F453072

General Info

Members Datasets Scaffolds Average Seq Length
485 336 435 148

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10113513|Ga0081455_101135133
Length 151
Sequence MPNTVRLHRVLATTPEKLYRAFLEPDAVAKWLPPNGFACTVHHLEARVGGTHKMSFRNFTAGDSSFGSHSFGGQYLELVPNERLRYTDKFDDPNLPGEMTVTVTLKKVSVGTELSIVQEGVPDAIPAEACYLGWQESLENLKRLVEPDIKP

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
8 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
9 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
10 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
11 2643221569 Achromobacter sp. Root565 Isolate Unclassified
12 2643221594 Achromobacter sp. Root170 Isolate Unclassified
13 2643221621 Achromobacter sp. Root83 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
16 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
17 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
18 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
19 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
20 2818991450 Burkholderia sp. 604 Isolate Unclassified
21 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
22 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
23 2858950400 Achromobacter sp. K91 Isolate Unclassified
24 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
25 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
26 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
27 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
28 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
29 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
30 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
31 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
32 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
33 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
34 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
35 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
36 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
37 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
38 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
39 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
40 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
41 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
42 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
43 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
44 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
45 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
46 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
47 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
48 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
49 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 0
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 5.57
Rhizoplane 6.8
Rhizosphere 67.84
Stem 0
Stem Tuber 0
Unclassified 9.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10069978 3300001979 Bacteria 942
2 JGI24739J22299_10008098 3300001989 Bacteria 3925
3 JGI24739J22299_10008222 3300001989 Bacteria 3894
4 JGI24739J22299_10036751 3300001989 Bacteria 1653
5 JGI24737J22298_10002958 3300001990 Bacteria 6023
6 JGI24737J22298_10038715 3300001990 Bacteria 1467
7 JGI24737J22298_10102394 3300001990 Bacteria 848
8 JGI24735J21928_10000985 3300002067 Bacteria 10197
9 JGI24735J21928_10003569 3300002067 Bacteria 5290
10 JGI24735J21928_10047422 3300002067 Bacteria 1245
11 JGI25162J39368_1000551 3300002737 Bacteria 27687
12 JGI25162J39368_1000604 3300002737 Bacteria 25862
13 JGI25157J39369_1000485 3300002741 Bacteria 24711
14 JGI25164J39214_1000046 3300002772 Bacteria 124984
15 JGI25164J39214_1000191 3300002772 Bacteria 53327
16 JGI25152J39213_1005748 3300002773 Bacteria 3535
17 JGI25165J46597_1000096 3300003214 Bacteria 161294
18 rootH1_10179127 3300003323 Bacteria 2873
19 JGI25160J50197_1021273 3300003354 Bacteria 1933
20 Ga0055527_1003070 3300003760 Bacteria 2588
21 Ga0055535_1000336 3300003761 Bacteria 46983
22 Ga0055535_1000675 3300003761 Bacteria 26608
23 Ga0055542_1000348 3300003762 Bacteria 48634
24 Ga0055529_1000309 3300003763 Bacteria 56116
25 Ga0055526_1002537 3300003771 Bacteria 12254
26 Ga0055524_1018412 3300003775 Bacteria 2426
27 Ga0055536_1073791 3300003781 Bacteria 665
28 Ga0055528_1019123 3300003790 Bacteria 2289
29 Ga0065714_10074392 3300005288 Bacteria 3043
30 Ga0070658_10096885 3300005327 Bacteria 2436
31 Ga0070658_10723659 3300005327 Bacteria 864
32 Ga0070683_100000046 3300005329 Bacteria 95134
33 Ga0070670_100000126 3300005331 Bacteria 71644
34 Ga0070666_10004034 3300005335 Bacteria 8911
35 Ga0070660_100162290 3300005339 Bacteria 1801
36 Ga0070660_100654436 3300005339 Bacteria 880
37 Ga0070689_100289903 3300005340 Bacteria 1360
38 Ga0070671_100596748 3300005355 Bacteria 954
39 Ga0070659_100168552 3300005366 Bacteria 1793
40 Ga0070659_100355858 3300005366 Bacteria 1229
41 Ga0070667_100000057 3300005367 Bacteria 150501
42 Ga0070663_100294172 3300005455 Bacteria 1298
43 Ga0070662_100151727 3300005457 Bacteria 1805
44 Ga0070662_100421674 3300005457 Bacteria 1104
45 Ga0070698_100753693 3300005471 Bacteria 917
46 Ga0070679_100108721 3300005530 Bacteria 2759
47 Ga0070679_100307380 3300005530 Unclassified 1536
48 Ga0070679_100398176 3300005530 Bacteria 1323
49 Ga0070684_100025052 3300005535 Bacteria 5010
50 Ga0068853_100005841 3300005539 Bacteria 9693
51 Ga0068853_100066614 3300005539 Bacteria 3128
52 Ga0068853_100207754 3300005539 Bacteria 1784
53 Ga0070672_100008032 3300005543 Bacteria 7207
54 Ga0070686_100804530 3300005544 Bacteria 758
55 Ga0068855_100007720 3300005563 Bacteria 12990
56 Ga0068855_100080510 3300005563 Bacteria 3777
57 Ga0068855_100286825 3300005563 Bacteria 1826
58 Ga0068857_100125711 3300005577 Bacteria 2310
59 Ga0068857_100375420 3300005577 Bacteria 1319
60 Ga0068854_100028297 3300005578 Bacteria 3871
61 Ga0068856_100006599 3300005614 Bacteria 11374
62 Ga0068856_100020287 3300005614 Bacteria 6455
63 Ga0068856_102028578 3300005614 Bacteria 585
64 Ga0068852_100039942 3300005616 Bacteria 3954
65 Ga0068852_100167206 3300005616 Bacteria 2058
66 Ga0068859_100720060 3300005617 Bacteria 1088
67 Ga0068863_100336489 3300005841 Bacteria 1468
68 Ga0068858_101946208 3300005842 Bacteria 581
