metagRoot

F453086

General Info

Members	Datasets	Scaffolds	Average Seq Length
485	281	475	464

Family's Representative Sequence

Representative Sequence	3300009094\|Ga0111539_10000213\|Ga0111539_1000021326
Length	522
Sequence	MTPPLVGRYCVVNPEQIVQPLLPGTHHPRRVMPGTGTSGRLRDVMTATLSALTAILSVNPVPWARAQMAFTLAFHIILVPLGVSWAFMTLIANYRGIRHNDRDALTLAQRWSKFMAVTFAVGAVTGTVLTFEFGLLWPRFMGRWGEAFGVPFGFEGVFFFTEGIFVAIYIFGWRRLKPWAHFWTGVPIVFAGIFGAISVVAANAWMNAPAGFELDSNGNVIKVDPVQVIFNDSMPWQAAHMLVAAYLVGGFLIASVYAVGMLRGRRDRYHYLGFLIPFTVAAVMTPIQLGIGDGLARWVYSNQSVKFAAIELVPTTSSDVPETLLGHLNEDGTVTGGLPIPGLASWLSDPSTGKATVVQGLDSVPPDQRPTIRQTNIVHLCWDIMVGLGTLLFLLAVWYALSWVFRRRMPQTKWFLRAAAVAGPAAVLTMEAGWVVTEVGRQPWIVYNLMKVEDAVTANTGVWITFFAVVILYAAVGTTLILVLRVMSRRFRRAGGFTDHDTPYGPSALTEKVSARSEEPVG

Samples

	Sample ID	Description	Type	Environment
1	2643221692	Nocardia sp. Root136	Isolate	Unclassified
2	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
3	2808606375	Streptomyces sp. SLBN-31	Isolate	Unclassified
4	2816332119	Kribbella amoyensis DSM 24683	Isolate	Rhizosphere
5	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
6	2884994152	Cellulomonas sp. H30R-01	Isolate	Rhizosphere
7	2889415604	Paludisphaera rhizosphaerae JC665	Isolate	Rhizosphere
8	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
9	2891554331	Microbispora sp. CL1-1	Isolate	Unclassified
10	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
11	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
12	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
13	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
14	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
15	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
16	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
17	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
18	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
19	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
20	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
21	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
22	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
25	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
33	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
34	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
35	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
36	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
37	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
40	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
41	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
42	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
43	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
44	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
45	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
46	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
47	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
48	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
49	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
50	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
51	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
52	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
53	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
54	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
55	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
56	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
57	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
58	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
59	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
61	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
63	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
64	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
65	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
66	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
67	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
68	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
69	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
70	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
71	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
72	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
73	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
74	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
75	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
76	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
77	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
78	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
79	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
80	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
109	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
113	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
114	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
115	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
116	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
117	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
118	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
119	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
120	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
121	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
122	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
123	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
124	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
125	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
126	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
127	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
128	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
129	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
130	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
131	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
132	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
133	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
134	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
135	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
136	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
137	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
138	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
139	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
140	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
141	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
142	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
143	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
144	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
145	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
146	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
147	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
148	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
149	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
150	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
151	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
152	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
153	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
154	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
155	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
156	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
157	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
158	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
159	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
160	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
161	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
162	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
163	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
164	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
165	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
166	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
167	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
168	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
169	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
170	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
171	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
172	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
173	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
174	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
175	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
176	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
177	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
178	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
179	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
180	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
181	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
182	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
183	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
184	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
185	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
186	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
187	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
188	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
189	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
190	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
191	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
192	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
193	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
194	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
195	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
196	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
197	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
198	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
199	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
200	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
201	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
202	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
203	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
204	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
205	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
206	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
207	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
208	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
209	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
210	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
211	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
212	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
213	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
214	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
215	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
216	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
217	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
218	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
219	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
220	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
221	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
222	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
223	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
224	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
225	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
226	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
227	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
228	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
229	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
230	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
231	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
232	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
233	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
234	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
250	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
252	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
253	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
254	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
257	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
262	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
263	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
264	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
265	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
266	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
267	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
268	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
269	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
270	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
271	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
272	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
273	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
274	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
275	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
276	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
277	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
278	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
279	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
280	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
281	8056667051	Streptomyces sichuanensis SCA3-4	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.94
Metatranscriptomes	0
Isolates	2.06

