F453240

General Info

Members Datasets Scaffolds Average Seq Length
486 174 972 102

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100046418|Ga0075428_1000464186
Length 109
Sequence MEEGGSRSMSTAVNAETVRQALRQVKDPELDLNIMDLGLVYDVEVEDGTVRIEMTLTSPGCPAGPMITNDAHKAVRALEGVKDVNIEIVWEPYWTPEKIEPKVRAMMGF

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
106 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.91
Stem 0
Stem Tuber 0
Unclassified 24.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100046418 3300006844 Bacteria 4772
2 Ga0065707_11165256 3300005295 Bacteria 502
3 Ga0070680_100041313 3300005336 Unclassified 3739
4 Ga0070680_100041403 3300005336 Unclassified 3735
5 Ga0070680_100932519 3300005336 Unclassified 749
6 Ga0070680_100942964 3300005336 Bacteria 745
7 Ga0070691_10409626 3300005341 Bacteria 766
8 Ga0070691_10946381 3300005341 Bacteria 534
9 Ga0070687_100072621 3300005343 Unclassified 1852
10 Ga0070692_10019655 3300005345 Unclassified 3262
11 Ga0070703_10000312 3300005406 Bacteria 22103
12 Ga0070703_10003122 3300005406 Bacteria 4739
13 Ga0070703_10012399 3300005406 Unclassified 2415
14 Ga0070703_10167515 3300005406 Bacteria 839
15 Ga0070709_10001591 3300005434 Bacteria 12263
16 Ga0070709_10036640 3300005434 Bacteria 2990
17 Ga0070714_100553980 3300005435 Bacteria 1101
18 Ga0070713_100018575 3300005436 Bacteria 5285
19 Ga0070713_100141184 3300005436 Bacteria 2134
20 Ga0070710_10432575 3300005437 Bacteria 888
21 Ga0070701_10013238 3300005438 Unclassified 3747
22 Ga0070711_100000009 3300005439 Bacteria 172420
23 Ga0070705_100001768 3300005440 Bacteria 11199
24 Ga0070705_100005416 3300005440 Bacteria 6218
25 Ga0070705_100012180 3300005440 Bacteria 4364
26 Ga0070705_100020287 3300005440 Bacteria 3514
27 Ga0070705_100026374 3300005440 Bacteria 3162
28 Ga0070705_100039573 3300005440 Bacteria 2676
29 Ga0070705_100108612 3300005440 Unclassified 1767
30 Ga0070705_100897537 3300005440 Bacteria 712
31 Ga0070694_100002184 3300005444 Bacteria 11590
32 Ga0070694_100006177 3300005444 Bacteria 7272
33 Ga0070694_100006607 3300005444 Bacteria 7046
34 Ga0070694_100009692 3300005444 Bacteria 5914
35 Ga0070694_100018767 3300005444 Bacteria 4394
36 Ga0070694_100028203 3300005444 Bacteria 3650
37 Ga0070694_100032710 3300005444 Bacteria 3417
38 Ga0070694_100110198 3300005444 Bacteria 1960
39 Ga0070694_100119351 3300005444 Bacteria 1890
40 Ga0070708_100032779 3300005445 Bacteria 4508
41 Ga0070708_100033969 3300005445 Bacteria 4433
42 Ga0070708_100041509 3300005445 Bacteria 4034
43 Ga0070708_100054288 3300005445 Bacteria 3558
44 Ga0070708_100070326 3300005445 Bacteria 3148
45 Ga0070708_100179294 3300005445 Unclassified 1979
46 Ga0070708_100251826 3300005445 Bacteria 1659
47 Ga0070708_100251830 3300005445 Bacteria 1659
48 Ga0070708_100372434 3300005445 Bacteria 1346
49 Ga0070708_100535296 3300005445 Bacteria 1105
50 Ga0070708_100882900 3300005445 Bacteria 840
51 Ga0068867_100316599 3300005459 Bacteria 1291
52 Ga0068867_101836563 3300005459 Bacteria 570
53 Ga0070706_100007410 3300005467 Bacteria 10293
54 Ga0070706_100021396 3300005467 Bacteria 5957
55 Ga0070706_100039989 3300005467 Bacteria 4329
56 Ga0070706_100080815 3300005467 Unclassified 3010
57 Ga0070706_100112958 3300005467 Unclassified 2530
58 Ga0070706_100233903 3300005467 Bacteria 1715
59 Ga0070706_100269799 3300005467 Bacteria 1588
60 Ga0070706_100280079 3300005467 Bacteria 1556
61 Ga0070706_100466124 3300005467 Unclassified 1175
62 Ga0070706_100885558 3300005467 Bacteria 825
63 Ga0070706_102039793 3300005467 Bacteria 519
64 Ga0070707_100015947 3300005468 Bacteria 7053
65 Ga0070707_100026813 3300005468 Bacteria 5474
66 Ga0070707_100033723 3300005468 Bacteria 4882
67 Ga0070707_100088721 3300005468 Bacteria 2992
68 Ga0070707_100110662 3300005468 Unclassified 2664
69 Ga0070707_100184489 3300005468 Unclassified 2034
70 Ga0070707_100227761 3300005468 Unclassified 1815
71 Ga0070707_100364239 3300005468 Unclassified 1404
72 Ga0070707_100549085 3300005468 Bacteria 1118
73 Ga0070707_100667046 3300005468 Bacteria 1003
74 Ga0070707_100941967 3300005468 Bacteria 828
75 Ga0070707_100970059 3300005468 Bacteria 815
76 Ga0070707_101331532 3300005468 Unclassified 684
77 Ga0070698_100001472 3300005471 Bacteria 26148
78 Ga0070698_100053985 3300005471 Bacteria 4081
79 Ga0070698_100055410 3300005471 Bacteria 4020
80 Ga0070698_100090053 3300005471 Bacteria 3051
81 Ga0070698_100165305 3300005471 Bacteria 2156
82 Ga0070698_100823150 3300005471 Bacteria 873
83 Ga0070698_101853109 3300005471 Unclassified 556
84 Ga0070699_100000112 3300005518 Bacteria 75499
85 Ga0070699_100008266 3300005518 Bacteria 9026