69 Ga0068860_100216290 3300005843 Bacteria 1860
70 Ga0081455_10113513 3300005937 Bacteria 2149
71 Ga0075365_10592613 3300006038 Bacteria 784
72 Ga0070712_101359833 3300006175 Bacteria 619
73 Ga0075362_10625984 3300006177 Bacteria 557
74 Ga0075369_10161475 3300006186 Bacteria 1027
75 Ga0075366_10015915 3300006195 Bacteria 4317
76 Ga0097621_100551902 3300006237 Bacteria 1049
77 Ga0068871_100107162 3300006358 Bacteria 2347
78 Ga0075430_100227517 3300006846 Bacteria 1547
79 Ga0068865_100077636 3300006881 Bacteria 2374
80 Ga0097620_100720082 3300006931 Bacteria 1088
81 Ga0099794_10020591 3300007265 Bacteria 2987
82 Ga0105251_10000029 3300009011 Bacteria 125097
83 Ga0105251_10002461 3300009011 Bacteria 14537
84 Ga0105251_10009781 3300009011 Bacteria 5624
85 Ga0105250_10073212 3300009092 Bacteria 1385
86 Ga0105240_10057758 3300009093 Bacteria 4845
87 Ga0105240_10240159 3300009093 Bacteria 2101
88 Ga0105247_10019748 3300009101 Bacteria 4047
89 Ga0105247_10705861 3300009101 Bacteria 760
90 Ga0105248_10004912 3300009177 Bacteria 14768
91 Ga0105248_11203229 3300009177 Bacteria 857
92 Ga0105237_10037680 3300009545 Bacteria 4886
93 Ga0105237_10096426 3300009545 Bacteria 2948
94 Ga0105237_10263158 3300009545 Bacteria 1727
95 Ga0105237_10313555 3300009545 Bacteria 1572
96 Ga0105238_10053312 3300009551 Bacteria 4064
97 Ga0105238_10473898 3300009551 Bacteria 1251
98 Ga0105147_106359 3300009982 Bacteria 1001
99 Ga0105239_10005426 3300010375 Bacteria 14965
100 Ga0105239_10542815 3300010375 Bacteria 1324
101 Ga0157370_10042767 3300013104 Bacteria 4364
102 Ga0157369_10000783 3300013105 Bacteria 40985
103 Ga0157369_10086121 3300013105 Bacteria 3356
104 Ga0157369_10238473 3300013105 Bacteria 1900
105 Ga0157369_10511527 3300013105 Bacteria 1242
106 Ga0157374_10310621 3300013296 Bacteria 1561
107 Ga0163162_10021856 3300013306 Bacteria 6303
108 Ga0157372_10107526 3300013307 Bacteria 3192
109 Ga0157375_10435014 3300013308 Bacteria 1478
110 Ga0157375_10667664 3300013308 Bacteria 1195
111 Ga0163163_10007443 3300014325 Bacteria 9663
112 Ga0163163_10739000 3300014325 Bacteria 1047
113 Ga0163163_10911047 3300014325 Bacteria 943
114 Ga0182007_10003546 3300015262 Bacteria 7350
115 Ga0163161_10000244 3300017792 Bacteria 49165
116 Ga0163161_10352956 3300017792 Bacteria 1169
117 Ga0209672_100160 3300025228 Bacteria 57654
118 Ga0209672_100651 3300025228 Bacteria 17730
119 Ga0207427_100040 3300025231 Bacteria 265135
120 Ga0209437_100172 3300025233 Bacteria 140146
121 Ga0209258_100246 3300025242 Bacteria 99606
122 Ga0209258_100272 3300025242 Bacteria 88382
123 Ga0209646_1002050 3300025246 Bacteria 4774
124 Ga0209026_1001902 3300025250 Bacteria 8480
125 Ga0209148_1000024 3300025254 Bacteria 669890
126 Ga0209148_1000185 3300025254 Bacteria 118117
127 Ga0209759_1000287 3300025256 Bacteria 70252
128 Ga0209759_1000807 3300025256 Bacteria 25155
129 Ga0209129_1002556 3300025258 Bacteria 8791
130 Ga0209233_1000108 3300025261 Bacteria 265137
131 Ga0209455_1000025 3300025272 Bacteria 670673
132 Ga0209455_1002195 3300025272 Bacteria 7724
133 Ga0209676_1020428 3300025292 Bacteria 2250
134 Ga0209564_1022954 3300025295 Bacteria 2185
135 Ga0209050_1012438 3300025298 Bacteria 3901
136 Ga0209256_1007394 3300025299 Bacteria 5431
137 Ga0207426_1001990 3300025302 Bacteria 14441
138 Ga0207426_1002441 3300025302 Bacteria 11864
139 Ga0209051_1030486 3300025303 Bacteria 2092
140 Ga0207696_1056476 3300025711 Bacteria 1111
141 Ga0207713_1000112 3300025735 Bacteria 133341
142 Ga0207710_10021471 3300025900 Bacteria 2767
143 Ga0207647_10000712 3300025904 Bacteria 26107
144 Ga0207647_10005249 3300025904 Bacteria 9535
145 Ga0207654_10017149 3300025911 Bacteria 3782
146 Ga0207695_10001998 3300025913 Bacteria 31500
147 Ga0207695_10280257 3300025913 Bacteria 1561
148 Ga0207671_10067018 3300025914 Bacteria 2673
149 Ga0207671_10181398 3300025914 Bacteria 1638
150 Ga0207657_10024087 3300025919 Bacteria 5651
151 Ga0207657_10108986 3300025919 Bacteria 2289
152 Ga0207652_10366941 3300025921 Bacteria 1300
153 Ga0207694_10000157 3300025924 Bacteria 70076
154 Ga0207694_10047369 3300025924 Bacteria 3325
155 Ga0207694_10677543 3300025924 Bacteria 869
156 Ga0207650_10000035 3300025925 Bacteria 215488
157 Ga0207687_10371507 3300025927 Bacteria 1169
158 Ga0207644_10186065 3300025931 Bacteria 1631
159 Ga0207644_11177973 3300025931 Bacteria 644
160 Ga0207690_10095918 3300025932 Bacteria 2108
161 Ga0207690_10356594 3300025932 Bacteria 1157
162 Ga0207706_10432701 3300025933 Bacteria 1139
163 Ga0207706_11566268 3300025933 Bacteria 535
164 Ga0207669_11015887 3300025937 Bacteria 697
165 Ga0207704_10077521 3300025938 Bacteria 2134
166 Ga0207691_10029682 3300025940 Bacteria 5114
167 Ga0207711_10006267 3300025941 Bacteria 10036
168 Ga0207711_10322871 3300025941 Bacteria 1427
169 Ga0207661_10000002 3300025944 Bacteria 816104
170 Ga0207667_10011520 3300025949 Bacteria 10275
171 Ga0207667_10029315 3300025949 Bacteria 5969
172 Ga0207667_10232189 3300025949 Bacteria 1889
173 Ga0207667_10506453 3300025949 Bacteria 1224
174 Ga0207651_10211575 3300025960 Bacteria 1561
175 Ga0207668_10181221 3300025972 Bacteria 1662
176 Ga0207640_10066447 3300025981 Bacteria 2409
177 Ga0207640_10079919 3300025981 Bacteria 2230
178 Ga0207658_10000551 3300025986 Bacteria 33984
179 Ga0207703_11832796 3300026035 Bacteria 583
180 Ga0207639_10014940 3300026041 Bacteria 5470
181 Ga0207639_10174172 3300026041 Bacteria 1825
182 Ga0207702_10000002 3300026078 Bacteria 491507
183 Ga0207702_10058373 3300026078 Bacteria 3284
184 Ga0207641_10318843 3300026088 Bacteria 1473
185 Ga0207674_10035480 3300026116 Bacteria 5204
186 Ga0207674_10036525 3300026116 Bacteria 5117
187 Ga0207675_100069139 3300026118 Bacteria 3300
188 Ga0207698_10018538 3300026142 Bacteria 4745
189 Ga0207698_10109072 3300026142 Bacteria 2315
190 Ga0207428_10331846 3300027907 Unclassified 1121
191 Ga0265338_10001292 3300028800 Bacteria 41039
192 Ga0265316_10531041 3300031344 Bacteria 838
193 Ga0307508_10223576 3300031616 Bacteria 1482
194 Ga0307516_10210142 3300031730 Bacteria 1661
195 Ga0307516_10428245 3300031730 Bacteria 981
196 Ga0307413_10015606 3300031824 Bacteria 3899
197 Ga0307413_11716223 3300031824 Bacteria 560