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.03
Nodule	0
Rhizoplane	14.85
Rhizosphere	80.21
Stem	0
Stem Tuber	0
Unclassified	3.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1001639	3300001977	Bacteria	3585
2	JGI24740J21852_10005705	3300001979	Bacteria	5236
3	JGI24737J22298_10001981	3300001990	Bacteria	7318
4	JGI24735J21928_10012399	3300002067	Bacteria	2693
5	JGI24744J21845_10004915	3300002077	Bacteria	2767
6	rootH2_10004183	3300003320	Bacteria	8428
7	rootH2_10016736	3300003320	Bacteria	18315
8	rootL2_10173994	3300003322	Bacteria	4219
9	rootH1_10014662	3300003323	Bacteria	1772
10	JGI25407J50210_10000970	3300003373	Bacteria	6195
11	Ga0070658_10008225	3300005327	Bacteria	8387
12	Ga0070658_10014884	3300005327	Bacteria	6231
13	Ga0070683_100133558	3300005329	Bacteria	2349
14	Ga0068869_100000269	3300005334	Bacteria	27219
15	Ga0068869_100109623	3300005334	Bacteria	2098
16	Ga0068869_100195884	3300005334	Bacteria	1591
17	Ga0070682_100123647	3300005337	Bacteria	1741
18	Ga0070660_100034836	3300005339	Bacteria	3807
19	Ga0070661_100002705	3300005344	Bacteria	12148
20	Ga0070692_10032033	3300005345	Bacteria	2640
21	Ga0070668_100013584	3300005347	Bacteria	6079
22	Ga0070668_100130957	3300005347	Bacteria	2013
23	Ga0070659_100019442	3300005366	Bacteria	5148
24	Ga0070667_100178274	3300005367	Bacteria	1878
25	Ga0070708_100023316	3300005445	Bacteria	5262
26	Ga0070663_100149282	3300005455	Bacteria	1791
27	Ga0068867_100000053	3300005459	Bacteria	69650
28	Ga0068867_100038551	3300005459	Bacteria	3479
29	Ga0070698_100135999	3300005471	Bacteria	2411
30	Ga0070684_100002915	3300005535	Bacteria	12715
31	Ga0070695_100003013	3300005545	Bacteria	9815
32	Ga0070665_100058079	3300005548	Bacteria	3879
33	Ga0068855_100008779	3300005563	Bacteria	12214
34	Ga0070664_100000455	3300005564	Bacteria	31016
35	Ga0068856_100062691	3300005614	Bacteria	3672
36	Ga0068852_100055256	3300005616	Bacteria	3426
37	Ga0068852_100213185	3300005616	Bacteria	1833
38	Ga0068864_100071211	3300005618	Bacteria	3027
39	Ga0068866_10029444	3300005718	Bacteria	2626
40	Ga0068861_100044756	3300005719	Bacteria	3330
41	Ga0068861_100085690	3300005719	Bacteria	2475
42	Ga0068861_100094419	3300005719	Bacteria	2367
43	Ga0068863_100004644	3300005841	Bacteria	13541
44	Ga0068862_100015452	3300005844	Bacteria	6341
45	Ga0081455_10000024	3300005937	Bacteria	157764
46	Ga0081455_10000145	3300005937	Bacteria	84152
47	Ga0081455_10005954	3300005937	Bacteria	13226
48	Ga0081455_10036223	3300005937	Bacteria	4398
49	Ga0081455_10038630	3300005937	Bacteria	4226
50	Ga0081455_10068652	3300005937	Bacteria	2949
51	Ga0081538_10000210	3300005981	Bacteria	65100
52	Ga0081538_10000629	3300005981	Bacteria	39074
53	Ga0081538_10001587	3300005981	Bacteria	23317
54	Ga0081538_10014837	3300005981	Bacteria	6073
55	Ga0081538_10066144	3300005981	Bacteria	2029
56	Ga0070717_10080911	3300006028	Bacteria	2726
57	Ga0075432_10002003	3300006058	Bacteria	6767
58	Ga0070715_10004784	3300006163	Bacteria	4479
59	Ga0097621_100141165	3300006237	Bacteria	2058
60	Ga0075428_100000457	3300006844	Bacteria	40962
61	Ga0075428_100011596	3300006844	Bacteria	9807
62	Ga0075428_100014413	3300006844	Bacteria	8784
63	Ga0075428_100071107	3300006844	Bacteria	3803
64	Ga0075428_100096698	3300006844	Bacteria	3219
65	Ga0075430_100017501	3300006846	Bacteria	6105
66	Ga0075430_100023301	3300006846	Bacteria	5268
67	Ga0075431_100001158	3300006847	Bacteria	23733
68	Ga0075431_100045327	3300006847	Bacteria	4533
69	Ga0075431_100048344	3300006847	Bacteria	4387
70	Ga0075431_100066705	3300006847	Bacteria	3716
71	Ga0075431_100127076	3300006847	Bacteria	2630
72	Ga0075433_10000953	3300006852	Bacteria	20426
73	Ga0075433_10001007	3300006852	Bacteria	20055
74	Ga0075434_100000025	3300006871	Bacteria	68254
75	Ga0075429_100001705	3300006880	Bacteria	18170
76	Ga0075429_100005693	3300006880	Bacteria	10748
77	Ga0075429_100109669	3300006880	Bacteria	2413
78	Ga0075429_100185519	3300006880	Bacteria	1823
79	Ga0068865_100018793	3300006881	Bacteria	4466
80	Ga0068865_100025693	3300006881	Bacteria	3877
81	Ga0075436_100010123	3300006914	Bacteria	6456
82	Ga0111539_10000213	3300009094	Bacteria	69372
83	Ga0111539_10025314	3300009094	Bacteria	7274
84	Ga0105245_10004727	3300009098	Bacteria	12028
85	Ga0105245_10039583	3300009098	Bacteria	4196
86	Ga0105245_10103866	3300009098	Bacteria	2634
87	Ga0105245_10137720	3300009098	Bacteria	2296
88	Ga0114129_10000014	3300009147	Bacteria	130267
89	Ga0114129_10050957	3300009147	Bacteria	5813
90	Ga0114129_10085544	3300009147	Bacteria	4375
91	Ga0105243_10000191	3300009148	Bacteria	71467
92	Ga0105243_10001738	3300009148	Bacteria	18749
93	Ga0105243_10036404	3300009148	Bacteria	3820
94	Ga0105243_10099588	3300009148	Bacteria	2409
95	Ga0105241_10055677	3300009174	Bacteria	3030
96	Ga0105242_10029507	3300009176	Bacteria	4376
97	Ga0105248_10130122	3300009177	Bacteria	2839
98	Ga0105248_10131258	3300009177	Bacteria	2826
99	Ga0105238_10105452	3300009551	Bacteria	2800
100	Ga0105249_10008644	3300009553	Bacteria	8873
101	Ga0105249_10168261	3300009553	Bacteria	2124
102	Ga0105239_10020585	3300010375	Bacteria	7278
103	Ga0105239_10093273	3300010375	Bacteria	3324
104	Ga0105246_10001142	3300011119	Bacteria	15397
105	Ga0105246_10049680	3300011119	Bacteria	2873
106	Ga0157371_10048159	3300013102	Bacteria	3030
107	Ga0157370_10000643	3300013104	Bacteria	43469
108	Ga0157369_10136738	3300013105	Bacteria	2594
109	Ga0163162_10003816	3300013306	Bacteria	14450
110	Ga0163162_10065150	3300013306	Bacteria	3690
111	Ga0163162_10223634	3300013306	Bacteria	2012
112	Ga0163162_10338809	3300013306	Bacteria	1636
113	Ga0157372_10006104	3300013307	Bacteria	12802
114	Ga0157372_10067812	3300013307	Bacteria	4010
115	Ga0157372_10141851	3300013307	Bacteria	2769
116	Ga0157372_10159760	3300013307	Bacteria	2604
117	Ga0157372_10251181	3300013307	Bacteria	2053
118	Ga0157372_10279741	3300013307	Bacteria	1940
119	Ga0157375_10021413	3300013308	Bacteria	5927
120	Ga0157375_10132783	3300013308	Bacteria	2610
121	Ga0182008_10061267	3300014497	Bacteria	1855
122	Ga0157379_10085639	3300014968	Bacteria	2825
123	Ga0163161_10006706	3300017792	Bacteria	7966
124	Ga0163161_10085807	3300017792	Bacteria	2323
125	Ga0213876_10043874	3300021384	Bacteria	2363
126	Ga0207642_10023740	3300025899	Bacteria	2455
127	Ga0207642_10043710	3300025899	Bacteria	1978
128	Ga0207688_10011097	3300025901	Bacteria	4902
129	Ga0207688_10021034	3300025901	Bacteria	3563
130	Ga0207688_10036458	3300025901	Bacteria	2725
131	Ga0207685_10007907	3300025905	Bacteria	2996
132	Ga0207705_10038824	3300025909	Bacteria	3411
133	Ga0207705_10089007	3300025909	Bacteria	2259
134	Ga0207693_10000637	3300025915	Bacteria	31341
135	Ga0207662_10100103	3300025918	Bacteria	1795
136	Ga0207649_10033613	3300025920	Bacteria	3066
137	Ga0207652_10026845	3300025921	Bacteria	4798
138	Ga0207687_10018456	3300025927	Bacteria	4605
139	Ga0207687_10084701	3300025927	Bacteria	2298
140	Ga0207690_10114639	3300025932	Bacteria	1947
141	Ga0207690_10174399	3300025932	Bacteria	1613
142	Ga0207706_10007828	3300025933	Bacteria	9862
143	Ga0207706_10015117	3300025933	Bacteria	6985
144	Ga0207706_10062409	3300025933	Bacteria	3281
145	Ga0207686_10074024	3300025934	Bacteria	2199
146	Ga0207709_10000261	3300025935	Bacteria	62864
147	Ga0207709_10016395	3300025935	Bacteria	4118
148	Ga0207709_10108198	3300025935	Bacteria	1853
149	Ga0207669_10030120	3300025937	Bacteria	3012
150	Ga0207704_10002541	3300025938	Bacteria	8225
151	Ga0207704_10011986	3300025938	Bacteria	4288
152	Ga0207691_10028938	3300025940	Bacteria	5185
153	Ga0207689_10002242	3300025942	Bacteria	18109
154	Ga0207689_10204584	3300025942	Bacteria	1630
155	Ga0207661_10056873	3300025944	Bacteria	3142
156	Ga0207679_10001313	3300025945	Bacteria	15707
157	Ga0207712_10014927	3300025961	Bacteria	5002
158	Ga0207712_10054479	3300025961	Bacteria	2810
159	Ga0207668_10027150	3300025972	Bacteria	3727
160	Ga0207668_10058082	3300025972	Bacteria	2702
161	Ga0207658_10108683	3300025986	Bacteria	2188
162	Ga0207708_10007836	3300026075	Bacteria	7912
163	Ga0207708_10037167	3300026075	Bacteria	3709
164	Ga0207641_10006906	3300026088	Bacteria	9497
165	Ga0207641_10180252	3300026088	Bacteria	1934
166	Ga0207648_10000154	3300026089	Bacteria	69657
167	Ga0207648_10010820	3300026089	Bacteria	8622
168	Ga0207648_10127036	3300026089	Bacteria	2243
169	Ga0207674_10026773	3300026116	Bacteria	6117
170	Ga0207675_100019409	3300026118	Bacteria	6342
171	Ga0207675_100031640	3300026118	Bacteria	4929
172	Ga0207683_10042864	3300026121	Bacteria	3952
173	Ga0207428_10000342	3300027907	Bacteria	60624
174	Ga0207428_10007163	3300027907	Bacteria	10202
175	Ga0207428_10136620	3300027907	Bacteria	1874
176	Ga0268266_10047124	3300028379	Bacteria	3691
177	Ga0268265_10003917	3300028380	Bacteria	10489
178	Ga0268265_10182384	3300028380	Bacteria	1805
179	Ga0268264_10109506	3300028381	Bacteria	2417
180	Ga0268264_10240335	3300028381	Bacteria	1677
181	Ga0265319_1000413	3300028563	Bacteria	30854