86 Ga0070699_100023736 3300005518 Bacteria 5284
87 Ga0070699_100028702 3300005518 Bacteria 4797
88 Ga0070699_100040976 3300005518 Bacteria 4008
89 Ga0070699_100086775 3300005518 Bacteria 2731
90 Ga0070699_100105083 3300005518 Bacteria 2477
91 Ga0070699_100111368 3300005518 Bacteria 2403
92 Ga0070699_100209731 3300005518 Unclassified 1734
93 Ga0070699_100308640 3300005518 Bacteria 1420
94 Ga0070699_100329141 3300005518 Bacteria 1374
95 Ga0070699_100331991 3300005518 Bacteria 1368
96 Ga0070699_100407281 3300005518 Bacteria 1230
97 Ga0070699_101316885 3300005518 Bacteria 662
98 Ga0070679_100501155 3300005530 Bacteria 1158
99 Ga0070697_100014519 3300005536 Bacteria 6187
100 Ga0070697_100031768 3300005536 Bacteria 4248
101 Ga0070697_100047304 3300005536 Bacteria 3488
102 Ga0070697_100056437 3300005536 Bacteria 3195
103 Ga0070697_100086070 3300005536 Bacteria 2593
104 Ga0070697_100086670 3300005536 Bacteria 2584
105 Ga0070697_100139820 3300005536 Bacteria 2036
106 Ga0070697_100147085 3300005536 Unclassified 1984
107 Ga0070697_100337718 3300005536 Bacteria 1299
108 Ga0070697_100442135 3300005536 Bacteria 1132
109 Ga0070697_100482004 3300005536 Bacteria 1083
110 Ga0070697_100603743 3300005536 Bacteria 965
111 Ga0070697_101141297 3300005536 Unclassified 694
112 Ga0070697_101504655 3300005536 Bacteria 602
113 Ga0070697_101675302 3300005536 Unclassified 569
114 Ga0070697_101897269 3300005536 Bacteria 533
115 Ga0070686_100005480 3300005544 Bacteria 7028
116 Ga0070686_101936430 3300005544 Unclassified 503
117 Ga0070695_100000660 3300005545 Bacteria 18420
118 Ga0070695_100003990 3300005545 Bacteria 8622
119 Ga0070695_100021966 3300005545 Unclassified 3910
120 Ga0070695_100059683 3300005545 Unclassified 2470
121 Ga0070695_100107948 3300005545 Unclassified 1884
122 Ga0070695_100114849 3300005545 Unclassified 1833
123 Ga0070695_100148145 3300005545 Bacteria 1635
124 Ga0070695_100223444 3300005545 Bacteria 1358
125 Ga0070695_100304698 3300005545 Bacteria 1179
126 Ga0070695_101724283 3300005545 Bacteria 524
127 Ga0070696_100001231 3300005546 Bacteria 16615
128 Ga0070696_100005131 3300005546 Bacteria 8749
129 Ga0070696_100029946 3300005546 Bacteria 3723
130 Ga0070696_100056505 3300005546 Bacteria 2737
131 Ga0070696_100081969 3300005546 Bacteria 2286
132 Ga0070696_100261992 3300005546 Bacteria 1311
133 Ga0070696_100315553 3300005546 Bacteria 1201
134 Ga0070693_100352310 3300005547 Bacteria 1008
135 Ga0070704_100001840 3300005549 Bacteria 11695
136 Ga0070704_100001963 3300005549 Bacteria 11385
137 Ga0070704_100002710 3300005549 Bacteria 10019
138 Ga0070704_100015368 3300005549 Bacteria 4807
139 Ga0070704_100027153 3300005549 Bacteria 3793
140 Ga0070704_100034771 3300005549 Bacteria 3420
141 Ga0070704_100282121 3300005549 Bacteria 1377
142 Ga0070704_100379440 3300005549 Bacteria 1200
143 Ga0070704_100445024 3300005549 Bacteria 1114
144 Ga0068859_100207954 3300005617 Bacteria 2043
145 Ga0068861_100055270 3300005719 Unclassified 3027
146 Ga0068858_101519347 3300005842 Bacteria 660
147 Ga0068860_101909711 3300005843 Bacteria 615
148 Ga0068862_101333785 3300005844 Unclassified 719
149 Ga0081455_10059097 3300005937 Bacteria 3239
150 Ga0081538_10081069 3300005981 Bacteria 1728
151 Ga0070716_100002438 3300006173 Bacteria 8569
152 Ga0070716_100080470 3300006173 Bacteria 1943
153 Ga0070716_100232550 3300006173 Bacteria 1245
154 Ga0075428_100001051 3300006844 Bacteria 29325
155 Ga0075428_101429992 3300006844 Unclassified 725
156 Ga0075430_100024539 3300006846 Bacteria 5128
157 Ga0075430_100658192 3300006846 Unclassified 864
158 Ga0075431_100010047 3300006847 Bacteria 9507
159 Ga0075431_100085016 3300006847 Unclassified 3266
160 Ga0075431_100334981 3300006847 Bacteria 1523
161 Ga0075431_100756848 3300006847 Bacteria 947
162 Ga0075431_100942653 3300006847 Bacteria 832
163 Ga0075431_102235383 3300006847 Bacteria 501
164 Ga0075433_10018802 3300006852 Bacteria 5749
165 Ga0075433_10019386 3300006852 Bacteria 5667
166 Ga0075433_10049655 3300006852 Bacteria 3650
167 Ga0075433_10052377 3300006852 Unclassified 3556
168 Ga0075433_10121545 3300006852 Bacteria 2319
169 Ga0075433_10145022 3300006852 Unclassified 2111
170 Ga0075433_10222013 3300006852 Bacteria 1678
171 Ga0075433_10227895 3300006852 Bacteria 1655
172 Ga0075434_100002623 3300006871 Bacteria 15856
173 Ga0075434_100014034 3300006871 Bacteria 7648
174 Ga0075434_100015037 3300006871 Bacteria 7411
175 Ga0075434_100027691 3300006871 Bacteria 5565
176 Ga0075434_100031498 3300006871 Bacteria 5229
177 Ga0075434_100249453 3300006871 Bacteria 1794
178 Ga0075434_100268597 3300006871 Bacteria 1725
179 Ga0075434_100408084 3300006871 Bacteria 1380