198 Ga0307410_10014537 3300031852 Bacteria 4636
199 Ga0307410_10511415 3300031852 Bacteria 990
200 Ga0307406_10006870 3300031901 Bacteria 6300
201 Ga0307412_10000403 3300031911 Bacteria 26350
202 Ga0307412_10004374 3300031911 Bacteria 7875
203 Ga0307409_100139931 3300031995 Bacteria 2084
204 Ga0307409_100154375 3300031995 Bacteria 1998
205 Ga0307416_101351818 3300032002 Bacteria 818
206 Ga0307416_101395116 3300032002 Bacteria 806
207 Ga0307414_10139252 3300032004 Bacteria 1897
208 Ga0307411_10570279 3300032005 Bacteria 969
209 Ga0307510_10243474 3300033180 Bacteria 1291
210 Ga0373924_0104960 3300035410 Bacteria 1218
211 Ga0373935_0711414 3300035692 Bacteria 739
212 Ga0373927_0064899 3300035695 Bacteria 2362
213 Ga0373927_0330969 3300035695 Bacteria 1003
214 Ga0373947_0066274 3300035725 Bacteria 2204
215 Ga0373937_0460211 3300036401 Bacteria 1208
216 Ga0373925_0123325 3300037068 Bacteria 2013
217 Ga0395900_0611925 3300037418 Bacteria 1029
218 Ga0395898_0000069 3300037466 Bacteria 254587
219 Ga0395898_0046274 3300037466 Bacteria 4274
220 Ga0395898_0633899 3300037466 Bacteria 1011
221 Ga0395905_0087632 3300037471 Bacteria 2918
222 Ga0395901_1887468 3300038443 Bacteria 545
223 Ga0436361_0636518 3300039447 Bacteria 1575
224 Ga0451853_0346831 3300041512 Bacteria 726
225 Ga0439432_164630 3300042006 Bacteria 648
226 Ga0439450_199417 3300042008 Bacteria 535
227 Ga0450888_067479 3300042126 Bacteria 533
228 Ga0451577_0406956 3300042876 Bacteria 1235
229 Ga0451577_1140824 3300042876 Unclassified 697
230 Ga0466969_0001473 3300044656 Bacteria 12646
231 Ga0466966_0007303 3300044684 Bacteria 7323
232 Ga0466961_0030016 3300044693 Bacteria 3493
233 Ga0453684_0330795 3300044712 Bacteria 1723
234 Ga0453684_0582139 3300044712 Bacteria 1229
235 Ga0466971_0091847 3300044719 Bacteria 1391
236 Ga0466970_0120415 3300044765 Bacteria 1437
237 Ga0466959_0847721 3300045049 Bacteria 610
238 Ga0466958_0786159 3300045836 Bacteria 620
239 Ga0466967_2142461 3300045976 Bacteria 555
240 Ga0466967_2158366 3300045976 Bacteria 553
241 Ga0495603_0040452 3300046455 Bacteria 2790
242 Ga0495590_0001159 3300046457 Bacteria 11537
243 Ga0495590_0214361 3300046457 Bacteria 710
244 Ga0495629_0002103 3300046459 Bacteria 15450
245 Ga0495629_0008214 3300046459 Bacteria 7676
246 Ga0495629_0453515 3300046459 Bacteria 868
247 Ga0495638_0000047 3300046460 Bacteria 216004
248 Ga0495651_0488419 3300046462 Bacteria 790
249 Ga0495653_0001072 3300046463 Bacteria 21091
250 Ga0495653_0030079 3300046463 Bacteria 4329
251 Ga0495653_0152035 3300046463 Bacteria 1616
252 Ga0495650_0002203 3300046471 Bacteria 16442
253 Ga0495650_0008031 3300046471 Bacteria 6231
254 Ga0495650_0047109 3300046471 Bacteria 1805
255 Ga0495580_0131551 3300046472 Bacteria 1735
256 Ga0495582_0030950 3300046473 Bacteria 2940
257 Ga0495582_0085386 3300046473 Bacteria 1756
258 Ga0495605_0128337 3300046474 Bacteria 1145
259 Ga0495639_0077396 3300046475 Bacteria 1544
260 Ga0495662_0175327 3300046476 Bacteria 1057
261 Ga0495664_0169338 3300046477 Bacteria 1325
262 Ga0495664_0249838 3300046477 Bacteria 1072
263 Ga0495664_0478992 3300046477 Bacteria 744
264 Ga0495584_0050207 3300046491 Bacteria 2101
265 Ga0495585_0125169 3300046492 Bacteria 1357
266 Ga0495596_0039387 3300046500 Bacteria 1867
267 Ga0495583_0001083 3300046506 Bacteria 30244
268 Ga0495606_0096953 3300046507 Bacteria 1803
269 Ga0495606_0366724 3300046507 Bacteria 759
270 Ga0495608_0195826 3300046511 Bacteria 1275
271 Ga0495610_0023438 3300046512 Bacteria 3355
272 Ga0495628_0018832 3300046516 Bacteria 5714
273 Ga0495630_0008047 3300046517 Bacteria 7580
274 Ga0495630_0046692 3300046517 Bacteria 3238
275 Ga0495643_0000160 3300046522 Bacteria 107502
276 Ga0495648_0000019 3300046524 Bacteria 276407
277 Ga0495648_0501738 3300046524 Bacteria 520
278 Ga0495642_0003905 3300046528 Bacteria 5836
279 Ga0495652_0006134 3300046529 Bacteria 11233
280 Ga0495654_0062663 3300046530 Bacteria 1782
281 Ga0495665_0000015 3300046531 Bacteria 66451
282 Ga0495665_0034780 3300046531 Bacteria 2695
283 Ga0495665_0475883 3300046531 Bacteria 630
284 Ga0495586_0139914 3300046535 Bacteria 1358
285 Ga0495586_0285557 3300046535 Bacteria 945
286 Ga0495609_0024578 3300046538 Bacteria 2763
287 Ga0495609_0024851 3300046538 Bacteria 2746
288 Ga0495597_0001887 3300046542 Bacteria 14297
289 Ga0495597_0006955 3300046542 Bacteria 5799
290 Ga0495645_0000238 3300046543 Bacteria 40111
291 Ga0495645_0008669 3300046543 Bacteria 7103
292 Ga0495645_0055693 3300046543 Bacteria 2871
293 Ga0495622_0000071 3300046557 Bacteria 89071
294 Ga0495633_0000077 3300046558 Bacteria 129051
295 Ga0495667_0249528 3300046559 Bacteria 1130
296 Ga0495656_0112847 3300046615 Bacteria 1274
297 Ga0495668_0698423 3300046616 Bacteria 561
298 Ga0495634_0124025 3300046642 Bacteria 1652
299 Ga0495634_0436845 3300046642 Bacteria 774
300 Ga0495625_0000447 3300046660 Bacteria 62017
301 Ga0495635_0022197 3300046663 Bacteria 4420
302 Ga0495588_0166166 3300046674 Bacteria 1167
303 Ga0495657_0371119 3300046675 Bacteria 845
304 Ga0495599_0221932 3300046678 Bacteria 1156
305 Ga0495623_0004100 3300046679 Bacteria 9601
306 Ga0495623_0299521 3300046679 Bacteria 889
307 Ga0495646_0000652 3300046680 Bacteria 19006
308 Ga0495646_0016576 3300046680 Bacteria 4678
309 Ga0495646_0400514 3300046680 Bacteria 714
310 Ga0495647_0166604 3300046681 Bacteria 952
311 Ga0495658_0289957 3300046683 Bacteria 1034
312 Ga0495669_0176246 3300046684 Bacteria 1018
313 Ga0495669_0344953 3300046684 Bacteria 720
314 Ga0495669_0457848 3300046684 Bacteria 619
315 Ga0495613_0009049 3300046689 Bacteria 7389
316 Ga0495624_0001634 3300046690 Bacteria 17184
317 Ga0495624_0495809 3300046690 Bacteria 731
318 Ga0495670_0316194 3300046691 Bacteria 838
319 Ga0495649_0012211 3300046694 Bacteria 5008
320 Ga0495649_0017723 3300046694 Bacteria 4016
321 Ga0495589_0003916 3300046794 Bacteria 7991
322 Ga0495589_0031567 3300046794 Bacteria 2666
323 Ga0495600_0101428 3300046809 Bacteria 1876
324 Ga0495660_0008470 3300046810 Bacteria 6023
325 Ga0495660_0086167 3300046810 Bacteria 1640
326 Ga0495581_0002045 3300047315 Bacteria 11345
327 Ga0495581_0094984 3300047315 Bacteria 1731
328 Ga0495674_0009227 3300047319 Bacteria 9375
329 Ga0495674_0020521 3300047319 Bacteria 6114