182	Ga0265320_10006203	3300031240	Bacteria	7561
183	Ga0265327_10004893	3300031251	Bacteria	11572
184	Ga0307408_100006032	3300031548	Bacteria	8063
185	Ga0307508_10000513	3300031616	Bacteria	46447
186	Ga0265314_10003059	3300031711	Bacteria	16484
187	Ga0307405_10030431	3300031731	Bacteria	3166
188	Ga0307405_10075175	3300031731	Bacteria	2187
189	Ga0307413_10011464	3300031824	Bacteria	4361
190	Ga0307413_10018026	3300031824	Bacteria	3693
191	Ga0307410_10000329	3300031852	Bacteria	18526
192	Ga0307410_10084565	3300031852	Bacteria	2237
193	Ga0307410_10084585	3300031852	Bacteria	2237
194	Ga0307406_10000056	3300031901	Bacteria	61808
195	Ga0307406_10005319	3300031901	Bacteria	7042
196	Ga0307407_10001356	3300031903	Bacteria	8806
197	Ga0307407_10005309	3300031903	Bacteria	5576
198	Ga0307407_10075883	3300031903	Bacteria	2017
199	Ga0307412_10000070	3300031911	Bacteria	107229
200	Ga0307412_10112640	3300031911	Bacteria	1945
201	Ga0307409_100000010	3300031995	Bacteria	66258
202	Ga0307409_100005756	3300031995	Bacteria	7186
203	Ga0307409_100024325	3300031995	Bacteria	4222
204	Ga0307409_100025306	3300031995	Bacteria	4159
205	Ga0307409_100172010	3300031995	Bacteria	1907
206	Ga0307416_100000063	3300032002	Bacteria	97632
207	Ga0307416_100022568	3300032002	Bacteria	4545
208	Ga0307416_100032200	3300032002	Bacteria	3958
209	Ga0307416_100088294	3300032002	Bacteria	2650
210	Ga0307416_100110114	3300032002	Bacteria	2424
211	Ga0307414_10037591	3300032004	Bacteria	3243
212	Ga0307411_10059781	3300032005	Bacteria	2528
213	Ga0307411_10242525	3300032005	Bacteria	1412
214	Ga0307415_100001924	3300032126	Bacteria	10215
215	Ga0307415_100015000	3300032126	Bacteria	4574
216	Ga0307415_100015949	3300032126	Bacteria	4462
217	Ga0373926_0000016	3300035083	Bacteria	26994
218	Ga0373944_0000285	3300035089	Bacteria	11225
219	Ga0373923_0008144	3300035111	Bacteria	3722
220	Ga0373945_0000031	3300035116	Bacteria	28586
221	Ga0373946_0000151	3300035171	Bacteria	21089
222	Ga0373931_0063564	3300035691	Bacteria	1995
223	Ga0373927_0000809	3300035695	Bacteria	23930
224	Ga0373947_0000293	3300035725	Bacteria	28170
225	Ga0373937_0012366	3300036401	Bacteria	7506
226	Ga0373925_0000908	3300037068	Bacteria	27018
227	Ga0395898_0086356	3300037466	Bacteria	3024
228	Ga0395901_0017767	3300038443	Bacteria	7261
229	Ga0436365_0510118	3300039437	Bacteria	6513
230	Ga0436361_0531458	3300039447	Bacteria	2872
231	Ga0439443_000585	3300042003	Bacteria	3388
232	Ga0439448_0019334	3300042005	Bacteria	2096
233	Ga0439463_000832	3300042016	Bacteria	8477
234	Ga0439463_004584	3300042016	Bacteria	3460
235	Ga0439463_016306	3300042016	Bacteria	1837
236	Ga0450890_000066	3300042127	Bacteria	19203
237	Ga0450892_000277	3300042130	Bacteria	6110
238	Ga0450902_003481	3300042137	Bacteria	2299
239	Ga0439444_0001192	3300042437	Bacteria	3284
240	Ga0439464_0005695	3300042439	Bacteria	3229
241	Ga0439464_0005936	3300042439	Bacteria	3174
242	Ga0439460_0005295	3300042461	Bacteria	3162
243	Ga0450916_000809	3300042530	Bacteria	2931
244	Ga0450893_0000101	3300042532	Bacteria	9739
245	Ga0450893_0002032	3300042532	Bacteria	3151
246	Ga0439440_0007446	3300042993	Bacteria	2224
247	Ga0466969_0023838	3300044656	Bacteria	3150
248	Ga0466972_0011217	3300044658	Bacteria	4498
249	Ga0466972_0022258	3300044658	Bacteria	3157
250	Ga0453683_0000287	3300044673	Bacteria	65266
251	Ga0453683_0000863	3300044673	Bacteria	29270
252	Ga0466965_0008626	3300044683	Bacteria	4716
253	Ga0466966_0003338	3300044684	Bacteria	10579
254	Ga0466961_0001106	3300044693	Bacteria	16587
255	Ga0466961_0054889	3300044693	Bacteria	2541
256	Ga0466963_0000020	3300044694	Bacteria	55146
257	Ga0466964_0000948	3300044706	Bacteria	9597
258	Ga0453684_0077868	3300044712	Bacteria	4152
259	Ga0466971_0019585	3300044719	Bacteria	3006
260	Ga0466970_0001682	3300044765	Bacteria	10626
261	Ga0466970_0002589	3300044765	Bacteria	8716
262	Ga0466957_0049671	3300044842	Bacteria	2551
263	Ga0466960_0005019	3300044901	Bacteria	5221
264	Ga0466959_0000749	3300045049	Bacteria	19023
265	Ga0451576_0039596	3300045051	Bacteria	4989
266	Ga0466958_0003964	3300045836	Bacteria	7757
267	Ga0466967_0000228	3300045976	Bacteria	24249
268	Ga0466967_0036925	3300045976	Bacteria	4176
269	Ga0466967_0062023	3300045976	Bacteria	3318
270	Ga0495603_0028317	3300046455	Bacteria	3379
271	Ga0495629_0000404	3300046459	Bacteria	36222
272	Ga0495641_0000671	3300046461	Bacteria	28836
273	Ga0495651_0012986	3300046462	Bacteria	6435
274	Ga0495653_0016420	3300046463	Bacteria	6030
275	Ga0495580_0027052	3300046472	Bacteria	4177
276	Ga0495582_0003109	3300046473	Bacteria	9305
277	Ga0495639_0000832	3300046475	Bacteria	14057
278	Ga0495639_0046575	3300046475	Bacteria	1963
279	Ga0495662_0000338	3300046476	Bacteria	20496
280	Ga0495594_0035828	3300046499	Bacteria	2704
281	Ga0495608_0027430	3300046511	Bacteria	3874
282	Ga0495630_0011611	3300046517	Bacteria	6381
283	Ga0495630_0076254	3300046517	Bacteria	2526
284	Ga0495666_0000094	3300046526	Bacteria	36379
285	Ga0495665_0000109	3300046531	Bacteria	38894
286	Ga0495640_0000565	3300046533	Bacteria	27203
287	Ga0495586_0005149	3300046535	Bacteria	6998
288	Ga0495621_0039059	3300046539	Bacteria	1659
289	Ga0495597_0055953	3300046542	Bacteria	1729
290	Ga0495667_0000792	3300046559	Bacteria	20332
291	Ga0495656_0033172	3300046615	Bacteria	2106
292	Ga0495634_0000485	3300046642	Bacteria	39124
293	Ga0495634_0015378	3300046642	Bacteria	5501
294	Ga0495635_0005600	3300046663	Bacteria	8752
295	Ga0495588_0000522	3300046674	Bacteria	18568
296	Ga0495657_0010672	3300046675	Bacteria	6906
297	Ga0495623_0004551	3300046679	Bacteria	9108
298	Ga0495647_0000057	3300046681	Bacteria	28116
299	Ga0495658_0000643	3300046683	Bacteria	18898
300	Ga0495613_0000245	3300046689	Bacteria	51376
301	Ga0495624_0000268	3300046690	Bacteria	41265
302	Ga0495581_0000288	3300047315	Bacteria	24478
303	Ga0495604_0058763	3300047317	Bacteria	2952
304	Ga0495674_0001387	3300047319	Bacteria	23659
305	Ga0495674_0087286	3300047319	Bacteria	2670
306	Ga0495676_0113674	3300047321	Bacteria	1982
307	Ga0495680_0000581	3300047322	Bacteria	41016
308	Ga0495680_0001915	3300047322	Bacteria	21849
309	Ga0495675_0027105	3300047444	Bacteria	3651
310	Ga0495684_0146964	3300047471	Bacteria	1765
311	Ga0495593_0000186	3300047673	Bacteria	32409
312	Ga0495602_0116893	3300048088	Bacteria	2154
313	Ga0495614_0000202	3300048089	Bacteria	22963
314	Ga0496100_0003530	3300048903	Bacteria	8165
315	Ga0496100_0061936	3300048903	Bacteria	2467
316	Ga0496100_0066706	3300048903	Bacteria	2388
317	Ga0496100_0141335	3300048903	Bacteria	1707
318	Ga0496101_0050408	3300048904	Bacteria	2996
319	Ga0496101_0113810	3300048904	Bacteria	2039
320	Ga0496102_0000232	3300048905	Bacteria	73055
321	Ga0496102_0028697	3300048905	Bacteria	4972
322	Ga0496102_0034396	3300048905	Bacteria	4557
323	Ga0496102_0045820	3300048905	Bacteria	3970
324	Ga0496102_0099907	3300048905	Bacteria	2694
325	Ga0496103_0000149	3300048906	Bacteria	72642
326	Ga0496103_0029514	3300048906	Bacteria	3333
327	Ga0496103_0098401	3300048906	Bacteria	1850
328	Ga0496104_0001715	3300048907	Bacteria	18910
329	Ga0496104_0046904	3300048907	Bacteria	4071
330	Ga0496104_0183531	3300048907	Bacteria	2002
331	Ga0496105_0001812	3300048908	Bacteria	15289
332	Ga0496105_0172844	3300048908	Bacteria	1771
333	Ga0496106_0003874	3300048909	Bacteria	11158
334	Ga0496106_0057032	3300048909	Bacteria	2953
335	Ga0496107_0012107	3300048910	Bacteria	6016
336	Ga0496107_0032955	3300048910	Bacteria	3705
337	Ga0496107_0042552	3300048910	Bacteria	3262
338	Ga0496107_0056308	3300048910	Bacteria	2841
339	Ga0496107_0155331	3300048910	Bacteria	1694
340	Ga0496108_0016285	3300048911	Bacteria	6063
341	Ga0496108_0024951	3300048911	Bacteria	4925
342	Ga0496108_0040121	3300048911	Bacteria	3902
343	Ga0496108_0043102	3300048911	Bacteria	3769
344	Ga0496108_0058931	3300048911	Bacteria	3229
345	Ga0496109_0011216	3300048912	Bacteria	7692
346	Ga0496109_0016378	3300048912	Bacteria	6480
347	Ga0496109_0021380	3300048912	Bacteria	5721
348	Ga0496109_0029955	3300048912	Bacteria	4877
349	Ga0496109_0034011	3300048912	Bacteria	4587
350	Ga0496109_0061073	3300048912	Bacteria	3445
351	Ga0496109_0071042	3300048912	Bacteria	3195
352	Ga0496109_0106730	3300048912	Bacteria	2601
353	Ga0496109_0109313	3300048912	Bacteria	2570
354	Ga0496109_0161257	3300048912	Bacteria	2101
355	Ga0496109_0180514	3300048912	Bacteria	1982
356	Ga0496110_0000210	3300048913	Bacteria	37459
357	Ga0496110_0003962	3300048913	Bacteria	11393
358	Ga0496110_0009810	3300048913	Bacteria	7756
359	Ga0496110_0011435	3300048913	Bacteria	7264
360	Ga0496110_0012454	3300048913	Bacteria	6994
361	Ga0496110_0077693	3300048913	Bacteria	2954
362	Ga0496110_0097346	3300048913	Bacteria	2636
363	Ga0496111_0005538	3300048914	Bacteria	8111
364	Ga0496111_0011854	3300048914	Bacteria	5887
365	Ga0496111_0048078	3300048914	Bacteria	3073
366	Ga0496111_0063198	3300048914	Bacteria	2685
367	Ga0496112_0000976	3300048915	Bacteria	20850