180 Ga0075434_100734658 3300006871 Bacteria 1004
181 Ga0075429_100013191 3300006880 Bacteria 7170
182 Ga0075429_100495904 3300006880 Bacteria 1070
183 Ga0068865_100197027 3300006881 Bacteria 1561
184 Ga0075436_100015829 3300006914 Bacteria 5164
185 Ga0075436_100016770 3300006914 Bacteria 5014
186 Ga0075436_100017353 3300006914 Bacteria 4927
187 Ga0075436_100020022 3300006914 Bacteria 4591
188 Ga0075436_100021020 3300006914 Unclassified 4478
189 Ga0075436_100026317 3300006914 Bacteria 4005
190 Ga0075436_100053424 3300006914 Unclassified 2789
191 Ga0075436_100056023 3300006914 Bacteria 2723
192 Ga0075436_100064177 3300006914 Unclassified 2538
193 Ga0075436_100081674 3300006914 Bacteria 2241
194 Ga0075436_100087679 3300006914 Bacteria 2162
195 Ga0075436_100167545 3300006914 Bacteria 1551
196 Ga0075436_100366939 3300006914 Unclassified 1039
197 Ga0075436_100701388 3300006914 Bacteria 750
198 Ga0097620_100207955 3300006931 Bacteria 2043
199 Ga0075435_100000439 3300007076 Bacteria 25401
200 Ga0075435_100019280 3300007076 Bacteria 5206
201 Ga0075435_100033835 3300007076 Bacteria 4044
202 Ga0075435_100133385 3300007076 Bacteria 2079
203 Ga0075435_100158702 3300007076 Bacteria 1904
204 Ga0075435_100194490 3300007076 Bacteria 1717
205 Ga0075435_100207002 3300007076 Unclassified 1663
206 Ga0075435_100267219 3300007076 Unclassified 1458
207 Ga0075435_100420715 3300007076 Unclassified 1151
208 Ga0075435_100511380 3300007076 Unclassified 1039
209 Ga0075435_100538480 3300007076 Bacteria 1011
210 Ga0075435_100605450 3300007076 Bacteria 950
211 Ga0075435_100785698 3300007076 Unclassified 829
212 Ga0099794_10000007 3300007265 Bacteria 128667
213 Ga0099794_10008182 3300007265 Bacteria 4334
214 Ga0099794_10315888 3300007265 Bacteria 810
215 Ga0099794_10466045 3300007265 Bacteria 663
216 Ga0099794_10474414 3300007265 Bacteria 657
217 Ga0099795_10313360 3300007788 Unclassified 693
218 Ga0099795_10556578 3300007788 Unclassified 541
219 Ga0099795_10565891 3300007788 Bacteria 537
220 Ga0105245_10336599 3300009098 Bacteria 1491
221 Ga0105245_10639447 3300009098 Bacteria 1093
222 Ga0114129_10034307 3300009147 Bacteria 7166
223 Ga0114129_10122924 3300009147 Unclassified 3571
224 Ga0114129_11444170 3300009147 Unclassified 847
225 Ga0114129_12265878 3300009147 Unclassified 652
226 Ga0114129_12285932 3300009147 Unclassified 649
227 Ga0114129_12943657 3300009147 Unclassified 562
228 Ga0114129_13137927 3300009147 Bacteria 539
229 Ga0114129_13266691 3300009147 Unclassified 525
230 Ga0105242_10606670 3300009176 Unclassified 1058
231 Ga0099796_10084300 3300010159 Bacteria 1171
232 Ga0099796_10251156 3300010159 Bacteria 734
233 Ga0157378_10098928 3300013297 Unclassified 2661
234 Ga0163162_10001791 3300013306 Bacteria 20158
235 Ga0157380_10368848 3300014326 Unclassified 1350
236 Ga0213875_10029476 3300021388 Bacteria 2603
237 Ga0213875_10285679 3300021388 Bacteria 779
238 Ga0207653_10000005 3300025885 Bacteria 257928
239 Ga0207653_10003039 3300025885 Bacteria 5331
240 Ga0207653_10004080 3300025885 Bacteria 4595
241 Ga0207653_10014693 3300025885 Unclassified 2457
242 Ga0207653_10014775 3300025885 Bacteria 2450
243 Ga0207653_10035230 3300025885 Unclassified 1627
244 Ga0207692_10606746 3300025898 Bacteria 704
245 Ga0207692_11085421 3300025898 Bacteria 530
246 Ga0207699_10015088 3300025906 Bacteria 4006
247 Ga0207684_10004665 3300025910 Bacteria 12866
248 Ga0207684_10032747 3300025910 Bacteria 4420
249 Ga0207684_10036915 3300025910 Bacteria 4147
250 Ga0207684_10072400 3300025910 Bacteria 2927
251 Ga0207684_10401849 3300025910 Bacteria 1178
252 Ga0207684_10638698 3300025910 Bacteria 907
253 Ga0207684_10815539 3300025910 Bacteria 788
254 Ga0207684_10837827 3300025910 Unclassified 776
255 Ga0207684_11198482 3300025910 Unclassified 629
256 Ga0207693_10515198 3300025915 Bacteria 933
257 Ga0207663_10000013 3300025916 Bacteria 167304
258 Ga0207660_10027788 3300025917 Unclassified 3864
259 Ga0207660_10351059 3300025917 Unclassified 1182
260 Ga0207652_10978333 3300025921 Bacteria 744
261 Ga0207646_10002324 3300025922 Bacteria 22521
262 Ga0207646_10002369 3300025922 Bacteria 22279
263 Ga0207646_10019111 3300025922 Bacteria 6372
264 Ga0207646_10027092 3300025922 Bacteria 5226
265 Ga0207646_10051503 3300025922 Bacteria 3684
266 Ga0207646_10062347 3300025922 Bacteria 3328
267 Ga0207646_10080170 3300025922 Bacteria 2919
268 Ga0207646_10146188 3300025922 Bacteria 2130
269 Ga0207646_10223912 3300025922 Unclassified 1699
270 Ga0207646_10488471 3300025922 Bacteria 1110
271 Ga0207646_10639659 3300025922 Unclassified 953
272 Ga0207646_10662671 3300025922 Bacteria 934
273 Ga0207646_11384325 3300025922 Unclassified 612
