712_10002282 3300025961 Bacteria 12454
221 Ga0207640_10006003 3300025981 Bacteria 6637
222 Ga0207640_10156381 3300025981 Bacteria 1681
223 Ga0207640_10537463 3300025981 Bacteria 980
224 Ga0207658_10024138 3300025986 Bacteria 4251
225 Ga0207703_10011903 3300026035 Bacteria 6775
226 Ga0207708_10020762 3300026075 Bacteria 4954
227 Ga0207702_10239044 3300026078 Bacteria 1701
228 Ga0207702_10582882 3300026078 Bacteria 1096
229 Ga0207641_10119937 3300026088 Bacteria 2345
230 Ga0207641_10147567 3300026088 Bacteria 2128
231 Ga0207641_10586775 3300026088 Bacteria 1090
232 Ga0207648_10000011 3300026089 Bacteria 182284
233 Ga0207648_10201068 3300026089 Bacteria 1767
234 Ga0207676_10117889 3300026095 Bacteria 2233
235 Ga0207676_10197911 3300026095 Bacteria 1773
236 Ga0207674_10003590 3300026116 Bacteria 18913
237 Ga0207674_10578041 3300026116 Unclassified 1085
238 Ga0207675_100009407 3300026118 Bacteria 9157
239 Ga0207683_10014229 3300026121 Bacteria 6777
240 Ga0207698_10013791 3300026142 Bacteria 5347
241 Ga0209998_10014428 3300027717 Bacteria 1649
242 Ga0209974_10069676 3300027876 Bacteria 1198
243 Ga0268266_10041165 3300028379 Bacteria 3941
244 Ga0268266_10186660 3300028379 Bacteria 1891
245 Ga0268264_10157011 3300028381 Unclassified 2045
246 Ga0307408_100078139 3300031548 Bacteria 2466
247 Ga0307405_10013869 3300031731 Bacteria 4312
248 Ga0307405_10042420 3300031731 Bacteria 2769
249 Ga0307405_10053153 3300031731 Bacteria 2522
250 Ga0307413_10002094 3300031824 Bacteria 7996
251 Ga0307413_10008897 3300031824 Bacteria 4771
252 Ga0307413_10036437 3300031824 Bacteria 2831
253 Ga0307413_10036891 3300031824 Bacteria 2819
254 Ga0307413_10044768 3300031824 Bacteria 2618
255 Ga0307413_10072375 3300031824 Bacteria 2176
256 Ga0307410_10000857 3300031852 Bacteria 12952
257 Ga0307410_10160194 3300031852 Bacteria 1685
258 Ga0307406_10011088 3300031901 Bacteria 5105
259 Ga0307406_10065635 3300031901 Bacteria 2359
260 Ga0307406_10069293 3300031901 Bacteria 2306
261 Ga0307407_10002476 3300031903 Bacteria 7239
262 Ga0307407_10005489 3300031903 Bacteria 5509
263 Ga0307407_10107320 3300031903 Unclassified 1746
264 Ga0307407_10299168 3300031903 Bacteria 1121
265 Ga0307412_10026831 3300031911 Bacteria 3585
266 Ga0307409_100006818 3300031995 Bacteria 6759
267 Ga0307409_100210189 3300031995 Bacteria 1748
268 Ga0307409_100237639 3300031995 Bacteria 1656
269 Ga0307409_100418110 3300031995 Bacteria 1285
270 Ga0307409_100634558 3300031995 Bacteria 1060
271 Ga0307416_100000666 3300032002 Bacteria 17808
272 Ga0307416_100002463 3300032002 Bacteria 10642
273 Ga0307416_100006863 3300032002 Bacteria 7165
274 Ga0307416_100077737 3300032002 Bacteria 2788
275 Ga0307416_100080549 3300032002 Bacteria 2749
276 Ga0307416_100121793 3300032002 Bacteria 2327
277 Ga0307414_10004191 3300032004 Bacteria 7799
278 Ga0307414_10005968 3300032004 Bacteria 6746
279 Ga0307414_10008152 3300032004 Bacteria 5921
280 Ga0307414_10011198 3300032004 Bacteria 5249
281 Ga0307414_10048158 3300032004 Bacteria 2939
282 Ga0307414_10080241 3300032004 Bacteria 2385
283 Ga0307414_10111041 3300032004 Bacteria 2087
284 Ga0307414_10212220 3300032004 Bacteria 1583
285 Ga0307411_10001595 3300032005 Bacteria 9417