368	Ga0496112_0001608	3300048915	Bacteria	17465
369	Ga0496112_0007099	3300048915	Bacteria	9903
370	Ga0496112_0173420	3300048915	Bacteria	2122
371	Ga0496112_0182429	3300048915	Bacteria	2063
372	Ga0496112_0356713	3300048915	Bacteria	1404
373	Ga0496113_0046432	3300048916	Bacteria	3224
374	Ga0496113_0101996	3300048916	Bacteria	2225
375	Ga0496113_0245741	3300048916	Bacteria	1428
376	Ga0496114_0001373	3300048917	Bacteria	18423
377	Ga0496114_0002152	3300048917	Bacteria	14991
378	Ga0496114_0015716	3300048917	Bacteria	6090
379	Ga0496114_0024425	3300048917	Bacteria	4934
380	Ga0496114_0059881	3300048917	Bacteria	3181
381	Ga0496114_0209393	3300048917	Bacteria	1710
382	Ga0496114_0218672	3300048917	Bacteria	1672
383	Ga0496114_0236495	3300048917	Bacteria	1605
384	Ga0496115_0001855	3300048918	Bacteria	15120
385	Ga0496115_0146906	3300048918	Bacteria	1946
386	Ga0496116_0000350	3300048919	Bacteria	72652
387	Ga0496117_0000262	3300048920	Bacteria	99623
388	Ga0496118_0000217	3300048921	Bacteria	100056
389	Ga0496120_0090768	3300048923	Bacteria	1632
390	Ga0496124_0000005	3300048927	Bacteria	922323
391	Ga0496125_0030618	3300048928	Bacteria	4810
392	Ga0496126_0000177	3300048929	Bacteria	145158
393	Ga0496126_0015210	3300048929	Bacteria	7748
394	Ga0501031_0065497	3300049568	Bacteria	2367
395	Ga0501032_0052182	3300049569	Bacteria	2756
396	Ga0501033_0040961	3300049570	Bacteria	3457
397	Ga0501034_0000572	3300049571	Bacteria	58406
398	Ga0501034_0012491	3300049571	Bacteria	8771
399	Ga0501037_0138505	3300049573	Bacteria	1742
400	Ga0501038_0014266	3300049574	Bacteria	7240
401	Ga0501038_0014772	3300049574	Bacteria	7114
402	Ga0501038_0070504	3300049574	Bacteria	2967
403	Ga0501039_0005498	3300049575	Bacteria	9585
404	Ga0501039_0102576	3300049575	Bacteria	2233
405	Ga0501041_0003711	3300049577	Bacteria	8779
406	Ga0501042_0000405	3300049578	Bacteria	21851
407	Ga0501042_0076200	3300049578	Bacteria	2401
408	Ga0501043_0052254	3300049579	Bacteria	3210
409	Ga0501043_0081964	3300049579	Bacteria	2535
410	Ga0501046_0001807	3300049580	Bacteria	20375
411	Ga0501048_0001929	3300049582	Bacteria	15762
412	Ga0501067_0004177	3300049583	Bacteria	7972
413	Ga0501067_0006232	3300049583	Bacteria	6614
414	Ga0501068_0083700	3300049584	Bacteria	1961
415	Ga0501069_0013660	3300049585	Bacteria	4333
416	Ga0501070_0072450	3300049586	Bacteria	2852
417	Ga0501071_0025910	3300049587	Bacteria	4112
418	Ga0501071_0041334	3300049587	Bacteria	3302
419	Ga0501072_0024194	3300049588	Bacteria	4723
420	Ga0501072_0087355	3300049588	Bacteria	2474
421	Ga0501074_0128204	3300049590	Bacteria	1816
422	Ga0501075_0006315	3300049591	Bacteria	8143
423	Ga0501076_0000697	3300049592	Bacteria	21627
424	Ga0501076_0254906	3300049592	Bacteria	1436
425	Ga0501077_0004323	3300049593	Bacteria	8605
426	Ga0501077_0069793	3300049593	Bacteria	2227
427	Ga0501243_004576	3300049675	Bacteria	2077
428	Ga0501081_0005026	3300049743	Bacteria	8509
429	Ga0501081_0070429	3300049743	Bacteria	2437
430	Ga0501083_0055751	3300049744	Bacteria	2649
431	Ga0501035_0000883	3300049822	Bacteria	31844
432	Ga0501044_0140221	3300049823	Bacteria	2406
433	Ga0501044_0197707	3300049823	Bacteria	1970
434	Ga0501045_0005844	3300049824	Bacteria	8520
435	Ga0501045_0042202	3300049824	Bacteria	3321
436	nmdc:mga00v17_55980_c1	3300050491	Bacteria	2410
437	nmdc:mga00v17_69506_c1	3300050491	Bacteria	2179
438	nmdc:mga0yw44_90685_c1	3300050492	Bacteria	1931
439	nmdc:mga05p37_1314_c1	3300050507	Bacteria	28924
440	nmdc:mga05p37_16628_c1	3300050507	Bacteria	8862
441	nmdc:mga05p37_26548_c1	3300050507	Bacteria	7043
442	nmdc:mga05p37_70876_c1	3300050507	Bacteria	4287
443	nmdc:mga05p37_83924_c1	3300050507	Bacteria	3925
444	nmdc:mga09592_1240_c1	3300050508	Bacteria	20452
445	nmdc:mga09592_142743_c1	3300050508	Bacteria	2064
446	nmdc:mga09592_197626_c1	3300050508	Bacteria	1741
447	nmdc:mga09592_34276_c1	3300050508	Bacteria	4244
448	nmdc:mga0qj67_143162_c1	3300050509	Bacteria	1938
449	nmdc:mga0qj67_15450_c1	3300050509	Bacteria	5781
450	nmdc:mga0qj67_25184_c1	3300050509	Bacteria	4595
451	nmdc:mga06r32_164770_c1	3300050510	Bacteria	2199
452	nmdc:mga06r32_17608_c1	3300050510	Bacteria	6526
453	nmdc:mga06r32_188335_c1	3300050510	Bacteria	2051
454	nmdc:mga06r32_386_c1	3300050510	Bacteria	37085
455	nmdc:mga06r32_86316_c1	3300050510	Bacteria	3061
456	nmdc:mga08y16_16647_c1	3300050511	Bacteria	7732
457	nmdc:mga08y16_331_c1	3300050511	Bacteria	42832
458	nmdc:mga08y16_59777_c1	3300050511	Bacteria	3981
459	nmdc:mga0n895_143668_c1	3300050512	Bacteria	2415
460	nmdc:mga0n895_2364_c1	3300050512	Bacteria	14708
461	nmdc:mga0rr50_44604_c1	3300050513	Bacteria	3253
462	nmdc:mga08x19_6250_c1	3300050514	Bacteria	7051
463	nmdc:mga0a205_1111_c1	3300050515	Bacteria	22273
464	nmdc:mga0a205_71_c1	3300050515	Bacteria	55470
465	Ga0495595_0002069	3300053084	Bacteria	7802
466	Ga0495619_0000389	3300053085	Bacteria	29922
467	Ga0495619_0029489	3300053085	Bacteria	3545
468	Ga0500644_0007365	3300053088	Bacteria	2863
469	Ga0500555_008456	3300053103	Bacteria	2935
470	Ga0501084_0003605	3300054114	Bacteria	12570
471	Ga0501082_0013085	3300060353	Bacteria	7133
472	Ga0501082_0193076	3300060353	Bacteria	1771
473	Ga0466962_0000556	3300061719	Bacteria	16371
474	Ga0530510_0016176	3300061734	Bacteria	5275
475	Ga0530510_0183312	3300061734	Bacteria	1553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049823	Ga0501044_0140221	Ga0501044_0140221_1160_2395	374
2	3300013306	Ga0163162_10338809	Ga0163162_103388091	378
3	3300048915	Ga0496112_0356713	Ga0496112_0356713_115_1392	381
4	3300005545	Ga0070695_100003013	Ga0070695_1000030134	382
5	3300048905	Ga0496102_0045820	Ga0496102_0045820_75_1490	382
6	3300048909	Ga0496106_0057032	Ga0496106_0057032_664_2079	382
7	3300006847	Ga0075431_100066705	Ga0075431_1000667053	384
8	3300003373	JGI25407J50210_10000970	JGI25407J50210_100009707	388
9	3300005981	Ga0081538_10000210	Ga0081538_1000021060	388
10	3300026121	Ga0207683_10042864	Ga0207683_100428642	390
11	3300009176	Ga0105242_10029507	Ga0105242_100295075	392
12	3300013105	Ga0157369_10136738	Ga0157369_101367382	396
13	3300005347	Ga0070668_100013584	Ga0070668_1000135842	399
14	3300005844	Ga0068862_100015452	Ga0068862_1000154524	399
15	3300009553	Ga0105249_10008644	Ga0105249_100086445	399
16	3300025961	Ga0207712_10014927	Ga0207712_100149272	399
17	3300025972	Ga0207668_10027150	Ga0207668_100271503	399
18	3300028380	Ga0268265_10003917	Ga0268265_100039175	399
19	3300028381	Ga0268264_10240335	Ga0268264_102403351	399
20	3300021384	Ga0213876_10043874	Ga0213876_100438742	400
21	3300025961	Ga0207712_10054479	Ga0207712_100544791	400
22	3300039437	Ga0436365_0510118	Ga0436365_0510118_479_1840	400
23	3300039447	Ga0436361_0531458	Ga0436361_0531458_140_1450	400
24	3300048907	Ga0496104_0183531	Ga0496104_0183531_12_1292	400
25	3300048908	Ga0496105_0172844	Ga0496105_0172844_388_1746	400
26	3300048913	Ga0496110_0097346	Ga0496110_0097346_1319_2623	400
27	3300049587	Ga0501071_0025910	Ga0501071_0025910_2575_3936	400
28	3300050508	nmdc:mga09592_142743_c1	nmdc:mga09592_142743_c1_441_1742	400
29	3300060353	Ga0501082_0193076	Ga0501082_0193076_339_1700	400
30	3300005471	Ga0070698_100135999	Ga0070698_1001359992	401
31	3300048912	Ga0496109_0029955	Ga0496109_0029955_231_1625	401
32	3300048913	Ga0496110_0000210	Ga0496110_0000210_14_1249	401
33	3300048914	Ga0496111_0005538	Ga0496111_0005538_4186_5580	401
34	3300048916	Ga0496113_0046432	Ga0496113_0046432_86_1480	401
35	3300049592	Ga0501076_0254906	Ga0501076_0254906_105_1421	405
36	3300005981	Ga0081538_10014837	Ga0081538_100148373	408
37	3300013307	Ga0157372_10159760	Ga0157372_101597602	408
38	3300048913	Ga0496110_0011435	Ga0496110_0011435_216_1640	408
39	3300050510	nmdc:mga06r32_17608_c1	nmdc:mga06r32_17608_c1_1357_2796	409
40	3300046455	Ga0495603_0028317	Ga0495603_0028317_86_1510	410
41	3300048914	Ga0496111_0063198	Ga0496111_0063198_356_1780	410
42	3300048917	Ga0496114_0015716	Ga0496114_0015716_3909_5333	410
43	3300050491	nmdc:mga00v17_55980_c1	nmdc:mga00v17_55980_c1_184_1593	411
44	3300050492	nmdc:mga0yw44_90685_c1	nmdc:mga0yw44_90685_c1_356_1765	411
45	3300005459	Ga0068867_100038551	Ga0068867_1000385513	412
46	3300049574	Ga0501038_0014266	Ga0501038_0014266_1141_2565	412
47	3300005327	Ga0070658_10008225	Ga0070658_100082255	413
48	3300025909	Ga0207705_10038824	Ga0207705_100388242	413
49	3300044673	Ga0453683_0000863	Ga0453683_0000863_23999_25330	413
50	3300049590	Ga0501074_0128204	Ga0501074_0128204_299_1618	414
51	3300006880	Ga0075429_100109669	Ga0075429_1001096692	415
52	3300026075	Ga0207708_10007836	Ga0207708_100078368	415
53	3300044658	Ga0466972_0022258	Ga0466972_0022258_1690_3117	415
54	3300048914	Ga0496111_0048078	Ga0496111_0048078_447_1778	415
55	3300006844	Ga0075428_100071107	Ga0075428_1000711075	416
56	3300044656	Ga0466969_0023838	Ga0466969_0023838_340_1746	416
57	3300044658	Ga0466972_0011217	Ga0466972_0011217_767_2173	416
58	3300044683	Ga0466965_0008626	Ga0466965_0008626_1866_3272	416