274 Ga0207687_10346474 3300025927 Bacteria 1209
275 Ga0207700_10021096 3300025928 Bacteria 4441
276 Ga0207700_10135116 3300025928 Bacteria 2019
277 Ga0207664_10338558 3300025929 Bacteria 1330
278 Ga0207665_10001116 3300025939 Bacteria 18005
279 Ga0207665_10044618 3300025939 Unclassified 2966
280 Ga0207665_10973723 3300025939 Bacteria 674
281 Ga0207689_10088646 3300025942 Unclassified 2541
282 Ga0207703_11155345 3300026035 Bacteria 744
283 Ga0207708_10035087 3300026075 Unclassified 3817
284 Ga0207648_10102480 3300026089 Bacteria 2509
285 Ga0207675_100079843 3300026118 Unclassified 3066
286 Ga0209179_1146608 3300027512 Unclassified 527
287 Ga0209588_1000301 3300027671 Bacteria 12923
288 Ga0209588_1000744 3300027671 Bacteria 8259
289 Ga0209588_1066229 3300027671 Unclassified 1168
290 Ga0209588_1258655 3300027671 Bacteria 530
291 Ga0207428_11148167 3300027907 Bacteria 542
292 Ga0268265_10596437 3300028380 Bacteria 1055
293 Ga0268264_10278519 3300028381 Bacteria 1566
294 Ga0268264_11844779 3300028381 Bacteria 615
295 Ga0316182_1170625 3300030745 Unclassified 1584
296 Ga0265325_10145370 3300031241 Bacteria 1125
297 Ga0307408_100174615 3300031548 Bacteria 1718
298 Ga0307405_10164023 3300031731 Bacteria 1577
299 Ga0307413_10035564 3300031824 Bacteria 2858
300 Ga0307410_10175017 3300031852 Bacteria 1620
301 Ga0307410_10183181 3300031852 Unclassified 1587
302 Ga0307406_10498840 3300031901 Bacteria 986
303 Ga0307407_10004285 3300031903 Bacteria 6023
304 Ga0307412_10420224 3300031911 Bacteria 1093
305 Ga0307409_100354558 3300031995 Bacteria 1385
306 Ga0307416_102517136 3300032002 Unclassified 613
307 Ga0307414_10420432 3300032004 Bacteria 1165
308 Ga0307411_10131914 3300032005 Bacteria 1827
309 Ga0307415_100307789 3300032126 Bacteria 1315
310 Ga0373937_1556869 3300036401 Bacteria 608
311 Ga0395905_1414562 3300037471 Unclassified 600
312 Ga0436364_0023825 3300037853 Bacteria 752
313 Ga0436364_0093676 3300037853 Unclassified 963
314 Ga0436364_0100154 3300037853 Bacteria 2894
315 Ga0436364_0252816 3300037853 Bacteria 17228
316 Ga0436364_1511780 3300037853 Bacteria 1506
317 Ga0436365_0216814 3300039437 Unclassified 793
318 Ga0436365_0492245 3300039437 Bacteria 2888
319 Ga0436365_0656722 3300039437 Bacteria 22448
320 Ga0436365_0907664 3300039437 Bacteria 3634
321 Ga0436365_1271877 3300039437 Bacteria 626
322 Ga0436365_1299205 3300039437 Bacteria 4136
323 Ga0436363_1011037 3300039450 Bacteria 541
324 Ga0436363_1600977 3300039450 Unclassified 504
325 Ga0436362_0025062 3300039453 Bacteria 2600
326 Ga0436362_0225907 3300039453 Bacteria 2886
327 Ga0436362_0447126 3300039453 Bacteria 1036
328 Ga0436362_0733634 3300039453 Bacteria 761
329 Ga0436362_0887819 3300039453 Bacteria 935
330 Ga0439436_0032844 3300041404 Viruses 1504
331 Ga0439461_0082962 3300041410 Bacteria 759
332 Ga0439433_0053344 3300041999 Unclassified 956
333 Ga0439449_0112296 3300042007 Bacteria 1010
334 Ga0439457_021347 3300042014 Bacteria 1436
335 Ga0439462_0010059 3300042015 Bacteria 2394
336 Ga0439462_0127653 3300042015 Unclassified 709
337 Ga0450897_019743 3300042128 Bacteria 715
338 Ga0450894_052637 3300042131 Bacteria 602
339 Ga0450906_031488 3300042145 Bacteria 938
340 Ga0439446_0003024 3300042156 Bacteria 4120
341 Ga0439446_0268018 3300042156 Bacteria 593
342 Ga0439434_0164669 3300042435 Unclassified 738
343 Ga0439444_0010265 3300042437 Unclassified 1494
344 Ga0451577_0856873 3300042876 Unclassified 819
345 Ga0453683_0015251 3300044673 Bacteria 4980
346 Ga0453683_0175503 3300044673 Bacteria 1358
347 Ga0453683_0176814 3300044673 Bacteria 1353
348 Ga0453683_0193890 3300044673 Bacteria 1289
349 Ga0466966_0191965 3300044684 Bacteria 1237
350 Ga0466961_0014611 3300044693 Bacteria 5044
351 Ga0466963_0194884 3300044694 Bacteria 1416
352 Ga0466963_0200580 3300044694 Bacteria 1395
353 Ga0466964_0563593 3300044706 Bacteria 620
354 Ga0466964_0663437 3300044706 Unclassified 578
355 Ga0453684_1798611 3300044712 Bacteria 623
356 Ga0466971_0009833 3300044719 Bacteria 4176
357 Ga0466971_0031052 3300044719 Bacteria 2391
358 Ga0466968_0038645 3300044735 Unclassified 2006
359 Ga0466970_0029208 3300044765 Bacteria 2902
360 Ga0466957_0007386 3300044842 Bacteria 6212
361 Ga0466957_0054706 3300044842 Bacteria 2437
362 Ga0466957_0312148 3300044842 Bacteria 1059
363 Ga0466959_0045138 3300045049 Bacteria 3246
364 Ga0466959_0055700 3300045049 Bacteria 2886
365 Ga0466959_0492565 3300045049 Unclassified 829
366 Ga0451576_0002297 3300045051 Bacteria 29018
367 Ga0451576_0007922 3300045051 Bacteria 12571
368 Ga0451576_0059201 3300045051 Bacteria 3999
369 Ga0451576_0074507 3300045051 Bacteria 3532
370 Ga0451576_0074911 3300045051 Bacteria 3521