286 Ga0307411_10009293 3300032005 Bacteria 5158
287 Ga0307411_10012262 3300032005 Bacteria 4668
288 Ga0307411_10016869 3300032005 Bacteria 4143
289 Ga0307411_10029355 3300032005 Bacteria 3356
290 Ga0307411_10034629 3300032005 Unclassified 3145
291 Ga0307411_10056825 3300032005 Bacteria 2581
292 Ga0307411_10207243 3300032005 Bacteria 1511
293 Ga0307415_100000818 3300032126 Bacteria 14209
294 Ga0307415_100023413 3300032126 Bacteria 3832
295 Ga0307415_100032673 3300032126 Bacteria 3368
296 Ga0307415_100055376 3300032126 Bacteria 2713
297 Ga0307415_100056711 3300032126 Bacteria 2688
298 Ga0307415_100123282 3300032126 Bacteria 1948
299 Ga0307415_100129604 3300032126 Bacteria 1907
300 Ga0307415_100594678 3300032126 Unclassified 984
301 Ga0373929_0048954 3300035085 Bacteria 961
302 Ga0373940_0004992 3300035088 Bacteria 2845
303 Ga0373949_0106700 3300035090 Bacteria 773
304 Ga0373960_0022691 3300035121 Bacteria 1684
305 Ga0373931_0011786 3300035691 Bacteria 4227
306 Ga0373931_0141390 3300035691 Bacteria 1394
307 Ga0316584_0337212 3300036712 Bacteria 1085
308 Ga0395899_0220003 3300037312 Bacteria 1316
309 Ga0395905_0189310 3300037471 Bacteria 1931
310 Ga0400484_31294 3300038725 Bacteria 29048
311 Ga0400490_09944 3300038726 Bacteria 75928
312 Ga0400490_14276 3300038726 Bacteria 16173
313 Ga0400490_29790 3300038726 Bacteria 76189
314 Ga0400491_07341 3300038727 Bacteria 17318
315 Ga0400491_19811 3300038727 Bacteria 1633
316 Ga0400488_03244 3300038741 Bacteria 4954
317 Ga0400488_07739 3300038741 Bacteria 3241
318 Ga0400488_32104 3300038741 Bacteria 1452
319 Ga0400488_33304 3300038741 Bacteria 1761
320 Ga0400488_47307 3300038741 Bacteria 2285
321 Ga0400488_47832 3300038741 Bacteria 2823
322 Ga0400488_48972 3300038741 Bacteria 4627
323 Ga0242420_001941 3300038996 Bacteria 2868
324 Ga0400483_005413 3300039062 Bacteria 5392
325 Ga0400483_076685 3300039062 Bacteria 2788
326 Ga0400483_106880 3300039062 Bacteria 3991
327 Ga0400483_130199 3300039062 Bacteria 1022
328 Ga0400483_156960 3300039062 Bacteria 3490
329 Ga0400483_206326 3300039062 Bacteria 7148
330 Ga0400483_274959 3300039062 Bacteria 7625
331 Ga0400487_04096 3300039110 Bacteria 11160
332 Ga0400487_19915 3300039110 Bacteria 26104
333 Ga0400487_26765 3300039110 Bacteria 90753
334 Ga0400487_51244 3300039110 Bacteria 3860
335 Ga0439434_0079548 3300042435 Unclassified 1039
336 Ga0451577_0001980 3300042876 Bacteria 25652
337 Ga0451577_0045554 3300042876 Bacteria 3926
338 Ga0451577_0137685 3300042876 Bacteria 2193
339 Ga0453683_0036597 3300044673 Bacteria 3089
340 Ga0453683_0142580 3300044673 Bacteria 1513
341 Ga0453684_0393590 3300044712 Bacteria 1553
342 Ga0453684_0935691 3300044712 Bacteria 926
343 Ga0466958_0149223 3300045836 Bacteria 1474
344 Ga0495639_0035681 3300046475 Bacteria 2225
345 Ga0495664_0046561 3300046477 Bacteria 2573
346 Ga0495594_0001662 3300046499 Bacteria 11558
347 Ga0495630_0003001 3300046517 Bacteria 11706
348 Ga0495666_0000296 3300046526 Bacteria 21816
349 Ga0495640_0030279 3300046533 Bacteria 3876
350 Ga0495586_0003076 3300046535 Bacteria 8993
351 Ga0495622_0062199 3300046557 Bacteria 1728
352 Ga0495588_0070122 3300046674 Bacteria 1822
353 Ga0495599_0062777 3300046678 Bacteria 2321