59	3300044684	Ga0466966_0003338	Ga0466966_0003338_8875_10281	416
60	3300044693	Ga0466961_0001106	Ga0466961_0001106_299_1705	416
61	3300044694	Ga0466963_0000020	Ga0466963_0000020_24678_26084	416
62	3300044706	Ga0466964_0000948	Ga0466964_0000948_2262_3668	416
63	3300044719	Ga0466971_0019585	Ga0466971_0019585_171_1577	416
64	3300044765	Ga0466970_0001682	Ga0466970_0001682_2348_3754	416
65	3300045049	Ga0466959_0000749	Ga0466959_0000749_16194_17600	416
66	3300045836	Ga0466958_0003964	Ga0466958_0003964_171_1577	416
67	3300045976	Ga0466967_0000228	Ga0466967_0000228_1557_2963	416
68	3300061719	Ga0466962_0000556	Ga0466962_0000556_2479_3885	416
69	3300005563	Ga0068855_100008779	Ga0068855_1000087799	418
70	3300005937	Ga0081455_10000024	Ga0081455_1000002470	418
71	3300025940	Ga0207691_10028938	Ga0207691_100289384	418
72	3300005614	Ga0068856_100062691	Ga0068856_1000626912	419
73	3300009174	Ga0105241_10055677	Ga0105241_100556772	419
74	3300031616	Ga0307508_10000513	Ga0307508_1000051324	419
75	3300031903	Ga0307407_10005309	Ga0307407_100053092	419
76	3300032002	Ga0307416_100032200	Ga0307416_1000322001	419
77	3300032005	Ga0307411_10242525	Ga0307411_102425251	419
78	3300061734	Ga0530510_0183312	Ga0530510_0183312_158_1519	419
79	3300002077	JGI24744J21845_10004915	JGI24744J21845_100049152	420
80	3300005937	Ga0081455_10005954	Ga0081455_100059543	420
81	3300009098	Ga0105245_10004727	Ga0105245_100047272	420
82	3300009098	Ga0105245_10039583	Ga0105245_100395832	420
83	3300009551	Ga0105238_10105452	Ga0105238_101054521	420
84	3300013306	Ga0163162_10223634	Ga0163162_102236342	420
85	3300013307	Ga0157372_10279741	Ga0157372_102797412	420
86	3300031251	Ga0265327_10004893	Ga0265327_1000489313	420
87	3300036401	Ga0373937_0012366	Ga0373937_0012366_463_1836	420
88	3300037466	Ga0395898_0086356	Ga0395898_0086356_1573_2937	420
89	3300042016	Ga0439463_000832	Ga0439463_000832_525_1892	420
90	3300042437	Ga0439444_0001192	Ga0439444_0001192_1253_2620	420
91	3300042439	Ga0439464_0005936	Ga0439464_0005936_1767_3134	420
92	3300042993	Ga0439440_0007446	Ga0439440_0007446_189_1556	420
93	3300044693	Ga0466961_0054889	Ga0466961_0054889_1136_2497	420
94	3300046462	Ga0495651_0012986	Ga0495651_0012986_1613_2986	420
95	3300046463	Ga0495653_0016420	Ga0495653_0016420_3254_4627	420
96	3300046511	Ga0495608_0027430	Ga0495608_0027430_550_1923	420
97	3300046559	Ga0495667_0000792	Ga0495667_0000792_16767_18140	420
98	3300046615	Ga0495656_0033172	Ga0495656_0033172_551_1915	420
99	3300046675	Ga0495657_0010672	Ga0495657_0010672_3556_4929	420
100	3300046679	Ga0495623_0004551	Ga0495623_0004551_2437_3810	420
101	3300047317	Ga0495604_0058763	Ga0495604_0058763_466_1839	420
102	3300047322	Ga0495680_0001915	Ga0495680_0001915_19979_21352	420
103	3300047444	Ga0495675_0027105	Ga0495675_0027105_1065_2438	420
104	3300048088	Ga0495602_0116893	Ga0495602_0116893_404_1777	420
105	3300048904	Ga0496101_0113810	Ga0496101_0113810_62_1426	420
106	3300048912	Ga0496109_0016378	Ga0496109_0016378_2973_4340	420
107	3300048916	Ga0496113_0101996	Ga0496113_0101996_841_2208	420
108	3300048916	Ga0496113_0245741	Ga0496113_0245741_49_1389	420
109	3300049573	Ga0501037_0138505	Ga0501037_0138505_319_1686	420
110	3300049578	Ga0501042_0076200	Ga0501042_0076200_363_1730	420
111	3300049587	Ga0501071_0041334	Ga0501071_0041334_17_1384	420
112	3300049588	Ga0501072_0087355	Ga0501072_0087355_203_1570	420
113	3300049824	Ga0501045_0042202	Ga0501045_0042202_1205_2572	420
114	3300053084	Ga0495595_0002069	Ga0495595_0002069_5105_6478	420
115	3300053085	Ga0495619_0029489	Ga0495619_0029489_1483_2856	420
116	3300061734	Ga0530510_0016176	Ga0530510_0016176_454_1821	420
117	3300031903	Ga0307407_10075883	Ga0307407_100758832	421
118	3300049568	Ga0501031_0065497	Ga0501031_0065497_617_2044	421
119	3300049570	Ga0501033_0040961	Ga0501033_0040961_1802_3229	421
120	3300049574	Ga0501038_0070504	Ga0501038_0070504_1391_2818	421
121	3300049579	Ga0501043_0052254	Ga0501043_0052254_617_2044	421
122	3300049586	Ga0501070_0072450	Ga0501070_0072450_539_1966	421
123	3300003323	rootH1_10014662	rootH1_100146621	422
124	3300005334	Ga0068869_100000269	Ga0068869_10000026918	422
125	3300005347	Ga0070668_100130957	Ga0070668_1001309571	422
126	3300005616	Ga0068852_100055256	Ga0068852_1000552563	422
127	3300005719	Ga0068861_100085690	Ga0068861_1000856902	422
128	3300006237	Ga0097621_100141165	Ga0097621_1001411652	422
129	3300006881	Ga0068865_100025693	Ga0068865_1000256932	422
130	3300009098	Ga0105245_10137720	Ga0105245_101377202	422
131	3300010375	Ga0105239_10093273	Ga0105239_100932732	422
132	3300013102	Ga0157371_10048159	Ga0157371_100481591	422
133	3300013306	Ga0163162_10065150	Ga0163162_100651503	422
134	3300025899	Ga0207642_10043710	Ga0207642_100437101	422
135	3300025901	Ga0207688_10021034	Ga0207688_100210342	422
136	3300025933	Ga0207706_10062409	Ga0207706_100624091	422
137	3300025938	Ga0207704_10002541	Ga0207704_100025413	422
138	3300025942	Ga0207689_10002242	Ga0207689_1000224211	422
139	3300025972	Ga0207668_10058082	Ga0207668_100580821	422
140	3300028380	Ga0268265_10182384	Ga0268265_101823842	422
141	3300049822	Ga0501035_0000883	Ga0501035_0000883_11694_12992	422
142	3300046475	Ga0495639_0046575	Ga0495639_0046575_155_1573	423
143	3300013104	Ga0157370_10000643	Ga0157370_1000064310	424
144	iso_pu_bacteria	2808606375	2808914888	424
145	3300048929	Ga0496126_0015210	Ga0496126_0015210_1710_3020	425
146	iso_pu_bacteria	2891395885	2891397389	425
147	iso_pu_bacteria	2891554331	2891561250	425
148	iso_pu_bacteria	8056667051	8056668032	425
149	3300048905	Ga0496102_0099907	Ga0496102_0099907_16_1455	426
150	3300048906	Ga0496103_0098401	Ga0496103_0098401_273_1712	426
151	3300048917	Ga0496114_0024425	Ga0496114_0024425_1738_3177	426
152	3300048927	Ga0496124_0000005	Ga0496124_0000005_46457_47767	426
153	iso_pu_bacteria	2889415604	2889418137	426
154	3300044673	Ga0453683_0000287	Ga0453683_0000287_27724_29049	427
155	3300048911	Ga0496108_0024951	Ga0496108_0024951_2960_4339	427
156	3300048912	Ga0496109_0161257	Ga0496109_0161257_189_1568	427
157	3300005445	Ga0070708_100023316	Ga0070708_1000233163	429
158	3300005937	Ga0081455_10068652	Ga0081455_100686522	429
159	3300006844	Ga0075428_100011596	Ga0075428_1000115962	429
160	3300006847	Ga0075431_100048344	Ga0075431_1000483442	429
161	3300009147	Ga0114129_10050957	Ga0114129_100509576	429
162	3300009148	Ga0105243_10001738	Ga0105243_100017383	429
163	3300045051	Ga0451576_0039596	Ga0451576_0039596_2153_3466	429
164	3300046539	Ga0495621_0039059	Ga0495621_0039059_215_1645	429
165	3300048910	Ga0496107_0056308	Ga0496107_0056308_59_1480	429
166	3300048911	Ga0496108_0040121	Ga0496108_0040121_403_1809	429
167	3300048912	Ga0496109_0011216	Ga0496109_0011216_138_1550	429
168	3300048912	Ga0496109_0109313	Ga0496109_0109313_103_1518	429
169	3300049571	Ga0501034_0012491	Ga0501034_0012491_2104_3546	429
170	3300050509	nmdc:mga0qj67_143162_c1	nmdc:mga0qj67_143162_c1_297_1700	429
171	3300050510	nmdc:mga06r32_188335_c1	nmdc:mga06r32_188335_c1_457_1860	429
172	3300001979	JGI24740J21852_10005705	JGI24740J21852_100057052	430
173	3300001990	JGI24737J22298_10001981	JGI24737J22298_100019812	430
174	3300002067	JGI24735J21928_10012399	JGI24735J21928_100123992	430
175	3300005327	Ga0070658_10014884	Ga0070658_100148843	430
176	3300005329	Ga0070683_100133558	Ga0070683_1001335582	430
177	3300005334	Ga0068869_100109623	Ga0068869_1001096232	430
178	3300005337	Ga0070682_100123647	Ga0070682_1001236471	430
179	3300005339	Ga0070660_100034836	Ga0070660_1000348363	430
180	3300005345	Ga0070692_10032033	Ga0070692_100320331	430
181	3300005366	Ga0070659_100019442	Ga0070659_1000194423	430
182	3300005367	Ga0070667_100178274	Ga0070667_1001782742	430
183	3300005455	Ga0070663_100149282	Ga0070663_1001492822	430
184	3300005535	Ga0070684_100002915	Ga0070684_1000029155	430
185	3300005548	Ga0070665_100058079	Ga0070665_1000580792	430
186	3300005616	Ga0068852_100213185	Ga0068852_1002131852	430
187	3300005618	Ga0068864_100071211	Ga0068864_1000712112	430
188	3300005718	Ga0068866_10029444	Ga0068866_100294442	430
189	3300005719	Ga0068861_100044756	Ga0068861_1000447562	430
190	3300005719	Ga0068861_100094419	Ga0068861_1000944192	430
191	3300005841	Ga0068863_100004644	Ga0068863_1000046449	430
192	3300005937	Ga0081455_10000145	Ga0081455_1000014519	430
193	3300005937	Ga0081455_10036223	Ga0081455_100362231	430
194	3300005937	Ga0081455_10038630	Ga0081455_100386305	430
195	3300005981	Ga0081538_10000629	Ga0081538_1000062930	430
196	3300005981	Ga0081538_10001587	Ga0081538_1000158711	430
197	3300005981	Ga0081538_10066144	Ga0081538_100661442	430
198	3300006028	Ga0070717_10080911	Ga0070717_100809111	430
199	3300006058	Ga0075432_10002003	Ga0075432_100020032	430
200	3300006163	Ga0070715_10004784	Ga0070715_100047844	430
201	3300006844	Ga0075428_100000457	Ga0075428_1000004573	430
202	3300006844	Ga0075428_100014413	Ga0075428_1000144135	430
203	3300006844	Ga0075428_100096698	Ga0075428_1000966981	430