371 Ga0451576_0135827 3300045051 Bacteria 2564
372 Ga0451576_0261466 3300045051 Bacteria 1809
373 Ga0451576_0299892 3300045051 Bacteria 1680
374 Ga0451576_0383317 3300045051 Bacteria 1473
375 Ga0451576_1425020 3300045051 Unclassified 721
376 Ga0466958_0061748 3300045836 Bacteria 2283
377 Ga0466958_0089877 3300045836 Bacteria 1899
378 Ga0466958_0161372 3300045836 Bacteria 1416
379 Ga0466958_0357403 3300045836 Bacteria 941
380 Ga0466958_0540262 3300045836 Bacteria 757
381 Ga0466967_1541487 3300045976 Bacteria 662
382 Ga0495629_0575109 3300046459 Unclassified 755
383 Ga0495582_0012937 3300046473 Unclassified 4598
384 Ga0495662_0069530 3300046476 Bacteria 1705
385 Ga0495664_0015137 3300046477 Unclassified 4383
386 Ga0495594_0012313 3300046499 Unclassified 4456
387 Ga0495618_0040569 3300046514 Bacteria 2930
388 Ga0495628_0230936 3300046516 Bacteria 1387
389 Ga0495630_0100135 3300046517 Unclassified 2192
390 Ga0495666_0009103 3300046526 Bacteria 4967
391 Ga0495642_0090350 3300046528 Unclassified 1296
392 Ga0495665_0380529 3300046531 Bacteria 717
393 Ga0495640_0061061 3300046533 Unclassified 2562
394 Ga0495586_0008369 3300046535 Bacteria 5505
395 Ga0495586_0649475 3300046535 Bacteria 609
396 Ga0495621_0089908 3300046539 Bacteria 1156
397 Ga0495622_0084459 3300046557 Unclassified 1460
398 Ga0495656_0190090 3300046615 Bacteria 1014
399 Ga0495634_0004444 3300046642 Bacteria 11011
400 Ga0495647_0002129 3300046681 Bacteria 6188
401 Ga0495658_0026665 3300046683 Unclassified 3099
402 Ga0495669_0437514 3300046684 Bacteria 635
403 Ga0495613_0143914 3300046689 Bacteria 1702
404 Ga0495600_0197599 3300046809 Archaea 1292
405 Ga0495604_0307926 3300047317 Unclassified 1062
406 Ga0495636_0223819 3300047318 Unclassified 864
407 Ga0495674_1197222 3300047319 Unclassified 574
408 Ga0495676_0476802 3300047321 Bacteria 821
409 Ga0495680_0005832 3300047322 Bacteria 11525
410 Ga0495593_0669591 3300047673 Unclassified 521
411 Ga0501032_0478307 3300049569 Bacteria 797
412 Ga0501038_1022722 3300049574 Unclassified 606
413 Ga0501040_0410584 3300049576 Bacteria 973
414 Ga0501046_0546443 3300049580 Bacteria 826
415 Ga0501067_0627508 3300049583 Bacteria 603
416 Ga0501075_0047139 3300049591 Bacteria 3239
417 Ga0501075_0173168 3300049591 Unclassified 1647
418 Ga0501076_0120500 3300049592 Bacteria 2125
419 Ga0501076_0122081 3300049592 Unclassified 2110
420 Ga0501079_0049577 3300049741 Bacteria 3241
421 Ga0501079_0059728 3300049741 Bacteria 2941
422 Ga0501080_0156385 3300049742 Bacteria 2106
423 Ga0501080_0269888 3300049742 Bacteria 1549
424 Ga0501081_0023545 3300049743 Bacteria 4128
425 nmdc:mga05p37_154707_c1 3300050507 Unclassified 2803
426 nmdc:mga05p37_2074907_c1 3300050507 Unclassified 534
427 nmdc:mga05p37_2156022_c1 3300050507 Unclassified 520
428 nmdc:mga09592_739550_c1 3300050508 Bacteria 835
429 nmdc:mga09592_9157_c1 3300050508 Bacteria 8054
430 nmdc:mga0qj67_105270_c1 3300050509 Bacteria 2276
431 nmdc:mga0qj67_212395_c1 3300050509 Unclassified 1571
432 nmdc:mga06r32_1076262_c1 3300050510 Bacteria 754
433 nmdc:mga06r32_1206280_c1 3300050510 Bacteria 703
434 nmdc:mga06r32_1276265_c1 3300050510 Unclassified 679
435 nmdc:mga06r32_1981321_c1 3300050510 Bacteria 516
436 nmdc:mga06r32_315537_c1 3300050510 Unclassified 1549
437 nmdc:mga06r32_557093_c1 3300050510 Bacteria 1120
438 nmdc:mga0n895_1252350_c1 3300050512 Bacteria 714
439 nmdc:mga0n895_13365_c1 3300050512 Bacteria 7403
440 nmdc:mga0n895_162673_c1 3300050512 Bacteria 2264
441 nmdc:mga0n895_20531_c1 3300050512 Bacteria 6162
442 nmdc:mga0n895_208554_c1 3300050512 Unclassified 1985
443 nmdc:mga0n895_214677_c1 3300050512 Bacteria 1954
444 nmdc:mga0n895_234_c1 3300050512 Bacteria 35273
445 nmdc:mga0n895_247109_c1 3300050512 Bacteria 1811
446 nmdc:mga0n895_2850_c1 3300050512 Bacteria 13698
447 nmdc:mga0n895_82308_c1 3300050512 Bacteria 3209
448 nmdc:mga0rr50_14408_c1 3300050513 Bacteria 5185
449 nmdc:mga0rr50_147260_c1 3300050513 Bacteria 1900
450 nmdc:mga0rr50_149750_c1 3300050513 Bacteria 1884
451 nmdc:mga0rr50_365331_c1 3300050513 Unclassified 1215
452 nmdc:mga0rr50_489626_c1 3300050513 Bacteria 1045
453 nmdc:mga0rr50_906670_c1 3300050513 Unclassified 752
454 nmdc:mga0rr50_9195_c1 3300050513 Bacteria 6196
455 nmdc:mga08x19_10313_c1 3300050514 Bacteria 5187
456 nmdc:mga08x19_117850_c1 3300050514 Unclassified 1777
457 nmdc:mga08x19_125603_c1 3300050514 Bacteria 1723
458 nmdc:mga08x19_146761_c1 3300050514 Bacteria 1596
459 nmdc:mga08x19_155429_c1 3300050514 Bacteria 1551
460 nmdc:mga08x19_28156_c1 3300050514 Bacteria 3517
461 nmdc:mga08x19_30760_c1 3300050514 Unclassified 3374
462 nmdc:mga08x19_312916_c1 3300050514 Viruses 1092