330 Ga0495674_0141015 3300047319 Bacteria 2026
331 Ga0495674_0573261 3300047319 Bacteria 896
332 Ga0495672_0020134 3300047320 Bacteria 4380
333 Ga0495680_0012736 3300047322 Bacteria 7378
334 Ga0495680_0106869 3300047322 Bacteria 2079
335 Ga0495683_0009451 3300047323 Bacteria 5194
336 Ga0495683_0073548 3300047323 Bacteria 1676
337 Ga0495683_0097890 3300047323 Bacteria 1414
338 Ga0495687_000005 3300047443 Bacteria 610401
339 Ga0495687_000172 3300047443 Bacteria 95963
340 Ga0495687_007044 3300047443 Bacteria 6730
341 Ga0495681_0184495 3300047470 Bacteria 855
342 Ga0495684_0493761 3300047471 Bacteria 843
343 Ga0495686_0025442 3300047472 Bacteria 3880
344 Ga0495593_0000133 3300047673 Bacteria 35691
345 Ga0495602_0009012 3300048088 Bacteria 10396
346 Ga0495602_0113176 3300048088 Bacteria 2200
347 Ga0495626_0307871 3300048091 Bacteria 625
348 Ga0496100_0015692 3300048903 Bacteria 4427
349 Ga0496100_0128792 3300048903 Bacteria 1780
350 Ga0496100_0794018 3300048903 Bacteria 741
351 Ga0496101_0012004 3300048904 Bacteria 5773
352 Ga0496101_0251968 3300048904 Bacteria 1376
353 Ga0496102_0022504 3300048905 Bacteria 5585
354 Ga0496102_0214240 3300048905 Bacteria 1816
355 Ga0496102_0596241 3300048905 Bacteria 1028
356 Ga0496102_1109306 3300048905 Bacteria 711
357 Ga0496103_0016864 3300048906 Bacteria 4362
358 Ga0496103_0224087 3300048906 Bacteria 1209
359 Ga0496103_0289879 3300048906 Bacteria 1053
360 Ga0496104_0024340 3300048907 Bacteria 5570
361 Ga0496105_0055448 3300048908 Bacteria 3272
362 Ga0496105_0071221 3300048908 Bacteria 2873
363 Ga0496105_0091086 3300048908 Bacteria 2518
364 Ga0496106_0000927 3300048909 Bacteria 21342
365 Ga0496106_0482163 3300048909 Bacteria 996
366 Ga0496107_0011986 3300048910 Bacteria 6050
367 Ga0496108_0424873 3300048911 Bacteria 1161
368 Ga0496109_0349456 3300048912 Bacteria 1397
369 Ga0496109_0499632 3300048912 Bacteria 1148
370 Ga0496110_0005273 3300048913 Bacteria 10118
371 Ga0496110_0177993 3300048913 Bacteria 1931
372 Ga0496111_0408452 3300048914 Bacteria 1003
373 Ga0496112_0027280 3300048915 Bacteria 5506
374 Ga0496113_0052182 3300048916 Bacteria 3053
375 Ga0496113_0311212 3300048916 Bacteria 1262
376 Ga0496114_0011278 3300048917 Bacteria 7137
377 Ga0496114_0111384 3300048917 Bacteria 2346
378 Ga0496114_0827189 3300048917 Bacteria 805
379 Ga0496115_0105671 3300048918 Bacteria 2311
380 Ga0496116_0008625 3300048919 Bacteria 8820
381 Ga0496116_0012173 3300048919 Bacteria 7040
382 Ga0496116_0215728 3300048919 Bacteria 989
383 Ga0496116_0276127 3300048919 Bacteria 817
384 Ga0496117_0018118 3300048920 Bacteria 5854
385 Ga0496117_0511245 3300048920 Bacteria 580
386 Ga0496118_0000692 3300048921 Bacteria 54767
387 Ga0496118_0041023 3300048921 Bacteria 3671
388 Ga0496118_0130406 3300048921 Bacteria 1616
389 Ga0496119_0066367 3300048922 Bacteria 2132
390 Ga0496120_0199814 3300048923 Bacteria 969
391 Ga0496121_0014098 3300048924 Bacteria 8521
392 Ga0496121_0132690 3300048924 Bacteria 1861
393 Ga0496121_0503456 3300048924 Bacteria 768
394 Ga0496121_0679145 3300048924 Bacteria 623
395 Ga0496122_0022670 3300048925 Bacteria 5573
396 Ga0496124_0015110 3300048927 Bacteria 7422
397 Ga0496124_0106290 3300048927 Bacteria 2266
398 Ga0496124_0269764 3300048927 Bacteria 1247
399 Ga0496125_0016492 3300048928 Bacteria 7090
400 Ga0496125_0138492 3300048928 Bacteria 1697
401 Ga0496125_0322219 3300048928 Bacteria 936
402 Ga0495678_013126 3300049459 Bacteria 3900
403 Ga0495678_139707 3300049459 Bacteria 794
404 Ga0495682_0225148 3300049460 Bacteria 664
405 Ga0501032_0204630 3300049569 Bacteria 1288
406 Ga0501033_0002576 3300049570 Bacteria 15299
407 Ga0501034_0001752 3300049571 Bacteria 27816
408 Ga0501046_0000681 3300049580 Bacteria 33000
409 Ga0501047_0169969 3300049581 Bacteria 2049
410 Ga0501047_0246811 3300049581 Bacteria 1634
411 Ga0501048_0033584 3300049582 Bacteria 3706
412 Ga0501068_0059802 3300049584 Bacteria 2313
413 Ga0501069_0567032 3300049585 Bacteria 680
414 Ga0501070_1027080 3300049586 Bacteria 638
415 Ga0501073_0277345 3300049589 Bacteria 1156
416 Ga0501083_0013438 3300049744 Bacteria 5722
417 Ga0501035_0191925 3300049822 Bacteria 1756
418 Ga0501044_0004164 3300049823 Bacteria 16251
419 Ga0501044_0031553 3300049823 Bacteria 5576
420 nmdc:mga03683_111263_c1 3300050489 Bacteria 1211
421 nmdc:mga00v17_1036767_c1 3300050491 Bacteria 515
422 nmdc:mga0k408_140244_c1 3300050493 Bacteria 1438
423 nmdc:mga0k408_566314_c1 3300050493 Bacteria 671
424 nmdc:mga06z11_537535_c1 3300050494 Bacteria 709
425 nmdc:mga0qj67_209526_c1 3300050509 Bacteria 1583
426 nmdc:mga08y16_148450_c1 3300050511 Unclassified 2437
427 nmdc:mga0a205_269415_c1 3300050515 Bacteria 1580
428 nmdc:mga0sz30_151384_c1 3300050516 Bacteria 1026
429 Ga0495612_0190889 3300053078 Bacteria 902
430 Ga0500566_0397442 3300053094 Bacteria 618
431 Ga0500634_0010102 3300053161 Bacteria 4811
432 Ga0500637_0206334 3300053178 Bacteria 1117
433 Ga0501084_0264337 3300054114 Bacteria 1453
434 Ga0466962_0011071 3300061719 Bacteria 4343
435 Ga0530510_0002166 3300061734 Bacteria 13474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0636518 Ga0436361_0636518_882_1295 137
2 3300045976 Ga0466967_2142461 Ga0466967_2142461_130_543 137
3 3300046462 Ga0495651_0488419 Ga0495651_0488419_358_771 137
4 3300046476 Ga0495662_0175327 Ga0495662_0175327_622_1035 137
5 3300046507 Ga0495606_0096953 Ga0495606_0096953_1358_1771 137
6 3300046517 Ga0495630_0046692 Ga0495630_0046692_11_424 137
7 3300046680 Ga0495646_0400514 Ga0495646_0400514_11_424 137
8 3300046690 Ga0495624_0495809 Ga0495624_0495809_301_714 137
9 3300047470 Ga0495681_0184495 Ga0495681_0184495_12_425 137
10 3300048919 Ga0496116_0215728 Ga0496116_0215728_24_437 137
11 3300014325 Ga0163163_10739000 Ga0163163_107390002 138
12 3300053094 Ga0500566_0397442 Ga0500566_0397442_30_446 138
13 3300047319 Ga0495674_0573261 Ga0495674_0573261_38_472 143
14 iso_pu_bacteria 2512875026 2512974870 143
15 iso_pu_bacteria 2513237089 2513603794 143
16 iso_pu_bacteria 2513237160 2514004248 143
17 iso_pu_bacteria 2802428858 2802718289 143
18 iso_pu_bacteria 2802428859 2802725917 143
19 iso_pu_bacteria 2802428861 2802736435 143
20 iso_pu_bacteria 2802428862 2802744409 143
21 iso_pu_bacteria 2840878972 2840882532 143