354 Ga0495658_0002504 3300046683 Bacteria 9244
355 Ga0495624_0093098 3300046690 Bacteria 1858
356 Ga0495636_0220197 3300047318 Unclassified 871
357 Ga0495674_0006122 3300047319 Bacteria 11554
358 Ga0495680_0011238 3300047322 Bacteria 7944
359 Ga0495614_0090104 3300048089 Unclassified 1334
360 Ga0496100_0223503 3300048903 Bacteria 1383
361 Ga0496102_0004666 3300048905 Bacteria 11593
362 Ga0496102_0024364 3300048905 Bacteria 5380
363 Ga0496102_0034235 3300048905 Bacteria 4568
364 Ga0496102_0043489 3300048905 Bacteria 4074
365 Ga0496102_0065491 3300048905 Bacteria 3331
366 Ga0496102_0193129 3300048905 Bacteria 1919
367 Ga0496102_0357805 3300048905 Bacteria 1374
368 Ga0496103_0006657 3300048906 Bacteria 6897
369 Ga0496104_0006450 3300048907 Bacteria 10314
370 Ga0496104_0055007 3300048907 Bacteria 3762
371 Ga0496104_0267426 3300048907 Bacteria 1622
372 Ga0496104_0438513 3300048907 Bacteria 1218
373 Ga0496104_0529348 3300048907 Bacteria 1090
374 Ga0496105_0065457 3300048908 Bacteria 3000
375 Ga0496105_0202307 3300048908 Bacteria 1621
376 Ga0496106_0004774 3300048909 Bacteria 10021
377 Ga0496106_0191065 3300048909 Bacteria 1628
378 Ga0496106_0331345 3300048909 Bacteria 1222
379 Ga0496108_0001577 3300048911 Bacteria 18043
380 Ga0496108_0001662 3300048911 Bacteria 17634
381 Ga0496108_0005481 3300048911 Bacteria 10262
382 Ga0496109_0001826 3300048912 Bacteria 17676
383 Ga0496109_0005506 3300048912 Bacteria 10604
384 Ga0496109_0010697 3300048912 Bacteria 7851
385 Ga0496109_0086327 3300048912 Bacteria 2898
386 Ga0496110_0004283 3300048913 Bacteria 11041
387 Ga0496110_0007481 3300048913 Bacteria 8729
388 Ga0496110_0235040 3300048913 Bacteria 1667
389 Ga0496111_0002928 3300048914 Bacteria 10439
390 Ga0496111_0011157 3300048914 Bacteria 6049
391 Ga0496111_0472865 3300048914 Unclassified 924
392 Ga0496112_0000498 3300048915 Bacteria 26502
393 Ga0496112_0003457 3300048915 Bacteria 13050
394 Ga0496112_0051634 3300048915 Bacteria 4033
395 Ga0496113_0000376 3300048916 Bacteria 21538
396 Ga0496113_0000471 3300048916 Bacteria 19753
397 Ga0496113_0015045 3300048916 Bacteria 5300
398 Ga0496114_0019202 3300048917 Bacteria 5538
399 Ga0496114_0040952 3300048917 Bacteria 3838
400 Ga0496115_0002606 3300048918 Bacteria 12943
401 Ga0501298_020118 3300049521 Bacteria 1241
402 Ga0501033_0091291 3300049570 Bacteria 2228
403 Ga0501033_0144261 3300049570 Bacteria 1721
404 Ga0501036_0059089 3300049572 Bacteria 3249
405 Ga0501036_0130583 3300049572 Bacteria 2121
406 Ga0501036_0141312 3300049572 Bacteria 2032
407 Ga0501038_0164564 3300049574 Bacteria 1800
408 Ga0501038_0254455 3300049574 Bacteria 1390
409 Ga0501039_0051677 3300049575 Bacteria 3180
410 Ga0501040_0012350 3300049576 Bacteria 5596
411 Ga0501040_0108825 3300049576 Bacteria 1937
412 Ga0501041_0028387 3300049577 Bacteria 3375
413 Ga0501041_0073659 3300049577 Bacteria 2098
414 Ga0501042_0032856 3300049578 Bacteria 3676
415 Ga0501042_0057039 3300049578 Bacteria 2787
416 Ga0501042_0164203 3300049578 Bacteria 1602
417 Ga0501048_0193721 3300049582 Bacteria 1440
418 Ga0501067_0007670 3300049583 Bacteria 6000
419 Ga0501067_0008016 3300049583 Bacteria 5866
420 Ga0501069_0038735 3300049585 Bacteria 2632
421 Ga0501069_0394589 3300049585 Bacteria 818