463 nmdc:mga08x19_377879_c1 3300050514 Bacteria 992
464 nmdc:mga08x19_39929_c1 3300050514 Unclassified 2985
465 nmdc:mga08x19_42589_c1 3300050514 Bacteria 2895
466 nmdc:mga08x19_426617_c1 3300050514 Bacteria 932
467 nmdc:mga08x19_44254_c1 3300050514 Bacteria 2842
468 nmdc:mga08x19_4975_c1 3300050514 Bacteria 7857
469 nmdc:mga08x19_583570_c1 3300050514 Unclassified 792
470 nmdc:mga08x19_9643_c1 3300050514 Bacteria 5783
471 nmdc:mga0a205_225378_c1 3300050515 Bacteria 1759
472 nmdc:mga0a205_315681_c1 3300050515 Bacteria 1434
473 nmdc:mga0a205_32531_c1 3300050515 Bacteria 5000
474 nmdc:mga0a205_40626_c1 3300050515 Unclassified 4479
475 nmdc:mga0a205_49920_c1 3300050515 Bacteria 4039
476 nmdc:mga0a205_53260_c1 3300050515 Bacteria 3906
477 nmdc:mga0a205_59194_c1 3300050515 Unclassified 3701
478 nmdc:mga0a205_747_c1 3300050515 Bacteria 26213
479 nmdc:mga0a205_90758_c1 3300050515 Bacteria 2952
480 Ga0501084_0294744 3300054114 Bacteria 1370
481 Ga0501082_0173115 3300060353 Unclassified 1877
482 Ga0501082_0904926 3300060353 Bacteria 772
483 Ga0501082_1033254 3300060353 Unclassified 718
484 Ga0501082_1489032 3300060353 Bacteria 591
485 Ga0466962_0002326 3300061719 Bacteria 9006
486 Ga0466962_0004911 3300061719 Bacteria 6432
487 Ga0075428_100046418
488 Ga0065707_11165256
489 Ga0070680_100041313
490 Ga0070680_100041403
491 Ga0070680_100932519
492 Ga0070680_100942964
493 Ga0070691_10409626
494 Ga0070691_10946381
495 Ga0070687_100072621
496 Ga0070692_10019655
497 Ga0070703_10000312
498 Ga0070703_10003122
499 Ga0070703_10012399
500 Ga0070703_10167515
501 Ga0070709_10001591
502 Ga0070709_10036640
503 Ga0070714_100553980
504 Ga0070713_100018575
505 Ga0070713_100141184
506 Ga0070710_10432575
507 Ga0070701_10013238
508 Ga0070711_100000009
509 Ga0070705_100001768
510 Ga0070705_100005416
511 Ga0070705_100012180
512 Ga0070705_100020287
513 Ga0070705_100026374
514 Ga0070705_100039573
515 Ga0070705_100108612
516 Ga0070705_100897537
517 Ga0070694_100002184
518 Ga0070694_100006177
519 Ga0070694_100006607
520 Ga0070694_100009692
521 Ga0070694_100018767
522 Ga0070694_100028203
523 Ga0070694_100032710
524 Ga0070694_100110198
525 Ga0070694_100119351
526 Ga0070708_100032779
527 Ga0070708_100033969
528 Ga0070708_100041509
529 Ga0070708_100054288
530 Ga0070708_100070326
531 Ga0070708_100179294
532 Ga0070708_100251826
533 Ga0070708_100251830
534 Ga0070708_100372434
535 Ga0070708_100535296
536 Ga0070708_100882900
537 Ga0068867_100316599
538 Ga0068867_101836563
539 Ga0070706_100007410
540 Ga0070706_100021396
541 Ga0070706_100039989
542 Ga0070706_100080815
543 Ga0070706_100112958
544 Ga0070706_100233903
545 Ga0070706_100269799
546 Ga0070706_100280079
547 Ga0070706_100466124
548 Ga0070706_100885558
549 Ga0070706_102039793
550 Ga0070707_100015947
551 Ga0070707_100026813
552 Ga0070707_100033723
553 Ga0070707_100088721
554 Ga0070707_100110662
555 Ga0070707_100184489
556 Ga0070707_100227761
557 Ga0070707_100364239
558 Ga0070707_100549085
559 Ga0070707_100667046
560 Ga0070707_100941967
561 Ga0070707_100970059
562 Ga0070707_101331532
563 Ga0070698_100001472
564 Ga0070698_100053985
565 Ga0070698_100055410
566 Ga0070698_100090053
567 Ga0070698_100165305
568 Ga0070698_100823150
569 Ga0070698_101853109
570 Ga0070699_100000112
571 Ga0070699_100008266
572 Ga0070699_100023736
573 Ga0070699_100028702
574 Ga0070699_100040976
575 Ga0070699_100086775
576 Ga0070699_100105083
577 Ga0070699_100111368
578 Ga0070699_100209731
579 Ga0070699_100308640
580 Ga0070699_100329141
581 Ga0070699_100331991
582 Ga0070699_100407281
583 Ga0070699_101316885
584 Ga0070679_100501155
585 Ga0070697_100014519
586 Ga0070697_100031768
587 Ga0070697_100047304
588 Ga0070697_100056437
589 Ga0070697_100086070
590 Ga0070697_100086670
591 Ga0070697_100139820
592 Ga0070697_100147085
593 Ga0070697_100337718
594 Ga0070697_100442135
595 Ga0070697_100482004
596 Ga0070697_100603743
597 Ga0070697_101141297
598 Ga0070697_101504655
599 Ga0070697_101675302
600 Ga0070697_101897269
601 Ga0070686_100005480
602 Ga0070686_101936430
603 Ga0070695_100000660
604 Ga0070695_100003990
605 Ga0070695_100021966
606 Ga0070695_100059683
607 Ga0070695_100107948
608 Ga0070695_100114849
609 Ga0070695_100148145
610 Ga0070695_100223444
611 Ga0070695_100304698
612 Ga0070695_101724283
613 Ga0070696_100001231
614 Ga0070696_100005131
615 Ga0070696_100029946
616 Ga0070696_100056505
617 Ga0070696_100081969
618 Ga0070696_100261992
619 Ga0070696_100315553
620 Ga0070693_100352310
621 Ga0070704_100001840
622 Ga0070704_100001963
623 Ga0070704_100002710
624 Ga0070704_100015368
625 Ga0070704_100027153
626 Ga0070704_100034771
627 Ga0070704_100282121