22 iso_pu_bacteria 2915980308 2915981061 143
23 iso_pu_bacteria 2916061851 2916066016 143
24 iso_pu_bacteria 2937029754 2937035990 143
25 iso_pu_bacteria 2937036028 2937038918 143
26 iso_pu_bacteria 2937078374 2937084845 143
27 iso_pu_bacteria 2937084907 2937088667 143
28 iso_pu_bacteria 2957375807 2957376098 143
29 iso_pu_bacteria 2957437181 2957439685 143
30 iso_pu_bacteria 2960591022 2960592567 143
31 iso_pu_bacteria 2960631154 2960636048 143
32 iso_pu_bacteria 2960680706 2960681204 143
33 iso_pu_bacteria 2960693952 2960694003 143
34 iso_pu_bacteria 2967686174 2967691930 143
35 iso_pu_bacteria 2967728569 2967733326 143
36 iso_pu_bacteria 2970026789 2970029734 143
37 iso_pu_bacteria 2970122695 2970127277 143
38 iso_pu_bacteria 2970143518 2970145716 143
39 iso_pu_bacteria 2977530762 2977537208 143
40 iso_pu_bacteria 2977544691 2977550176 143
41 iso_pu_bacteria 8003999396 8004006234 143
42 iso_pu_bacteria 2501025502 2501080187 144
43 iso_pu_bacteria 2501025504 2501409894 144
44 iso_pu_bacteria 2510917013 2511089834 144
45 iso_pu_bacteria 2510917014 2511095225 144
46 iso_pu_bacteria 2510917015 2511104883 144
47 iso_pu_bacteria 2515154189 2516016661 144
48 iso_pu_bacteria 2599185292 2599905202 144
49 iso_pu_bacteria 2643221569 2643858588 144
50 iso_pu_bacteria 2643221594 2643982369 144
51 iso_pu_bacteria 2643221621 2644121616 144
52 iso_pu_bacteria 2643221654 2644304180 144
53 iso_pu_bacteria 2808606395 2809034479 144
54 iso_pu_bacteria 2818991450 2819621268 144
55 iso_pu_bacteria 2857537821 2857540029 144
56 iso_pu_bacteria 2858950400 2858953317 144
57 iso_pu_bacteria 2881927736 2881930567 144
58 iso_pu_bacteria 2883087390 2883090660 144
59 iso_pu_bacteria 2900634093 2900638957 144
60 iso_pu_bacteria 2928108538 2928109220 144
61 iso_pu_bacteria 2928135762 2928136443 144
62 iso_pu_bacteria 2928503688 2928503776 144
63 iso_pu_bacteria 2945984333 2945988393 144
64 3300005471 Ga0070698_100753693 Ga0070698_1007536931 145
65 3300028800 Ga0265338_10001292 Ga0265338_100012925 145
66 3300001979 JGI24740J21852_10069978 JGI24740J21852_100699781 147
67 3300001989 JGI24739J22299_10008098 JGI24739J22299_100080984 147
68 3300001989 JGI24739J22299_10008222 JGI24739J22299_100082222 147
69 3300001989 JGI24739J22299_10036751 JGI24739J22299_100367513 147
70 3300001990 JGI24737J22298_10002958 JGI24737J22298_100029587 147
71 3300001990 JGI24737J22298_10038715 JGI24737J22298_100387152 147
72 3300001990 JGI24737J22298_10102394 JGI24737J22298_101023942 147
73 3300002067 JGI24735J21928_10000985 JGI24735J21928_100009858 147
74 3300002067 JGI24735J21928_10003569 JGI24735J21928_100035695 147
75 3300002067 JGI24735J21928_10047422 JGI24735J21928_100474221 147
76 3300002737 JGI25162J39368_1000551 JGI25162J39368_10005513 147
77 3300002737 JGI25162J39368_1000604 JGI25162J39368_10006049 147
78 3300002741 JGI25157J39369_1000485 JGI25157J39369_100048518 147
79 3300002772 JGI25164J39214_1000046 JGI25164J39214_100004619 147
80 3300002772 JGI25164J39214_1000191 JGI25164J39214_100019121 147
81 3300002773 JGI25152J39213_1005748 JGI25152J39213_10057483 147
82 3300003214 JGI25165J46597_1000096 JGI25165J46597_100009646 147
83 3300003323 rootH1_10179127 rootH1_101791273 147
84 3300003354 JGI25160J50197_1021273 JGI25160J50197_10212732 147
85 3300003760 Ga0055527_1003070 Ga0055527_10030701 147
86 3300003761 Ga0055535_1000336 Ga0055535_100033619 147
87 3300003761 Ga0055535_1000675 Ga0055535_100067520 147
88 3300003762 Ga0055542_1000348 Ga0055542_10003489 147
89 3300003763 Ga0055529_1000309 Ga0055529_100030921 147
90 3300003771 Ga0055526_1002537 Ga0055526_100253710 147
91 3300003775 Ga0055524_1018412 Ga0055524_10184122 147
92 3300003781 Ga0055536_1073791 Ga0055536_10737911 147
93 3300003790 Ga0055528_1019123 Ga0055528_10191234 147
94 3300005288 Ga0065714_10074392 Ga0065714_100743923 147
95 3300005327 Ga0070658_10096885 Ga0070658_100968854 147
96 3300005327 Ga0070658_10723659 Ga0070658_107236592 147
97 3300005329 Ga0070683_100000046 Ga0070683_1000000464 147
98 3300005331 Ga0070670_100000126 Ga0070670_10000012632 147
99 3300005335 Ga0070666_10004034 Ga0070666_100040343 147
100 3300005339 Ga0070660_100162290 Ga0070660_1001622903 147
101 3300005339 Ga0070660_100654436 Ga0070660_1006544362 147
102 3300005340 Ga0070689_100289903 Ga0070689_1002899032 147
103 3300005355 Ga0070671_100596748 Ga0070671_1005967482 147
104 3300005366 Ga0070659_100168552 Ga0070659_1001685523 147
105 3300005366 Ga0070659_100355858 Ga0070659_1003558582 147
106 3300005367 Ga0070667_100000057 Ga0070667_100000057143 147
107 3300005455 Ga0070663_100294172 Ga0070663_1002941721 147
108 3300005457 Ga0070662_100151727 Ga0070662_1001517272 147
109 3300005457 Ga0070662_100421674 Ga0070662_1004216742 147
110 3300005530 Ga0070679_100108721 Ga0070679_1001087212 147
111 3300005530 Ga0070679_100307380 Ga0070679_1003073802 147
112 3300005530 Ga0070679_100398176 Ga0070679_1003981762 147
113 3300005535 Ga0070684_100025052 Ga0070684_1000250523 147
114 3300005539 Ga0068853_100005841 Ga0068853_1000058415 147
115 3300005539 Ga0068853_100066614 Ga0068853_1000666143 147
116 3300005539 Ga0068853_100207754 Ga0068853_1002077542 147
117 3300005543 Ga0070672_100008032 Ga0070672_1000080326 147
118 3300005544 Ga0070686_100804530 Ga0070686_1008045302 147
119 3300005563 Ga0068855_100007720 Ga0068855_10000772014 147
120 3300005563 Ga0068855_100080510 Ga0068855_1000805103 147
121 3300005563 Ga0068855_100286825 Ga0068855_1002868253 147
122 3300005577 Ga0068857_100125711 Ga0068857_1001257112 147
123 3300005577 Ga0068857_100375420 Ga0068857_1003754202 147
124 3300005578 Ga0068854_100028297 Ga0068854_1000282974 147
125 3300005614 Ga0068856_100006599 Ga0068856_1000065992 147
126 3300005614 Ga0068856_100020287 Ga0068856_1000202878 147
127 3300005614 Ga0068856_102028578 Ga0068856_1020285782 147
128 3300005616 Ga0068852_100039942 Ga0068852_1000399422 147
129 3300005616 Ga0068852_100167206 Ga0068852_1001672062 147
130 3300005617 Ga0068859_100720060 Ga0068859_1007200602 147
131 3300005841 Ga0068863_100336489 Ga0068863_1003364893 147
132 3300005842 Ga0068858_101946208 Ga0068858_1019462081 147
133 3300005843 Ga0068860_100216290 Ga0068860_1002162902 147