204	3300006846	Ga0075430_100017501	Ga0075430_1000175013	430
205	3300006846	Ga0075430_100023301	Ga0075430_1000233013	430
206	3300006847	Ga0075431_100001158	Ga0075431_1000011589	430
207	3300006847	Ga0075431_100045327	Ga0075431_1000453274	430
208	3300006847	Ga0075431_100127076	Ga0075431_1001270762	430
209	3300006852	Ga0075433_10000953	Ga0075433_100009537	430
210	3300006852	Ga0075433_10001007	Ga0075433_100010072	430
211	3300006871	Ga0075434_100000025	Ga0075434_10000002547	430
212	3300006880	Ga0075429_100001705	Ga0075429_1000017056	430
213	3300006880	Ga0075429_100005693	Ga0075429_1000056932	430
214	3300006880	Ga0075429_100185519	Ga0075429_1001855191	430
215	3300006881	Ga0068865_100018793	Ga0068865_1000187932	430
216	3300006914	Ga0075436_100010123	Ga0075436_1000101235	430
217	3300009094	Ga0111539_10000213	Ga0111539_1000021326	430
218	3300009094	Ga0111539_10025314	Ga0111539_100253142	430
219	3300009147	Ga0114129_10000014	Ga0114129_1000001468	430
220	3300009147	Ga0114129_10085544	Ga0114129_100855442	430
221	3300009148	Ga0105243_10036404	Ga0105243_100364042	430
222	3300009148	Ga0105243_10099588	Ga0105243_100995882	430
223	3300009177	Ga0105248_10130122	Ga0105248_101301222	430
224	3300009177	Ga0105248_10131258	Ga0105248_101312582	430
225	3300009553	Ga0105249_10168261	Ga0105249_101682612	430
226	3300010375	Ga0105239_10020585	Ga0105239_100205855	430
227	3300011119	Ga0105246_10001142	Ga0105246_100011422	430
228	3300011119	Ga0105246_10049680	Ga0105246_100496802	430
229	3300013306	Ga0163162_10003816	Ga0163162_1000381611	430
230	3300013307	Ga0157372_10006104	Ga0157372_100061042	430
231	3300013307	Ga0157372_10067812	Ga0157372_100678123	430
232	3300013307	Ga0157372_10141851	Ga0157372_101418511	430
233	3300013307	Ga0157372_10251181	Ga0157372_102511812	430
234	3300013308	Ga0157375_10021413	Ga0157375_100214134	430
235	3300013308	Ga0157375_10132783	Ga0157375_101327832	430
236	3300014497	Ga0182008_10061267	Ga0182008_100612672	430
237	3300014968	Ga0157379_10085639	Ga0157379_100856392	430
238	3300017792	Ga0163161_10006706	Ga0163161_100067066	430
239	3300017792	Ga0163161_10085807	Ga0163161_100858072	430
240	3300025899	Ga0207642_10023740	Ga0207642_100237402	430
241	3300025901	Ga0207688_10011097	Ga0207688_100110971	430
242	3300025901	Ga0207688_10036458	Ga0207688_100364581	430
243	3300025905	Ga0207685_10007907	Ga0207685_100079072	430
244	3300025909	Ga0207705_10089007	Ga0207705_100890072	430
245	3300025915	Ga0207693_10000637	Ga0207693_100006374	430
246	3300025918	Ga0207662_10100103	Ga0207662_101001031	430
247	3300025921	Ga0207652_10026845	Ga0207652_100268452	430
248	3300025927	Ga0207687_10018456	Ga0207687_100184563	430
249	3300025932	Ga0207690_10114639	Ga0207690_101146392	430
250	3300025932	Ga0207690_10174399	Ga0207690_101743991	430
251	3300025933	Ga0207706_10007828	Ga0207706_100078283	430
252	3300025933	Ga0207706_10015117	Ga0207706_100151175	430
253	3300025934	Ga0207686_10074024	Ga0207686_100740242	430
254	3300025935	Ga0207709_10016395	Ga0207709_100163954	430
255	3300025935	Ga0207709_10108198	Ga0207709_101081982	430
256	3300025937	Ga0207669_10030120	Ga0207669_100301203	430
257	3300025938	Ga0207704_10011986	Ga0207704_100119863	430
258	3300025944	Ga0207661_10056873	Ga0207661_100568731	430
259	3300025986	Ga0207658_10108683	Ga0207658_101086832	430
260	3300026075	Ga0207708_10037167	Ga0207708_100371673	430
261	3300026088	Ga0207641_10006906	Ga0207641_100069062	430
262	3300026088	Ga0207641_10180252	Ga0207641_101802522	430
263	3300026089	Ga0207648_10010820	Ga0207648_100108206	430
264	3300026089	Ga0207648_10127036	Ga0207648_101270362	430
265	3300026116	Ga0207674_10026773	Ga0207674_100267732	430
266	3300026118	Ga0207675_100019409	Ga0207675_1000194095	430
267	3300026118	Ga0207675_100031640	Ga0207675_1000316405	430
268	3300027907	Ga0207428_10000342	Ga0207428_1000034215	430
269	3300027907	Ga0207428_10007163	Ga0207428_100071633	430
270	3300027907	Ga0207428_10136620	Ga0207428_101366201	430
271	3300028379	Ga0268266_10047124	Ga0268266_100471242	430
272	3300028381	Ga0268264_10109506	Ga0268264_101095062	430
273	3300031548	Ga0307408_100006032	Ga0307408_1000060322	430
274	3300031731	Ga0307405_10030431	Ga0307405_100304313	430
275	3300031731	Ga0307405_10075175	Ga0307405_100751752	430
276	3300031824	Ga0307413_10011464	Ga0307413_100114642	430
277	3300031824	Ga0307413_10018026	Ga0307413_100180263	430
278	3300031852	Ga0307410_10000329	Ga0307410_1000032914	430
279	3300031852	Ga0307410_10084565	Ga0307410_100845651	430
280	3300031852	Ga0307410_10084585	Ga0307410_100845852	430
281	3300031901	Ga0307406_10000056	Ga0307406_1000005653	430
282	3300031901	Ga0307406_10005319	Ga0307406_100053193	430
283	3300031903	Ga0307407_10001356	Ga0307407_100013567	430
284	3300031911	Ga0307412_10112640	Ga0307412_101126402	430
285	3300031995	Ga0307409_100000010	Ga0307409_10000001048	430
286	3300031995	Ga0307409_100005756	Ga0307409_1000057566	430
287	3300031995	Ga0307409_100024325	Ga0307409_1000243253	430
288	3300031995	Ga0307409_100025306	Ga0307409_1000253062	430
289	3300031995	Ga0307409_100172010	Ga0307409_1001720102	430
290	3300032002	Ga0307416_100000063	Ga0307416_10000006389	430
291	3300032002	Ga0307416_100022568	Ga0307416_1000225684	430
292	3300032002	Ga0307416_100088294	Ga0307416_1000882942	430
293	3300032002	Ga0307416_100110114	Ga0307416_1001101142	430
294	3300032004	Ga0307414_10037591	Ga0307414_100375912	430
295	3300032005	Ga0307411_10059781	Ga0307411_100597812	430
296	3300032126	Ga0307415_100001924	Ga0307415_1000019244	430
297	3300032126	Ga0307415_100015000	Ga0307415_1000150005	430
298	3300032126	Ga0307415_100015949	Ga0307415_1000159494	430
299	3300035083	Ga0373926_0000016	Ga0373926_0000016_1689_3107	430
300	3300035089	Ga0373944_0000285	Ga0373944_0000285_4539_5957	430
301	3300035111	Ga0373923_0008144	Ga0373923_0008144_2233_3651	430
302	3300035116	Ga0373945_0000031	Ga0373945_0000031_4052_5470	430
303	3300035171	Ga0373946_0000151	Ga0373946_0000151_4592_6010	430
304	3300035691	Ga0373931_0063564	Ga0373931_0063564_440_1885	430
305	3300035695	Ga0373927_0000809	Ga0373927_0000809_17942_19360	430
306	3300035725	Ga0373947_0000293	Ga0373947_0000293_7554_8972	430
307	3300037068	Ga0373925_0000908	Ga0373925_0000908_3113_4531	430
308	3300038443	Ga0395901_0017767	Ga0395901_0017767_5666_7099	430
309	3300042003	Ga0439443_000585	Ga0439443_000585_1616_3067	430
310	3300042005	Ga0439448_0019334	Ga0439448_0019334_508_1959	430
311	3300042016	Ga0439463_004584	Ga0439463_004584_365_1819	430
312	3300042016	Ga0439463_016306	Ga0439463_016306_93_1520	430
313	3300042137	Ga0450902_003481	Ga0450902_003481_492_1946	430
314	3300042439	Ga0439464_0005695	Ga0439464_0005695_1292_2746	430
315	3300042461	Ga0439460_0005295	Ga0439460_0005295_445_1899	430
316	3300042530	Ga0450916_000809	Ga0450916_000809_170_1624	430
317	3300044765	Ga0466970_0002589	Ga0466970_0002589_2756_4186	430
318	3300044842	Ga0466957_0049671	Ga0466957_0049671_781_2211	430
319	3300044901	Ga0466960_0005019	Ga0466960_0005019_1161_2591	430
320	3300045976	Ga0466967_0036925	Ga0466967_0036925_2363_3793	430
321	3300045976	Ga0466967_0062023	Ga0466967_0062023_1643_3079	430
322	3300046459	Ga0495629_0000404	Ga0495629_0000404_22731_24149	430
323	3300046461	Ga0495641_0000671	Ga0495641_0000671_13366_14784	430
324	3300046472	Ga0495580_0027052	Ga0495580_0027052_1026_2444	430
325	3300046473	Ga0495582_0003109	Ga0495582_0003109_332_1750	430
326	3300046475	Ga0495639_0000832	Ga0495639_0000832_5206_6624	430
327	3300046476	Ga0495662_0000338	Ga0495662_0000338_13150_14568	430
328	3300046499	Ga0495594_0035828	Ga0495594_0035828_356_1774	430
329	3300046517	Ga0495630_0011611	Ga0495630_0011611_4552_5970	430
330	3300046517	Ga0495630_0076254	Ga0495630_0076254_1028_2437	430
331	3300046526	Ga0495666_0000094	Ga0495666_0000094_2184_3602	430
332	3300046531	Ga0495665_0000109	Ga0495665_0000109_22172_23590	430
333	3300046533	Ga0495640_0000565	Ga0495640_0000565_3615_5033	430
334	3300046535	Ga0495586_0005149	Ga0495586_0005149_1831_3249	430
335	3300046542	Ga0495597_0055953	Ga0495597_0055953_162_1607	430
336	3300046642	Ga0495634_0000485	Ga0495634_0000485_33238_34656	430
337	3300046642	Ga0495634_0015378	Ga0495634_0015378_2480_3889	430
338	3300046663	Ga0495635_0005600	Ga0495635_0005600_5353_6771	430
339	3300046674	Ga0495588_0000522	Ga0495588_0000522_15113_16531	430
340	3300046681	Ga0495647_0000057	Ga0495647_0000057_6685_8103	430
341	3300046683	Ga0495658_0000643	Ga0495658_0000643_11316_12734	430
342	3300046689	Ga0495613_0000245	Ga0495613_0000245_20948_22366	430
343	3300046690	Ga0495624_0000268	Ga0495624_0000268_20754_22172	430
344	3300047315	Ga0495581_0000288	Ga0495581_0000288_3047_4465	430
345	3300047319	Ga0495674_0001387	Ga0495674_0001387_2373_3791	430
346	3300047319	Ga0495674_0087286	Ga0495674_0087286_1022_2440	430
347	3300047321	Ga0495676_0113674	Ga0495676_0113674_388_1890	430
348	3300047322	Ga0495680_0000581	Ga0495680_0000581_27504_28922	430
349	3300047471	Ga0495684_0146964	Ga0495684_0146964_143_1567	430