628 Ga0070704_100379440
629 Ga0070704_100445024
630 Ga0068859_100207954
631 Ga0068861_100055270
632 Ga0068858_101519347
633 Ga0068860_101909711
634 Ga0068862_101333785
635 Ga0081455_10059097
636 Ga0081538_10081069
637 Ga0070716_100002438
638 Ga0070716_100080470
639 Ga0070716_100232550
640 Ga0075428_100001051
641 Ga0075428_101429992
642 Ga0075430_100024539
643 Ga0075430_100658192
644 Ga0075431_100010047
645 Ga0075431_100085016
646 Ga0075431_100334981
647 Ga0075431_100756848
648 Ga0075431_100942653
649 Ga0075431_102235383
650 Ga0075433_10018802
651 Ga0075433_10019386
652 Ga0075433_10049655
653 Ga0075433_10052377
654 Ga0075433_10121545
655 Ga0075433_10145022
656 Ga0075433_10222013
657 Ga0075433_10227895
658 Ga0075434_100002623
659 Ga0075434_100014034
660 Ga0075434_100015037
661 Ga0075434_100027691
662 Ga0075434_100031498
663 Ga0075434_100249453
664 Ga0075434_100268597
665 Ga0075434_100408084
666 Ga0075434_100734658
667 Ga0075429_100013191
668 Ga0075429_100495904
669 Ga0068865_100197027
670 Ga0075436_100015829
671 Ga0075436_100016770
672 Ga0075436_100017353
673 Ga0075436_100020022
674 Ga0075436_100021020
675 Ga0075436_100026317
676 Ga0075436_100053424
677 Ga0075436_100056023
678 Ga0075436_100064177
679 Ga0075436_100081674
680 Ga0075436_100087679
681 Ga0075436_100167545
682 Ga0075436_100366939
683 Ga0075436_100701388
684 Ga0097620_100207955
685 Ga0075435_100000439
686 Ga0075435_100019280
687 Ga0075435_100033835
688 Ga0075435_100133385
689 Ga0075435_100158702
690 Ga0075435_100194490
691 Ga0075435_100207002
692 Ga0075435_100267219
693 Ga0075435_100420715
694 Ga0075435_100511380
695 Ga0075435_100538480
696 Ga0075435_100605450
697 Ga0075435_100785698
698 Ga0099794_10000007
699 Ga0099794_10008182
700 Ga0099794_10315888
701 Ga0099794_10466045
702 Ga0099794_10474414
703 Ga0099795_10313360
704 Ga0099795_10556578
705 Ga0099795_10565891
706 Ga0105245_10336599
707 Ga0105245_10639447
708 Ga0114129_10034307
709 Ga0114129_10122924
710 Ga0114129_11444170
711 Ga0114129_12265878
712 Ga0114129_12285932
713 Ga0114129_12943657
714 Ga0114129_13137927
715 Ga0114129_13266691
716 Ga0105242_10606670
717 Ga0099796_10084300
718 Ga0099796_10251156
719 Ga0157378_10098928
720 Ga0163162_10001791
721 Ga0157380_10368848
722 Ga0213875_10029476
723 Ga0213875_10285679
724 Ga0207653_10000005
725 Ga0207653_10003039
726 Ga0207653_10004080
727 Ga0207653_10014693
728 Ga0207653_10014775
729 Ga0207653_10035230
730 Ga0207692_10606746
731 Ga0207692_11085421
732 Ga0207699_10015088
733 Ga0207684_10004665
734 Ga0207684_10032747
735 Ga0207684_10036915
736 Ga0207684_10072400
737 Ga0207684_10401849
738 Ga0207684_10638698
739 Ga0207684_10815539
740 Ga0207684_10837827
741 Ga0207684_11198482
742 Ga0207693_10515198
743 Ga0207663_10000013
744 Ga0207660_10027788
745 Ga0207660_10351059
746 Ga0207652_10978333
747 Ga0207646_10002324
748 Ga0207646_10002369
749 Ga0207646_10019111
750 Ga0207646_10027092
751 Ga0207646_10051503
752 Ga0207646_10062347
753 Ga0207646_10080170
754 Ga0207646_10146188
755 Ga0207646_10223912
756 Ga0207646_10488471
757 Ga0207646_10639659
758 Ga0207646_10662671
759 Ga0207646_11384325
760 Ga0207687_10346474
761 Ga0207700_10021096
762 Ga0207700_10135116
763 Ga0207664_10338558
764 Ga0207665_10001116
765 Ga0207665_10044618
766 Ga0207665_10973723
767 Ga0207689_10088646
768 Ga0207703_11155345
769 Ga0207708_10035087
770 Ga0207648_10102480
771 Ga0207675_100079843
772 Ga0209179_1146608
773 Ga0209588_1000301
774 Ga0209588_1000744
775 Ga0209588_1066229
776 Ga0209588_1258655
777 Ga0207428_11148167
778 Ga0268265_10596437
779 Ga0268264_10278519
780 Ga0268264_11844779
781 Ga0316182_1170625
782 Ga0265325_10145370
783 Ga0307408_100174615
784 Ga0307405_10164023
785 Ga0307413_10035564
786 Ga0307410_10175017
787 Ga0307410_10183181
788 Ga0307406_10498840
789 Ga0307407_10004285
790 Ga0307412_10420224
791 Ga0307409_100354558
792 Ga0307416_102517136
793 Ga0307414_10420432
794 Ga0307411_10131914
795 Ga0307415_100307789
796 Ga0373937_1556869
797 Ga0395905_1414562
798 Ga0436364_0023825
799 Ga0436364_0093676
800 Ga0436364_0100154
801 Ga0436364_0252816
802 Ga0436364_1511780
803 Ga0436365_0216814
804 Ga0436365_0492245
805 Ga0436365_0656722
806 Ga0436365_0907664
807 Ga0436365_1271877
808 Ga0436365_1299205
809 Ga0436363_1011037
810 Ga0436363_1600977
811 Ga0436362_0025062
812 Ga0436362_0225907
813 Ga0436362_0447126
814 Ga0436362_0733634
815 Ga0436362_0887819
816 Ga0439436_0032844
817 Ga0439461_0082962
818 Ga0439433_0053344
819 Ga0439449_0112296
820 Ga0439457_021347
821 Ga0439462_0010059
822 Ga0439462_0127653
823 Ga0450897_019743
824 Ga0450894_052637
825 Ga0450906_031488
826 Ga0439446_0003024
827 Ga0439446_0268018
828 Ga0439434_0164669