134 3300005937 Ga0081455_10113513 Ga0081455_101135133 147
135 3300006038 Ga0075365_10592613 Ga0075365_105926131 147
136 3300006175 Ga0070712_101359833 Ga0070712_1013598332 147
137 3300006177 Ga0075362_10625984 Ga0075362_106259842 147
138 3300006186 Ga0075369_10161475 Ga0075369_101614752 147
139 3300006195 Ga0075366_10015915 Ga0075366_100159155 147
140 3300006237 Ga0097621_100551902 Ga0097621_1005519021 147
141 3300006358 Ga0068871_100107162 Ga0068871_1001071622 147
142 3300006846 Ga0075430_100227517 Ga0075430_1002275173 147
143 3300006881 Ga0068865_100077636 Ga0068865_1000776364 147
144 3300006931 Ga0097620_100720082 Ga0097620_1007200822 147
145 3300007265 Ga0099794_10020591 Ga0099794_100205912 147
146 3300009011 Ga0105251_10000029 Ga0105251_1000002990 147
147 3300009011 Ga0105251_10002461 Ga0105251_100024617 147
148 3300009011 Ga0105251_10009781 Ga0105251_100097814 147
149 3300009092 Ga0105250_10073212 Ga0105250_100732122 147
150 3300009093 Ga0105240_10057758 Ga0105240_100577586 147
151 3300009093 Ga0105240_10240159 Ga0105240_102401593 147
152 3300009101 Ga0105247_10019748 Ga0105247_100197483 147
153 3300009101 Ga0105247_10705861 Ga0105247_107058611 147
154 3300009177 Ga0105248_10004912 Ga0105248_100049129 147
155 3300009177 Ga0105248_11203229 Ga0105248_112032291 147
156 3300009545 Ga0105237_10037680 Ga0105237_100376807 147
157 3300009545 Ga0105237_10096426 Ga0105237_100964262 147
158 3300009545 Ga0105237_10263158 Ga0105237_102631582 147
159 3300009545 Ga0105237_10313555 Ga0105237_103135552 147
160 3300009551 Ga0105238_10053312 Ga0105238_100533122 147
161 3300009551 Ga0105238_10473898 Ga0105238_104738982 147
162 3300009982 Ga0105147_106359 Ga0105147_1063591 147
163 3300010375 Ga0105239_10005426 Ga0105239_100054262 147
164 3300010375 Ga0105239_10542815 Ga0105239_105428152 147
165 3300013104 Ga0157370_10042767 Ga0157370_100427673 147
166 3300013105 Ga0157369_10000783 Ga0157369_1000078325 147
167 3300013105 Ga0157369_10086121 Ga0157369_100861213 147
168 3300013105 Ga0157369_10238473 Ga0157369_102384733 147
169 3300013105 Ga0157369_10511527 Ga0157369_105115273 147
170 3300013296 Ga0157374_10310621 Ga0157374_103106213 147
171 3300013306 Ga0163162_10021856 Ga0163162_100218562 147
172 3300013307 Ga0157372_10107526 Ga0157372_101075264 147
173 3300013308 Ga0157375_10435014 Ga0157375_104350142 147
174 3300013308 Ga0157375_10667664 Ga0157375_106676642 147
175 3300014325 Ga0163163_10007443 Ga0163163_100074438 147
176 3300014325 Ga0163163_10911047 Ga0163163_109110472 147
177 3300015262 Ga0182007_10003546 Ga0182007_100035464 147
178 3300017792 Ga0163161_10000244 Ga0163161_1000024433 147
179 3300017792 Ga0163161_10352956 Ga0163161_103529562 147
180 3300025228 Ga0209672_100160 Ga0209672_10016035 147
181 3300025228 Ga0209672_100651 Ga0209672_10065120 147
182 3300025231 Ga0207427_100040 Ga0207427_100040104 147
183 3300025233 Ga0209437_100172 Ga0209437_100172104 147
184 3300025242 Ga0209258_100246 Ga0209258_10024664 147
185 3300025242 Ga0209258_100272 Ga0209258_10027218 147
186 3300025246 Ga0209646_1002050 Ga0209646_10020504 147
187 3300025250 Ga0209026_1001902 Ga0209026_10019029 147
188 3300025254 Ga0209148_1000024 Ga0209148_1000024468 147
189 3300025254 Ga0209148_1000185 Ga0209148_100018518 147
190 3300025256 Ga0209759_1000287 Ga0209759_100028736 147
191 3300025256 Ga0209759_1000807 Ga0209759_10008073 147
192 3300025258 Ga0209129_1002556 Ga0209129_10025564 147
193 3300025261 Ga0209233_1000108 Ga0209233_1000108122 147
194 3300025272 Ga0209455_1000025 Ga0209455_1000025468 147
195 3300025272 Ga0209455_1002195 Ga0209455_10021953 147
196 3300025292 Ga0209676_1020428 Ga0209676_10204283 147
197 3300025295 Ga0209564_1022954 Ga0209564_10229542 147
198 3300025298 Ga0209050_1012438 Ga0209050_10124382 147
199 3300025299 Ga0209256_1007394 Ga0209256_10073945 147
200 3300025302 Ga0207426_1001990 Ga0207426_100199011 147
201 3300025302 Ga0207426_1002441 Ga0207426_10024415 147
202 3300025303 Ga0209051_1030486 Ga0209051_10304863 147
203 3300025711 Ga0207696_1056476 Ga0207696_10564762 147
204 3300025735 Ga0207713_1000112 Ga0207713_100011231 147
205 3300025900 Ga0207710_10021471 Ga0207710_100214712 147
206 3300025904 Ga0207647_10000712 Ga0207647_1000071211 147
207 3300025904 Ga0207647_10005249 Ga0207647_1000524912 147
208 3300025911 Ga0207654_10017149 Ga0207654_100171491 147
209 3300025913 Ga0207695_10001998 Ga0207695_1000199819 147
210 3300025913 Ga0207695_10280257 Ga0207695_102802572 147
211 3300025914 Ga0207671_10067018 Ga0207671_100670183 147
212 3300025914 Ga0207671_10181398 Ga0207671_101813982 147
213 3300025919 Ga0207657_10024087 Ga0207657_100240874 147
214 3300025919 Ga0207657_10108986 Ga0207657_101089862 147
215 3300025921 Ga0207652_10366941 Ga0207652_103669412 147
216 3300025924 Ga0207694_10000157 Ga0207694_1000015716 147
217 3300025924 Ga0207694_10047369 Ga0207694_100473692 147
218 3300025924 Ga0207694_10677543 Ga0207694_106775431 147
219 3300025925 Ga0207650_10000035 Ga0207650_10000035121 147
220 3300025927 Ga0207687_10371507 Ga0207687_103715071 147
221 3300025931 Ga0207644_10186065 Ga0207644_101860653 147
222 3300025931 Ga0207644_11177973 Ga0207644_111779731 147
223 3300025932 Ga0207690_10095918 Ga0207690_100959183 147
224 3300025932 Ga0207690_10356594 Ga0207690_103565941 147
225 3300025933 Ga0207706_10432701 Ga0207706_104327012 147
226 3300025933 Ga0207706_11566268 Ga0207706_115662681 147
227 3300025937 Ga0207669_11015887 Ga0207669_110158871 147
228 3300025938 Ga0207704_10077521 Ga0207704_100775213 147
229 3300025940 Ga0207691_10029682 Ga0207691_100296825 147
230 3300025941 Ga0207711_10006267 Ga0207711_100062675 147
231 3300025941 Ga0207711_10322871 Ga0207711_103228711 147
232 3300025944 Ga0207661_10000002 Ga0207661_10000002481 147
233 3300025949 Ga0207667_10011520 Ga0207667_100115204 147
234 3300025949 Ga0207667_10029315 Ga0207667_100293152 147
235 3300025949 Ga0207667_10232189 Ga0207667_102321893 147
236 3300025949 Ga0207667_10506453 Ga0207667_105064532 147
237 3300025960 Ga0207651_10211575 Ga0207651_102115753 147
238 3300025972 Ga0207668_10181221 Ga0207668_101812212 147
239 3300025981 Ga0207640_10066447 Ga0207640_100664474 147
240 3300025981 Ga0207640_10079919 Ga0207640_100799191 147
241 3300025986 Ga0207658_10000551 Ga0207658_100005519 147