422 Ga0501070_0264625 3300049586 Bacteria 1405
423 Ga0501071_0013047 3300049587 Bacteria 5654
424 Ga0501072_0112509 3300049588 Bacteria 2167
425 Ga0501072_0284488 3300049588 Bacteria 1315
426 Ga0501073_0060181 3300049589 Bacteria 2651
427 Ga0501074_0102177 3300049590 Bacteria 2052
428 Ga0501074_0353190 3300049590 Bacteria 1043
429 Ga0501075_0049613 3300049591 Bacteria 3155
430 Ga0501075_0087661 3300049591 Bacteria 2359
431 Ga0501076_0003572 3300049592 Bacteria 10922
432 Ga0501076_0019754 3300049592 Bacteria 5153
433 Ga0501076_0205286 3300049592 Bacteria 1609
434 Ga0501077_0003507 3300049593 Bacteria 9414
435 Ga0501077_0003834 3300049593 Bacteria 9057
436 Ga0501077_0041542 3300049593 Bacteria 2927
437 Ga0501209_015778 3300049656 Unclassified 1692
438 Ga0501217_083950 3300049661 Bacteria 885
439 Ga0501249_019164 3300049679 Bacteria 1484
440 Ga0501079_0030828 3300049741 Bacteria 4121
441 Ga0501079_0042076 3300049741 Bacteria 3528
442 Ga0501080_0014985 3300049742 Bacteria 7139
443 Ga0501081_0028164 3300049743 Bacteria 3790
444 Ga0501081_0034461 3300049743 Bacteria 3445
445 Ga0501081_0098274 3300049743 Bacteria 2067
446 Ga0501083_0040759 3300049744 Bacteria 3152
447 Ga0501035_0166362 3300049822 Bacteria 1907
448 Ga0501045_0067125 3300049824 Bacteria 2634
449 Ga0501045_0086524 3300049824 Bacteria 2313
450 Ga0501045_0358747 3300049824 Bacteria 1085
451 nmdc:mga05p37_249562_c1 3300050507 Bacteria 2129
452 nmdc:mga05p37_269025_c1 3300050507 Bacteria 2037
453 nmdc:mga05p37_292280_c1 3300050507 Bacteria 1939
454 nmdc:mga05p37_3757_c1 3300050507 Bacteria 17773
455 nmdc:mga05p37_39469_c1 3300050507 Bacteria 5796
456 nmdc:mga05p37_48884_c1 3300050507 Bacteria 5201
457 nmdc:mga09592_2974_c1 3300050508 Bacteria 13740
458 nmdc:mga0qj67_300861_c1 3300050509 Unclassified 1299
459 nmdc:mga06r32_109780_c1 3300050510 Bacteria 2713
460 nmdc:mga06r32_355495_c1 3300050510 Bacteria 1449
461 nmdc:mga0n895_194612_c1 3300050512 Bacteria 2059
462 nmdc:mga0n895_264211_c1 3300050512 Bacteria 1746
463 nmdc:mga0n895_36433_c1 3300050512 Bacteria 4750
464 nmdc:mga0n895_733095_c1 3300050512 Bacteria 982
465 nmdc:mga0n895_76674_c1 3300050512 Bacteria 3324
466 nmdc:mga0rr50_226849_c1 3300050513 Bacteria 1544
467 nmdc:mga0rr50_230145_c1 3300050513 Bacteria 1533
468 nmdc:mga0rr50_312189_c1 3300050513 Bacteria 1317
469 nmdc:mga0rr50_53045_c1 3300050513 Bacteria 3015
470 nmdc:mga08x19_37437_c1 3300050514 Bacteria 3079
471 nmdc:mga08x19_81900_c1 3300050514 Bacteria 2120
472 nmdc:mga0a205_138564_c1 3300050515 Bacteria 2333
473 nmdc:mga0a205_262072_c1 3300050515 Bacteria 1606
474 nmdc:mga0a205_30274_c1 3300050515 Bacteria 5181
475 nmdc:mga0a205_42651_c1 3300050515 Bacteria 4372
476 nmdc:mga0a205_75056_c1 3300050515 Bacteria 3267
477 Ga0495612_0149555 3300053078 Bacteria 1016
478 Ga0501084_0008409 3300054114 Bacteria 8527
479 Ga0590071_004337 3300059421 Bacteria 3450
480 Ga0590071_027293 3300059421 Bacteria 1355
481 Ga0590075_033969 3300059424 Bacteria 1296
482 Ga0590077_022180 3300059426 Bacteria 1354
483 Ga0501082_0032870 3300060353 Bacteria 4474
484 Ga0501082_0053488 3300060353 Bacteria 3480
485 Ga0501082_0176170 3300060353 Bacteria 1859
486 Ga0530510_0055126 3300061734 Bacteria 2872