350	3300047673	Ga0495593_0000186	Ga0495593_0000186_22445_23863	430
351	3300048089	Ga0495614_0000202	Ga0495614_0000202_16562_17980	430
352	3300048903	Ga0496100_0003530	Ga0496100_0003530_1353_2804	430
353	3300048903	Ga0496100_0066706	Ga0496100_0066706_736_2175	430
354	3300048903	Ga0496100_0141335	Ga0496100_0141335_75_1487	430
355	3300048904	Ga0496101_0050408	Ga0496101_0050408_1294_2712	430
356	3300048905	Ga0496102_0000232	Ga0496102_0000232_47174_48589	430
357	3300048905	Ga0496102_0028697	Ga0496102_0028697_491_1903	430
358	3300048905	Ga0496102_0034396	Ga0496102_0034396_1305_2744	430
359	3300048906	Ga0496103_0000149	Ga0496103_0000149_46788_48203	430
360	3300048906	Ga0496103_0029514	Ga0496103_0029514_548_1957	430
361	3300048907	Ga0496104_0001715	Ga0496104_0001715_10300_11739	430
362	3300048907	Ga0496104_0046904	Ga0496104_0046904_1791_3206	430
363	3300048908	Ga0496105_0001812	Ga0496105_0001812_4903_6342	430
364	3300048909	Ga0496106_0003874	Ga0496106_0003874_165_1613	430
365	3300048910	Ga0496107_0012107	Ga0496107_0012107_816_2225	430
366	3300048910	Ga0496107_0032955	Ga0496107_0032955_1197_2645	430
367	3300048910	Ga0496107_0042552	Ga0496107_0042552_67_1485	430
368	3300048910	Ga0496107_0155331	Ga0496107_0155331_112_1524	430
369	3300048911	Ga0496108_0016285	Ga0496108_0016285_620_2032	430
370	3300048911	Ga0496108_0043102	Ga0496108_0043102_139_1584	430
371	3300048911	Ga0496108_0058931	Ga0496108_0058931_1201_2616	430
372	3300048912	Ga0496109_0021380	Ga0496109_0021380_374_1810	430
373	3300048912	Ga0496109_0034011	Ga0496109_0034011_736_2145	430
374	3300048912	Ga0496109_0061073	Ga0496109_0061073_1555_2961	430
375	3300048912	Ga0496109_0071042	Ga0496109_0071042_778_2190	430
376	3300048912	Ga0496109_0106730	Ga0496109_0106730_759_2198	430
377	3300048912	Ga0496109_0180514	Ga0496109_0180514_245_1660	430
378	3300048913	Ga0496110_0003962	Ga0496110_0003962_9462_10880	430
379	3300048913	Ga0496110_0009810	Ga0496110_0009810_5980_7389	430
380	3300048913	Ga0496110_0012454	Ga0496110_0012454_4008_5414	430
381	3300048913	Ga0496110_0077693	Ga0496110_0077693_559_1974	430
382	3300048914	Ga0496111_0011854	Ga0496111_0011854_1350_2762	430
383	3300048915	Ga0496112_0000976	Ga0496112_0000976_18184_19632	430
384	3300048915	Ga0496112_0001608	Ga0496112_0001608_13424_14965	430
385	3300048915	Ga0496112_0007099	Ga0496112_0007099_2541_3992	430
386	3300048915	Ga0496112_0173420	Ga0496112_0173420_536_2002	430
387	3300048915	Ga0496112_0182429	Ga0496112_0182429_320_1792	430
388	3300048917	Ga0496114_0001373	Ga0496114_0001373_11058_12494	430
389	3300048917	Ga0496114_0002152	Ga0496114_0002152_1430_2869	430
390	3300048917	Ga0496114_0059881	Ga0496114_0059881_1567_3006	430
391	3300048917	Ga0496114_0209393	Ga0496114_0209393_109_1581	430
392	3300048917	Ga0496114_0218672	Ga0496114_0218672_224_1627	430
393	3300048917	Ga0496114_0236495	Ga0496114_0236495_17_1435	430
394	3300048918	Ga0496115_0001855	Ga0496115_0001855_5824_7263	430
395	3300048918	Ga0496115_0146906	Ga0496115_0146906_211_1647	430
396	3300048919	Ga0496116_0000350	Ga0496116_0000350_46792_48207	430
397	3300048920	Ga0496117_0000262	Ga0496117_0000262_46802_48217	430
398	3300048921	Ga0496118_0000217	Ga0496118_0000217_47174_48589	430
399	3300048923	Ga0496120_0090768	Ga0496120_0090768_122_1537	430
400	3300048928	Ga0496125_0030618	Ga0496125_0030618_1632_3047	430
401	3300048929	Ga0496126_0000177	Ga0496126_0000177_96968_98383	430
402	3300049574	Ga0501038_0014772	Ga0501038_0014772_2806_4242	430
403	3300049575	Ga0501039_0005498	Ga0501039_0005498_2778_4214	430
404	3300049577	Ga0501041_0003711	Ga0501041_0003711_6705_8141	430
405	3300049578	Ga0501042_0000405	Ga0501042_0000405_6607_8043	430
406	3300049579	Ga0501043_0081964	Ga0501043_0081964_455_1891	430
407	3300049580	Ga0501046_0001807	Ga0501046_0001807_6570_8006	430
408	3300049582	Ga0501048_0001929	Ga0501048_0001929_13679_15115	430
409	3300049583	Ga0501067_0004177	Ga0501067_0004177_3579_5012	430
410	3300049583	Ga0501067_0006232	Ga0501067_0006232_2420_3868	430
411	3300049584	Ga0501068_0083700	Ga0501068_0083700_495_1928	430
412	3300049585	Ga0501069_0013660	Ga0501069_0013660_1588_3021	430
413	3300049588	Ga0501072_0024194	Ga0501072_0024194_2223_3659	430
414	3300049591	Ga0501075_0006315	Ga0501075_0006315_6598_8034	430
415	3300049592	Ga0501076_0000697	Ga0501076_0000697_6595_8031	430
416	3300049593	Ga0501077_0004323	Ga0501077_0004323_2378_3814	430
417	3300049593	Ga0501077_0069793	Ga0501077_0069793_508_1953	430
418	3300049743	Ga0501081_0005026	Ga0501081_0005026_6607_8043	430
419	3300049743	Ga0501081_0070429	Ga0501081_0070429_246_1667	430
420	3300049744	Ga0501083_0055751	Ga0501083_0055751_908_2344	430
421	3300049823	Ga0501044_0197707	Ga0501044_0197707_246_1682	430
422	3300049824	Ga0501045_0005844	Ga0501045_0005844_6579_8015	430
423	3300050491	nmdc:mga00v17_69506_c1	nmdc:mga00v17_69506_c1_619_2085	430
424	3300050507	nmdc:mga05p37_1314_c1	nmdc:mga05p37_1314_c1_8158_9597	430
425	3300050507	nmdc:mga05p37_16628_c1	nmdc:mga05p37_16628_c1_1068_2477	430
426	3300050507	nmdc:mga05p37_26548_c1	nmdc:mga05p37_26548_c1_1141_2541	430
427	3300050507	nmdc:mga05p37_70876_c1	nmdc:mga05p37_70876_c1_692_2098	430
428	3300050507	nmdc:mga05p37_83924_c1	nmdc:mga05p37_83924_c1_1042_2442	430
429	3300050508	nmdc:mga09592_1240_c1	nmdc:mga09592_1240_c1_11442_12851	430
430	3300050508	nmdc:mga09592_197626_c1	nmdc:mga09592_197626_c1_272_1705	430
431	3300050508	nmdc:mga09592_34276_c1	nmdc:mga09592_34276_c1_645_2084	430
432	3300050509	nmdc:mga0qj67_15450_c1	nmdc:mga0qj67_15450_c1_2532_3932	430
433	3300050509	nmdc:mga0qj67_25184_c1	nmdc:mga0qj67_25184_c1_2084_3493	430
434	3300050510	nmdc:mga06r32_164770_c1	nmdc:mga06r32_164770_c1_10_1443	430
435	3300050510	nmdc:mga06r32_386_c1	nmdc:mga06r32_386_c1_903_2342	430
436	3300050510	nmdc:mga06r32_86316_c1	nmdc:mga06r32_86316_c1_509_1918	430
437	3300050511	nmdc:mga08y16_16647_c1	nmdc:mga08y16_16647_c1_1736_3175	430
438	3300050511	nmdc:mga08y16_331_c1	nmdc:mga08y16_331_c1_37703_39271	430
439	3300050511	nmdc:mga08y16_59777_c1	nmdc:mga08y16_59777_c1_1146_2582	430
440	3300050512	nmdc:mga0n895_143668_c1	nmdc:mga0n895_143668_c1_391_1836	430
441	3300050512	nmdc:mga0n895_2364_c1	nmdc:mga0n895_2364_c1_5402_6970	430
442	3300050513	nmdc:mga0rr50_44604_c1	nmdc:mga0rr50_44604_c1_219_1787	430
443	3300050514	nmdc:mga08x19_6250_c1	nmdc:mga08x19_6250_c1_4691_6259	430
444	3300050515	nmdc:mga0a205_1111_c1	nmdc:mga0a205_1111_c1_1446_2924	430
445	3300050515	nmdc:mga0a205_71_c1	nmdc:mga0a205_71_c1_48750_50318	430
446	3300053085	Ga0495619_0000389	Ga0495619_0000389_20754_22172	430
447	3300054114	Ga0501084_0003605	Ga0501084_0003605_2797_4233	430
448	3300060353	Ga0501082_0013085	Ga0501082_0013085_2870_4306	430
449	iso_pu_bacteria	2744054611	2744958281	430
450	iso_pu_bacteria	2816332119	2816424221	430
451	iso_pu_bacteria	2837268691	2837269998	430
452	iso_pu_bacteria	2884994152	2884995274	430
453	3300053088	Ga0500644_0007365	Ga0500644_0007365_1052_2413	431
454	3300053103	Ga0500555_008456	Ga0500555_008456_1205_2605	431
455	3300003320	rootH2_10004183	rootH2_100041834	432
456	3300003322	rootL2_10173994	rootL2_101739942	432
457	3300049571	Ga0501034_0000572	Ga0501034_0000572_7610_8944	432
458	3300049675	Ga0501243_004576	Ga0501243_004576_634_1932	432
459	iso_pu_bacteria	2643221692	2644516119	432
460	3300001977	JGI24746J21847_1001639	JGI24746J21847_10016392	433
461	3300003320	rootH2_10016736	rootH2_100167369	433
462	3300005334	Ga0068869_100195884	Ga0068869_1001958841	433
463	3300005344	Ga0070661_100002705	Ga0070661_1000027059	433
464	3300005459	Ga0068867_100000053	Ga0068867_10000005339	433
465	3300005564	Ga0070664_100000455	Ga0070664_10000045525	433
466	3300009098	Ga0105245_10103866	Ga0105245_101038662	433
467	3300009148	Ga0105243_10000191	Ga0105243_1000019140	433
468	3300025920	Ga0207649_10033613	Ga0207649_100336132	433
469	3300025927	Ga0207687_10084701	Ga0207687_100847012	433
470	3300025935	Ga0207709_10000261	Ga0207709_1000026140	433
471	3300025942	Ga0207689_10204584	Ga0207689_102045841	433
472	3300025945	Ga0207679_10001313	Ga0207679_100013134	433
473	3300026089	Ga0207648_10000154	Ga0207648_1000015418	433
474	3300028563	Ga0265319_1000413	Ga0265319_100041326	433
475	3300031240	Ga0265320_10006203	Ga0265320_100062031	433
476	3300031711	Ga0265314_10003059	Ga0265314_100030593	433
477	3300031911	Ga0307412_10000070	Ga0307412_1000007082	433
478	3300042127	Ga0450890_000066	Ga0450890_000066_12357_13658	433
479	3300042130	Ga0450892_000277	Ga0450892_000277_2817_4118	433
480	3300042532	Ga0450893_0000101	Ga0450893_0000101_1422_2723	433
481	3300042532	Ga0450893_0002032	Ga0450893_0002032_645_1946	433
482	3300044712	Ga0453684_0077868	Ga0453684_0077868_2063_3382	433
483	3300048903	Ga0496100_0061936	Ga0496100_0061936_770_2116	433
484	3300049569	Ga0501032_0052182	Ga0501032_0052182_267_1568	433
485	3300049575	Ga0501039_0102576	Ga0501039_0102576_240_1541	433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