242 3300026035 Ga0207703_11832796 Ga0207703_118327961 147
243 3300026041 Ga0207639_10014940 Ga0207639_100149402 147
244 3300026041 Ga0207639_10174172 Ga0207639_101741723 147
245 3300026078 Ga0207702_10000002 Ga0207702_10000002272 147
246 3300026078 Ga0207702_10058373 Ga0207702_100583732 147
247 3300026088 Ga0207641_10318843 Ga0207641_103188433 147
248 3300026116 Ga0207674_10035480 Ga0207674_100354807 147
249 3300026116 Ga0207674_10036525 Ga0207674_100365252 147
250 3300026118 Ga0207675_100069139 Ga0207675_1000691394 147
251 3300026142 Ga0207698_10018538 Ga0207698_100185383 147
252 3300026142 Ga0207698_10109072 Ga0207698_101090723 147
253 3300027907 Ga0207428_10331846 Ga0207428_103318462 147
254 3300031344 Ga0265316_10531041 Ga0265316_105310411 147
255 3300031616 Ga0307508_10223576 Ga0307508_102235762 147
256 3300031730 Ga0307516_10210142 Ga0307516_102101422 147
257 3300031730 Ga0307516_10428245 Ga0307516_104282452 147
258 3300031824 Ga0307413_10015606 Ga0307413_100156064 147
259 3300031824 Ga0307413_11716223 Ga0307413_117162231 147
260 3300031852 Ga0307410_10014537 Ga0307410_100145378 147
261 3300031852 Ga0307410_10511415 Ga0307410_105114153 147
262 3300031901 Ga0307406_10006870 Ga0307406_1000687011 147
263 3300031911 Ga0307412_10000403 Ga0307412_100004032 147
264 3300031911 Ga0307412_10004374 Ga0307412_100043746 147
265 3300031995 Ga0307409_100139931 Ga0307409_1001399313 147
266 3300031995 Ga0307409_100154375 Ga0307409_1001543754 147
267 3300032002 Ga0307416_101351818 Ga0307416_1013518181 147
268 3300032002 Ga0307416_101395116 Ga0307416_1013951161 147
269 3300032004 Ga0307414_10139252 Ga0307414_101392524 147
270 3300032005 Ga0307411_10570279 Ga0307411_105702791 147
271 3300033180 Ga0307510_10243474 Ga0307510_102434741 147
272 3300035410 Ga0373924_0104960 Ga0373924_0104960_365_808 147
273 3300035692 Ga0373935_0711414 Ga0373935_0711414_146_589 147
274 3300035695 Ga0373927_0064899 Ga0373927_0064899_1326_1769 147
275 3300035695 Ga0373927_0330969 Ga0373927_0330969_280_723 147
276 3300035725 Ga0373947_0066274 Ga0373947_0066274_1658_2101 147
277 3300036401 Ga0373937_0460211 Ga0373937_0460211_754_1197 147
278 3300037068 Ga0373925_0123325 Ga0373925_0123325_848_1291 147
279 3300037418 Ga0395900_0611925 Ga0395900_0611925_249_692 147
280 3300037466 Ga0395898_0000069 Ga0395898_0000069_200756_201202 147
281 3300037466 Ga0395898_0046274 Ga0395898_0046274_1366_1809 147
282 3300037466 Ga0395898_0633899 Ga0395898_0633899_464_907 147
283 3300037471 Ga0395905_0087632 Ga0395905_0087632_1996_2442 147
284 3300038443 Ga0395901_1887468 Ga0395901_1887468_12_455 147
285 3300041512 Ga0451853_0346831 Ga0451853_0346831_34_480 147
286 3300042006 Ga0439432_164630 Ga0439432_164630_130_579 147
287 3300042008 Ga0439450_199417 Ga0439450_199417_57_503 147
288 3300042126 Ga0450888_067479 Ga0450888_067479_40_486 147
289 3300042876 Ga0451577_0406956 Ga0451577_0406956_660_1106 147
290 3300042876 Ga0451577_1140824 Ga0451577_1140824_163_609 147
291 3300044656 Ga0466969_0001473 Ga0466969_0001473_4976_5422 147
292 3300044684 Ga0466966_0007303 Ga0466966_0007303_6838_7284 147
293 3300044693 Ga0466961_0030016 Ga0466961_0030016_74_520 147
294 3300044712 Ga0453684_0330795 Ga0453684_0330795_1187_1633 147
295 3300044712 Ga0453684_0582139 Ga0453684_0582139_32_478 147
296 3300044719 Ga0466971_0091847 Ga0466971_0091847_930_1376 147
297 3300044765 Ga0466970_0120415 Ga0466970_0120415_960_1406 147
298 3300045049 Ga0466959_0847721 Ga0466959_0847721_125_571 147
299 3300045836 Ga0466958_0786159 Ga0466958_0786159_80_526 147
300 3300045976 Ga0466967_2158366 Ga0466967_2158366_91_537 147
301 3300046455 Ga0495603_0040452 Ga0495603_0040452_141_587 147
302 3300046457 Ga0495590_0001159 Ga0495590_0001159_2161_2607 147
303 3300046457 Ga0495590_0214361 Ga0495590_0214361_26_472 147
304 3300046459 Ga0495629_0002103 Ga0495629_0002103_102_548 147
305 3300046459 Ga0495629_0008214 Ga0495629_0008214_3180_3626 147
306 3300046459 Ga0495629_0453515 Ga0495629_0453515_135_578 147
307 3300046460 Ga0495638_0000047 Ga0495638_0000047_8062_8508 147
308 3300046463 Ga0495653_0001072 Ga0495653_0001072_16764_17210 147
309 3300046463 Ga0495653_0030079 Ga0495653_0030079_1691_2137 147
310 3300046463 Ga0495653_0152035 Ga0495653_0152035_466_912 147
311 3300046471 Ga0495650_0002203 Ga0495650_0002203_13682_14128 147
312 3300046471 Ga0495650_0008031 Ga0495650_0008031_4059_4505 147
313 3300046471 Ga0495650_0047109 Ga0495650_0047109_1278_1724 147
314 3300046472 Ga0495580_0131551 Ga0495580_0131551_359_805 147
315 3300046473 Ga0495582_0030950 Ga0495582_0030950_1018_1464 147
316 3300046473 Ga0495582_0085386 Ga0495582_0085386_1173_1616 147
317 3300046474 Ga0495605_0128337 Ga0495605_0128337_230_676 147
318 3300046475 Ga0495639_0077396 Ga0495639_0077396_479_925 147
319 3300046477 Ga0495664_0169338 Ga0495664_0169338_650_1096 147
320 3300046477 Ga0495664_0249838 Ga0495664_0249838_11_457 147
321 3300046477 Ga0495664_0478992 Ga0495664_0478992_258_722 147
322 3300046491 Ga0495584_0050207 Ga0495584_0050207_1497_1943 147
323 3300046492 Ga0495585_0125169 Ga0495585_0125169_256_702 147
324 3300046500 Ga0495596_0039387 Ga0495596_0039387_611_1057 147
325 3300046506 Ga0495583_0001083 Ga0495583_0001083_1732_2178 147
326 3300046507 Ga0495606_0366724 Ga0495606_0366724_185_631 147
327 3300046511 Ga0495608_0195826 Ga0495608_0195826_517_963 147
328 3300046512 Ga0495610_0023438 Ga0495610_0023438_840_1286 147
329 3300046516 Ga0495628_0018832 Ga0495628_0018832_4504_4950 147
330 3300046517 Ga0495630_0008047 Ga0495630_0008047_228_674 147
331 3300046522 Ga0495643_0000160 Ga0495643_0000160_46424_46870 147
332 3300046524 Ga0495648_0000019 Ga0495648_0000019_66228_66674 147
333 3300046524 Ga0495648_0501738 Ga0495648_0501738_55_507 147
334 3300046528 Ga0495642_0003905 Ga0495642_0003905_3237_3683 147
335 3300046529 Ga0495652_0006134 Ga0495652_0006134_3911_4357 147
336 3300046530 Ga0495654_0062663 Ga0495654_0062663_806_1252 147
337 3300046531 Ga0495665_0000015 Ga0495665_0000015_6042_6488 147
338 3300046531 Ga0495665_0034780 Ga0495665_0034780_926_1372 147
339 3300046531 Ga0495665_0475883 Ga0495665_0475883_60_506 147
340 3300046535 Ga0495586_0139914 Ga0495586_0139914_543_989 147