487 Ga0307406_10236349
488 MBSR1b_contig_110058
489 rootH2_10183864
490 Ga0065715_10109414
491 Ga0065715_10204674
492 Ga0070676_10310922
493 Ga0070690_100105929
494 Ga0070677_10012637
495 Ga0068869_100000567
496 Ga0070680_100211163
497 Ga0068868_100088181
498 Ga0070660_100303259
499 Ga0070691_10006166
500 Ga0070691_10020000
501 Ga0070661_100308223
502 Ga0070668_100045540
503 Ga0070668_100096867
504 Ga0070669_100050686
505 Ga0070669_100132842
506 Ga0070675_100252566
507 Ga0070671_100001161
508 Ga0070671_100242551
509 Ga0070674_100000037
510 Ga0070674_100076286
511 Ga0070673_100004524
512 Ga0070659_100085602
513 Ga0070667_100060781
514 Ga0070667_100416860
515 Ga0070709_10268338
516 Ga0070714_100097283
517 Ga0070705_100000440
518 Ga0070705_100038468
519 Ga0070694_100016870
520 Ga0070694_100095219
521 Ga0070694_100106973
522 Ga0070708_100002343
523 Ga0070708_100020222
524 Ga0070708_100059189
525 Ga0070678_100012043
526 Ga0070678_100113236
527 Ga0070662_100000534
528 Ga0070662_100507888
529 Ga0070681_10513503
530 Ga0068867_100006910
531 Ga0068867_100231394
532 Ga0070706_100001152
533 Ga0070706_100595434
534 Ga0070707_100000281
535 Ga0070698_100055270
536 Ga0070698_100282705
537 Ga0070699_100001115
538 Ga0070699_100019978
539 Ga0070699_100427245
540 Ga0070679_100146316
541 Ga0070679_100347311
542 Ga0070684_100238150
543 Ga0070697_100029061
544 Ga0070697_100032661
545 Ga0070697_100062093
546 Ga0070697_100652446
547 Ga0070672_100002483
548 Ga0070686_100352125
549 Ga0070695_100010705
550 Ga0070695_100052232
551 Ga0070695_100127205
552 Ga0070696_100000578
553 Ga0070696_100025065
554 Ga0070696_100084297
555 Ga0070693_100004632
556 Ga0070693_100246912
557 Ga0070665_100163661
558 Ga0070665_100243130
559 Ga0070704_100070414
560 Ga0070704_100107738
561 Ga0068855_100541736
562 Ga0068855_100684168
563 Ga0068855_100694495
564 Ga0070664_100009225
565 Ga0070664_100065529
566 Ga0070664_100503160
567 Ga0070664_100738108
568 Ga0068857_100013076
569 Ga0068854_100004209
570 Ga0068856_100223737
571 Ga0068852_100035762
572 Ga0068864_100001973
573 Ga0068866_10000023
574 Ga0068861_100006544
575 Ga0068861_100348857
576 Ga0068851_10000982
577 Ga0068863_100158621
578 Ga0068858_100074320
579 Ga0068860_100056190
580 Ga0081455_10018997
581 Ga0081538_10136666
582 Ga0070717_10611121
583 Ga0070715_10122417
584 Ga0070715_10149353
585 Ga0097621_100197509
586 Ga0068871_100016675
587 Ga0075431_100025367
588 Ga0075431_100353904
589 Ga0075433_10004838
590 Ga0075433_10032681
591 Ga0075433_10094353
592 Ga0075433_10120309
593 Ga0075434_100056209
594 Ga0075434_100102739
595 Ga0075434_100169893
596 Ga0075434_100202621
597 Ga0075434_100346128
598 Ga0075429_100022199
599 Ga0068865_100001083
600 Ga0075436_100003464
601 Ga0075436_100091729
602 Ga0075435_100227342
603 Ga0075435_100239746
604 Ga0075435_100388840
605 Ga0105240_10020377
606 Ga0105240_10165946
607 Ga0105240_11163834
608 Ga0111539_10809568
609 Ga0111539_10827820
610 Ga0105245_10047790
611 Ga0105245_10703233
612 Ga0114129_10037926
613 Ga0114129_10040891
614 Ga0114129_10099441
615 Ga0114129_10157814
616 Ga0114129_10323352
617 Ga0114129_10513200
618 Ga0114129_10613838
619 Ga0105243_10003530
620 Ga0105241_10005284