63

492

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ose-assembly1.cif.gz_D	cytochrome bd-ii type oxidase with bound aurachin d	0.953	1	429
5ir6-assembly1.cif.gz_A	the structure of bd oxidase from geobacillus thermodenitrificans	0.945	2	424
7ose-assembly1.cif.gz_D	cytochrome bd-ii type oxidase with bound aurachin d	0.9423	1	429
7nkz-assembly1.cif.gz_A	cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution	0.9283	1	426
5ir6-assembly1.cif.gz_A	the structure of bd oxidase from geobacillus thermodenitrificans	0.9239	2	424

ID	Description	Score	Start	End	Superfamily
af_A9Z1K9_108_335_1.20.120.1770	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.6747	10	144	1.20.120.1770
af_Q17661_216_431_1.20.120.1770	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.6727	8	143	1.20.120.1770
af_Q46755_4_127_1.20.120.550	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain	0.5895	13	138	1.20.120.550
4z9hA00	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain	0.582	4	141	1.20.120.30
af_K7MEX1_94_281_1.20.120.1770	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.5713	2	138	1.20.120.1770

ID	Description	Score	Start	End	GO Terms
AF-A0A4V1SRL3-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9886	1	253	GO:0005886 GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069
AF-A0A838P349-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9879	1	328	GO:0005886 GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069
AF-A0A7W1IV37-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9852	1	146	GO:0005886 GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069
AF-A0A4V1SRL3-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9848	1	253	GO:0005886 GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069
AF-A0A3M0XTJ4-F1-model_v4	Cytochrome ubiquinol oxidase subunit I	0.9847	1	432	GO:0005886 GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069

Feature Viewer

pLDDT	pTM	Quality
89.66	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453086

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

63

492

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map