829 Ga0439444_0010265
830 Ga0451577_0856873
831 Ga0453683_0015251
832 Ga0453683_0175503
833 Ga0453683_0176814
834 Ga0453683_0193890
835 Ga0466966_0191965
836 Ga0466961_0014611
837 Ga0466963_0194884
838 Ga0466963_0200580
839 Ga0466964_0563593
840 Ga0466964_0663437
841 Ga0453684_1798611
842 Ga0466971_0009833
843 Ga0466971_0031052
844 Ga0466968_0038645
845 Ga0466970_0029208
846 Ga0466957_0007386
847 Ga0466957_0054706
848 Ga0466957_0312148
849 Ga0466959_0045138
850 Ga0466959_0055700
851 Ga0466959_0492565
852 Ga0451576_0002297
853 Ga0451576_0007922
854 Ga0451576_0059201
855 Ga0451576_0074507
856 Ga0451576_0074911
857 Ga0451576_0135827
858 Ga0451576_0261466
859 Ga0451576_0299892
860 Ga0451576_0383317
861 Ga0451576_1425020
862 Ga0466958_0061748
863 Ga0466958_0089877
864 Ga0466958_0161372
865 Ga0466958_0357403
866 Ga0466958_0540262
867 Ga0466967_1541487
868 Ga0495629_0575109
869 Ga0495582_0012937
870 Ga0495662_0069530
871 Ga0495664_0015137
872 Ga0495594_0012313
873 Ga0495618_0040569
874 Ga0495628_0230936
875 Ga0495630_0100135
876 Ga0495666_0009103
877 Ga0495642_0090350
878 Ga0495665_0380529
879 Ga0495640_0061061
880 Ga0495586_0008369
881 Ga0495586_0649475
882 Ga0495621_0089908
883 Ga0495622_0084459
884 Ga0495656_0190090
885 Ga0495634_0004444
886 Ga0495647_0002129
887 Ga0495658_0026665
888 Ga0495669_0437514
889 Ga0495613_0143914
890 Ga0495600_0197599
891 Ga0495604_0307926
892 Ga0495636_0223819
893 Ga0495674_1197222
894 Ga0495676_0476802
895 Ga0495680_0005832
896 Ga0495593_0669591
897 Ga0501032_0478307
898 Ga0501038_1022722
899 Ga0501040_0410584
900 Ga0501046_0546443
901 Ga0501067_0627508
902 Ga0501075_0047139
903 Ga0501075_0173168
904 Ga0501076_0120500
905 Ga0501076_0122081
906 Ga0501079_0049577
907 Ga0501079_0059728
908 Ga0501080_0156385
909 Ga0501080_0269888
910 Ga0501081_0023545
911 nmdc:mga05p37_154707_c1
912 nmdc:mga05p37_2074907_c1
913 nmdc:mga05p37_2156022_c1
914 nmdc:mga09592_739550_c1
915 nmdc:mga09592_9157_c1
916 nmdc:mga0qj67_105270_c1
917 nmdc:mga0qj67_212395_c1
918 nmdc:mga06r32_1076262_c1
919 nmdc:mga06r32_1206280_c1
920 nmdc:mga06r32_1276265_c1
921 nmdc:mga06r32_1981321_c1
922 nmdc:mga06r32_315537_c1
923 nmdc:mga06r32_557093_c1
924 nmdc:mga0n895_1252350_c1
925 nmdc:mga0n895_13365_c1
926 nmdc:mga0n895_162673_c1
927 nmdc:mga0n895_20531_c1
928 nmdc:mga0n895_208554_c1
929 nmdc:mga0n895_214677_c1
930 nmdc:mga0n895_234_c1
931 nmdc:mga0n895_247109_c1
932 nmdc:mga0n895_2850_c1
933 nmdc:mga0n895_82308_c1
934 nmdc:mga0rr50_14408_c1
935 nmdc:mga0rr50_147260_c1
936 nmdc:mga0rr50_149750_c1
937 nmdc:mga0rr50_365331_c1
938 nmdc:mga0rr50_489626_c1
939 nmdc:mga0rr50_906670_c1
940 nmdc:mga0rr50_9195_c1
941 nmdc:mga08x19_10313_c1
942 nmdc:mga08x19_117850_c1
943 nmdc:mga08x19_125603_c1
944 nmdc:mga08x19_146761_c1
945 nmdc:mga08x19_155429_c1
946 nmdc:mga08x19_28156_c1
947 nmdc:mga08x19_30760_c1
948 nmdc:mga08x19_312916_c1
949 nmdc:mga08x19_377879_c1
950 nmdc:mga08x19_39929_c1
951 nmdc:mga08x19_42589_c1
952 nmdc:mga08x19_426617_c1
953 nmdc:mga08x19_44254_c1
954 nmdc:mga08x19_4975_c1
955 nmdc:mga08x19_583570_c1
956 nmdc:mga08x19_9643_c1
957 nmdc:mga0a205_225378_c1
958 nmdc:mga0a205_315681_c1
959 nmdc:mga0a205_32531_c1
960 nmdc:mga0a205_40626_c1
961 nmdc:mga0a205_49920_c1
962 nmdc:mga0a205_53260_c1
963 nmdc:mga0a205_59194_c1
964 nmdc:mga0a205_747_c1
965 nmdc:mga0a205_90758_c1
966 Ga0501084_0294744
967 Ga0501082_0173115
968 Ga0501082_0904926
969 Ga0501082_1033254
970 Ga0501082_1489032
971 Ga0466962_0002326
972 Ga0466962_0004911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

15

88

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9555 5 98
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.9134 5 92
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.9113 5 99
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.9006 2 99
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8999 5 98
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9616 14 98 3.30.300.130
3lnoB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9287 5 98 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9198 14 98 3.30.300.130
3cq2B00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9096 5 99 3.30.300.130
1wcjA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9006 2 99 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A838P3X7-F1-model_v4 DUF59 domain-containing protein 0.9916 1 99
AF-A0A838QMK9-F1-model_v4 DUF59 domain-containing protein 0.9878 2 99
AF-A0A6N8SHI0-F1-model_v4 DUF59 domain-containing protein 0.9855 4 91
AF-A0A3L7XLC2-F1-model_v4 DUF59 domain-containing protein 0.984 2 98
AF-A0A3L7XJC0-F1-model_v4 DUF59 domain-containing protein 0.9823 2 98

Map