621 Ga0105241_10148857
622 Ga0105242_10000266
623 Ga0105248_10014234
624 Ga0105248_10054431
625 Ga0105248_10157765
626 Ga0105248_10261825
627 Ga0105237_10443047
628 Ga0105238_10616329
629 Ga0105249_10018728
630 Ga0105249_10207415
631 Ga0105249_10336512
632 Ga0105239_10003684
633 Ga0105239_10467907
634 Ga0105246_10077744
635 Ga0105246_10088684
636 Ga0157373_10075430
637 Ga0157373_10196003
638 Ga0157371_10126600
639 Ga0157370_10052715
640 Ga0157370_10125827
641 Ga0157369_10003415
642 Ga0157374_10046464
643 Ga0157378_10000329
644 Ga0163162_10011676
645 Ga0163162_10018740
646 Ga0157372_10024372
647 Ga0157372_10778046
648 Ga0157375_10099008
649 Ga0163163_10320264
650 Ga0157380_10340253
651 Ga0182008_10010897
652 Ga0157377_10178222
653 Ga0157379_10072249
654 Ga0157379_10158867
655 Ga0163161_10011926
656 Ga0197907_11369355
657 Ga0206356_11090931
658 Ga0206353_11695212
659 Ga0224712_10055213
660 Ga0207656_10003017
661 Ga0207682_10013678
662 Ga0207642_10000824
663 Ga0207699_10089750
664 Ga0207645_10062024
665 Ga0207643_10012076
666 Ga0207684_10011546
667 Ga0207684_10411228
668 Ga0207684_10455120
669 Ga0207654_10374333
670 Ga0207707_10065762
671 Ga0207695_10029251
672 Ga0207695_10048595
673 Ga0207695_10065287
674 Ga0207695_10191386
675 Ga0207671_10255335
676 Ga0207663_10120889
677 Ga0207649_10063581
678 Ga0207652_10034625
679 Ga0207652_10102078
680 Ga0207652_10191186
681 Ga0207652_10206877
682 Ga0207646_10006209
683 Ga0207646_10574577
684 Ga0207681_10055573
685 Ga0207681_10450722
686 Ga0207694_10511911
687 Ga0207687_10040350
688 Ga0207687_10497324
689 Ga0207690_10030135
690 Ga0207706_10000011
691 Ga0207706_10141305
692 Ga0207686_10000049
693 Ga0207709_10006305
694 Ga0207669_10082455
695 Ga0207669_10104541
696 Ga0207704_10006599
697 Ga0207691_10014705
698 Ga0207711_10096600
699 Ga0207689_10000895
700 Ga0207679_10147688
701 Ga0207667_10404643
702 Ga0207651_10056034
703 Ga0207651_10063834
704 Ga0207651_10116002
705 Ga0207651_10203000
706 Ga0207712_10002282
707 Ga0207640_10006003
708 Ga0207640_10156381
709 Ga0207640_10537463
710 Ga0207658_10024138
711 Ga0207703_10011903
712 Ga0207708_10020762
713 Ga0207702_10239044
714 Ga0207702_10582882
715 Ga0207641_10119937
716 Ga0207641_10147567
717 Ga0207641_10586775
718 Ga0207648_10000011
719 Ga0207648_10201068
720 Ga0207676_10117889
721 Ga0207676_10197911
722 Ga0207674_10003590
723 Ga0207674_10578041
724 Ga0207675_100009407
725 Ga0207683_10014229
726 Ga0207698_10013791
727 Ga0209998_10014428
728 Ga0209974_10069676
729 Ga0268266_10041165
730 Ga0268266_10186660
731 Ga0268264_10157011
732 Ga0307408_100078139
733 Ga0307405_10013869
734 Ga0307405_10042420
735 Ga0307405_10053153
736 Ga0307413_10002094
737 Ga0307413_10008897
738 Ga0307413_10036437
739 Ga0307413_10036891
740 Ga0307413_10044768
741 Ga0307413_10072375
742 Ga0307410_10000857
743 Ga0307410_10160194
744 Ga0307406_10011088
745 Ga0307406_10065635
746 Ga0307406_10069293
747 Ga0307407_10002476
748 Ga0307407_10005489
749 Ga0307407_10107320
750 Ga0307407_10299168
751 Ga0307412_10026831
752 Ga0307409_100006818
753 Ga0307409_100210189
754 Ga0307409_100237639
755 Ga0307409_100418110
756 Ga0307409_100634558
757 Ga0307416_100000666
758 Ga0307416_100002463
759 Ga0307416_100006863
760 Ga0307416_100077737
761 Ga0307416_100080549
762 Ga0307416_100121793
763 Ga0307414_10004191
764 Ga0307414_10005968
765 Ga0307414_10008152
766 Ga0307414_10011198
767 Ga0307414_10048158
768 Ga0307414_10080241
769 Ga0307414_10111041
770 Ga0307414_10212220
771 Ga0307411_10001595
772 Ga0307411_10009293
773 Ga0307411_10012262
774 Ga0307411_10016869
775 Ga0307411_10029355
776 Ga0307411_10034629
777 Ga0307411_10056825
778 Ga0307411_10207243
779 Ga0307415_100000818
780 Ga0307415_100023413
781 Ga0307415_100032673
782 Ga0307415_100055376
783 Ga0307415_100056711
784 Ga0307415_100123282
785 Ga0307415_100129604
786 Ga0307415_100594678
787 Ga0373929_0048954
788 Ga0373940_0004992
789 Ga0373949_0106700
790 Ga0373960_0022691
791 Ga0373931_0011786
792 Ga0373931_0141390
793 Ga0316584_0337212
794 Ga0395899_0220003
795 Ga0395905_0189310
796 Ga0400484_31294
797 Ga0400490_09944
798 Ga0400490_14276
799 Ga0400490_29790
800 Ga0400491_07341
801 Ga0400491_19811
802 Ga0400488_03244
803 Ga0400488_07739
804 Ga0400488_32104
805 Ga0400488_33304
806 Ga0400488_47307
807 Ga0400488_47832
808 Ga0400488_48972
809 Ga0242420_001941
810 Ga0400483_005413
811 Ga0400483_076685
812 Ga0400483_106880
813 Ga0400483_130199
814 Ga0400483_156960
815 Ga0400483_206326
816 Ga0400483_274959
817 Ga0400487_04096
818 Ga0400487_19915
819 Ga0400487_26765
820 Ga0400487_51244
821 Ga0439434_0079548
822 Ga0451577_0001980
823 Ga0451577_0045554
824 Ga0451577_0137685
825 Ga0453683_0036597
826 Ga0453683_0142580
827 Ga0453684_0393590
828 Ga0453684_0935691
829 Ga0466958_0149223
830 Ga0495639_0035681
831 Ga0495664_0046561
832 Ga0495594_0001662
833 Ga0495630_0003001
834 Ga0495666_0000296
835 Ga0495640_0030279
836 Ga0495586_0003076
837 Ga0495622_0062199
838 Ga0495588_0070122
839 Ga0495599_0062777
840 Ga0495658_0002504
841 Ga0495624_0093098
842 Ga0495636_0220197
843 Ga0495674_0006122
844 Ga0495680_0011238
845 Ga0495614_0090104
846 Ga0496100_0223503
847 Ga0496102_0004666
848 Ga0496102_0024364
849 Ga0496102_0034235
850 Ga0496102_0043489
851 Ga0496102_0065491
852 Ga0496102_0193129
853 Ga0496102_0357805
854 Ga0496103_0006657
855 Ga0496104_0006450
856 Ga0496104_0055007
857 Ga0496104_0267426
858 Ga0496104_0438513
859 Ga0496104_0529348
860 Ga0496105_0065457
861 Ga0496105_0202307
862 Ga0496106_0004774
863 Ga0496106_0191065
864 Ga0496106_0331345
865 Ga0496108_0001577
866 Ga0496108_0001662
867 Ga0496108_0005481
868 Ga0496109_0001826
869 Ga0496109_0005506
870 Ga0496109_0010697
871 Ga0496109_0086327
872 Ga0496110_0004283
873 Ga0496110_0007481
874 Ga0496110_0235040
875 Ga0496111_0002928
876 Ga0496111_0011157
877 Ga0496111_0472865
878 Ga0496112_0000498
879 Ga0496112_0003457
880 Ga0496112_0051634
881 Ga0496113_0000376
882 Ga0496113_0000471
883 Ga0496113_0015045
884 Ga0496114_0019202
885 Ga0496114_0040952
886 Ga0496115_0002606
887 Ga0501298_020118
888 Ga0501033_0091291
889 Ga0501033_0144261
890 Ga0501036_0059089
891 Ga0501036_0130583
892 Ga0501036_0141312
893 Ga0501038_0164564
894 Ga0501038_0254455
895 Ga0501039_0051677
896 Ga0501040_0012350
897 Ga0501040_0108825
898 Ga0501041_0028387
899 Ga0501041_0073659
900 Ga0501042_0032856
901 Ga0501042_0057039
902 Ga0501042_0164203
903 Ga0501048_0193721
904 Ga0501067_0007670
905 Ga0501067_0008016
906 Ga0501069_0038735
907 Ga0501069_0394589
908 Ga0501070_0264625
909 Ga0501071_0013047
910 Ga0501072_0112509
911 Ga0501072_0284488
912 Ga0501073_0060181
913 Ga0501074_0102177
914 Ga0501074_0353190
915 Ga0501075_0049613
916 Ga0501075_0087661
917 Ga0501076_0003572
918 Ga0501076_0019754
919 Ga0501076_0205286
920 Ga0501077_0003507
921 Ga0501077_0003834
922 Ga0501077_0041542
923 Ga0501209_015778
924 Ga0501217_083950
925 Ga0501249_019164
926 Ga0501079_0030828
927 Ga0501079_0042076
928 Ga0501080_0014985
929 Ga0501081_0028164
930 Ga0501081_0034461
931 Ga0501081_0098274
932 Ga0501083_0040759
933 Ga0501035_0166362
934 Ga0501045_0067125
935 Ga0501045_0086524
936 Ga0501045_0358747
937 nmdc:mga05p37_249562_c1
938 nmdc:mga05p37_269025_c1
939 nmdc:mga05p37_292280_c1
940 nmdc:mga05p37_3757_c1
941 nmdc:mga05p37_39469_c1
942 nmdc:mga05p37_48884_c1
943 nmdc:mga09592_2974_c1
944 nmdc:mga0qj67_300861_c1
945 nmdc:mga06r32_109780_c1
946 nmdc:mga06r32_355495_c1
947 nmdc:mga0n895_194612_c1
948 nmdc:mga0n895_264211_c1
949 nmdc:mga0n895_36433_c1
950 nmdc:mga0n895_733095_c1
951 nmdc:mga0n895_76674_c1
952 nmdc:mga0rr50_226849_c1
953 nmdc:mga0rr50_230145_c1
954 nmdc:mga0rr50_312189_c1
955 nmdc:mga0rr50_53045_c1
956 nmdc:mga08x19_37437_c1
957 nmdc:mga08x19_81900_c1
958 nmdc:mga0a205_138564_c1
959 nmdc:mga0a205_262072_c1
960 nmdc:mga0a205_30274_c1
961 nmdc:mga0a205_42651_c1
962 nmdc:mga0a205_75056_c1
963 Ga0495612_0149555
964 Ga0501084_0008409
965 Ga0590071_004337
966 Ga0590071_027293
967 Ga0590075_033969
968 Ga0590077_022180
969 Ga0501082_0032870
970 Ga0501082_0053488
971 Ga0501082_0176170
972 Ga0530510_0055126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

50

261

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ny7-assembly1.cif.gz_B bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form 0.9857 20 247
1otw-assembly1.cif.gz_A crystal structure of pqqc in complex with pqq and a putative h2o2 0.9846 19 247
5vrd-assembly2.cif.gz_C-2 crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9489 28 248
3hml-assembly1.cif.gz_B crystal structure of pqqc active site mutant h154s in complex with pqq 0.9461 23 247
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9447 25 248
ID Description Score Start End Superfamily
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9494 20 247 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8766 27 243 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8609 27 243 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8526 20 247 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8432 25 245 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A6J4MAJ8-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) 0.9992 25 249 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A7V9T229-F1-model_v4 Pyrroloquinoline-quinone synthase PqqC 0.9976 40 250 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A6J4MAJ8-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) 0.9948 25 249 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A7V9T229-F1-model_v4 Pyrroloquinoline-quinone synthase PqqC 0.9929 40 250 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A443TZV1-F1-model_v4 deleted 0.9854 24 247

Map