341 3300046535 Ga0495586_0285557 Ga0495586_0285557_78_524 147
342 3300046538 Ga0495609_0024578 Ga0495609_0024578_396_842 147
343 3300046538 Ga0495609_0024851 Ga0495609_0024851_1725_2171 147
344 3300046542 Ga0495597_0001887 Ga0495597_0001887_8104_8550 147
345 3300046542 Ga0495597_0006955 Ga0495597_0006955_230_676 147
346 3300046543 Ga0495645_0000238 Ga0495645_0000238_27699_28145 147
347 3300046543 Ga0495645_0008669 Ga0495645_0008669_3518_3964 147
348 3300046543 Ga0495645_0055693 Ga0495645_0055693_1774_2220 147
349 3300046557 Ga0495622_0000071 Ga0495622_0000071_37330_37776 147
350 3300046558 Ga0495633_0000077 Ga0495633_0000077_27061_27507 147
351 3300046559 Ga0495667_0249528 Ga0495667_0249528_206_652 147
352 3300046615 Ga0495656_0112847 Ga0495656_0112847_57_503 147
353 3300046616 Ga0495668_0698423 Ga0495668_0698423_25_471 147
354 3300046642 Ga0495634_0124025 Ga0495634_0124025_104_550 147
355 3300046642 Ga0495634_0436845 Ga0495634_0436845_233_679 147
356 3300046660 Ga0495625_0000447 Ga0495625_0000447_13932_14378 147
357 3300046663 Ga0495635_0022197 Ga0495635_0022197_1774_2220 147
358 3300046674 Ga0495588_0166166 Ga0495588_0166166_69_515 147
359 3300046675 Ga0495657_0371119 Ga0495657_0371119_359_805 147
360 3300046678 Ga0495599_0221932 Ga0495599_0221932_289_735 147
361 3300046679 Ga0495623_0004100 Ga0495623_0004100_2239_2685 147
362 3300046679 Ga0495623_0299521 Ga0495623_0299521_49_495 147
363 3300046680 Ga0495646_0000652 Ga0495646_0000652_14406_14852 147
364 3300046680 Ga0495646_0016576 Ga0495646_0016576_2137_2583 147
365 3300046681 Ga0495647_0166604 Ga0495647_0166604_477_920 147
366 3300046683 Ga0495658_0289957 Ga0495658_0289957_495_938 147
367 3300046684 Ga0495669_0176246 Ga0495669_0176246_288_734 147
368 3300046684 Ga0495669_0344953 Ga0495669_0344953_263_709 147
369 3300046684 Ga0495669_0457848 Ga0495669_0457848_115_594 147
370 3300046689 Ga0495613_0009049 Ga0495613_0009049_4494_4940 147
371 3300046690 Ga0495624_0001634 Ga0495624_0001634_12844_13290 147
372 3300046691 Ga0495670_0316194 Ga0495670_0316194_277_723 147
373 3300046694 Ga0495649_0012211 Ga0495649_0012211_2602_3081 147
374 3300046694 Ga0495649_0017723 Ga0495649_0017723_1622_2068 147
375 3300046794 Ga0495589_0003916 Ga0495589_0003916_5567_6013 147
376 3300046794 Ga0495589_0031567 Ga0495589_0031567_517_996 147
377 3300046809 Ga0495600_0101428 Ga0495600_0101428_415_861 147
378 3300046810 Ga0495660_0008470 Ga0495660_0008470_4186_4632 147
379 3300046810 Ga0495660_0086167 Ga0495660_0086167_264_710 147
380 3300047315 Ga0495581_0002045 Ga0495581_0002045_5979_6425 147
381 3300047315 Ga0495581_0094984 Ga0495581_0094984_487_930 147
382 3300047319 Ga0495674_0009227 Ga0495674_0009227_5049_5513 147
383 3300047319 Ga0495674_0020521 Ga0495674_0020521_2890_3336 147
384 3300047319 Ga0495674_0141015 Ga0495674_0141015_96_542 147
385 3300047320 Ga0495672_0020134 Ga0495672_0020134_3249_3713 147
386 3300047322 Ga0495680_0012736 Ga0495680_0012736_2113_2559 147
387 3300047322 Ga0495680_0106869 Ga0495680_0106869_1559_2005 147
388 3300047323 Ga0495683_0009451 Ga0495683_0009451_4485_4931 147
389 3300047323 Ga0495683_0073548 Ga0495683_0073548_970_1416 147
390 3300047323 Ga0495683_0097890 Ga0495683_0097890_363_809 147
391 3300047443 Ga0495687_000005 Ga0495687_000005_283565_284011 147
392 3300047443 Ga0495687_000172 Ga0495687_000172_84617_85063 147
393 3300047443 Ga0495687_007044 Ga0495687_007044_4563_5009 147
394 3300047471 Ga0495684_0493761 Ga0495684_0493761_256_702 147
395 3300047472 Ga0495686_0025442 Ga0495686_0025442_2157_2603 147
396 3300047673 Ga0495593_0000133 Ga0495593_0000133_33579_34025 147
397 3300048088 Ga0495602_0009012 Ga0495602_0009012_2472_2918 147
398 3300048088 Ga0495602_0113176 Ga0495602_0113176_461_907 147
399 3300048091 Ga0495626_0307871 Ga0495626_0307871_82_528 147
400 3300048903 Ga0496100_0015692 Ga0496100_0015692_1498_1944 147
401 3300048903 Ga0496100_0128792 Ga0496100_0128792_747_1193 147
402 3300048903 Ga0496100_0794018 Ga0496100_0794018_201_647 147
403 3300048904 Ga0496101_0012004 Ga0496101_0012004_5215_5661 147
404 3300048904 Ga0496101_0251968 Ga0496101_0251968_189_632 147
405 3300048905 Ga0496102_0022504 Ga0496102_0022504_4407_4853 147
406 3300048905 Ga0496102_0214240 Ga0496102_0214240_64_528 147
407 3300048905 Ga0496102_0596241 Ga0496102_0596241_138_653 147
408 3300048905 Ga0496102_1109306 Ga0496102_1109306_228_674 147
409 3300048906 Ga0496103_0016864 Ga0496103_0016864_734_1180 147
410 3300048906 Ga0496103_0224087 Ga0496103_0224087_94_540 147
411 3300048906 Ga0496103_0289879 Ga0496103_0289879_341_805 147
412 3300048907 Ga0496104_0024340 Ga0496104_0024340_150_596 147
413 3300048908 Ga0496105_0055448 Ga0496105_0055448_2008_2454 147
414 3300048908 Ga0496105_0071221 Ga0496105_0071221_958_1401 147
415 3300048908 Ga0496105_0091086 Ga0496105_0091086_1960_2406 147
416 3300048909 Ga0496106_0000927 Ga0496106_0000927_13765_14211 147
417 3300048909 Ga0496106_0482163 Ga0496106_0482163_290_736 147
418 3300048910 Ga0496107_0011986 Ga0496107_0011986_4988_5434 147
419 3300048911 Ga0496108_0424873 Ga0496108_0424873_35_481 147
420 3300048912 Ga0496109_0349456 Ga0496109_0349456_502_948 147
421 3300048912 Ga0496109_0499632 Ga0496109_0499632_406_852 147
422 3300048913 Ga0496110_0005273 Ga0496110_0005273_2209_2655 147
423 3300048913 Ga0496110_0177993 Ga0496110_0177993_935_1381 147
424 3300048914 Ga0496111_0408452 Ga0496111_0408452_204_650 147
425 3300048915 Ga0496112_0027280 Ga0496112_0027280_3332_3778 147
426 3300048916 Ga0496113_0052182 Ga0496113_0052182_860_1306 147
427 3300048916 Ga0496113_0311212 Ga0496113_0311212_91_534 147
428 3300048917 Ga0496114_0011278 Ga0496114_0011278_4620_5066 147
429 3300048917 Ga0496114_0111384 Ga0496114_0111384_1271_1717 147
430 3300048917 Ga0496114_0827189 Ga0496114_0827189_103_549 147
431 3300048918 Ga0496115_0105671 Ga0496115_0105671_1489_1935 147
432 3300048919 Ga0496116_0008625 Ga0496116_0008625_8061_8525 147
433 3300048919 Ga0496116_0012173 Ga0496116_0012173_4974_5420 147
434 3300048919 Ga0496116_0276127 Ga0496116_0276127_291_734 147
435 3300048920 Ga0496117_0018118 Ga0496117_0018118_431_877 147
436 3300048920 Ga0496117_0511245 Ga0496117_0511245_124_570 147
437 3300048921 Ga0496118_0000692 Ga0496118_0000692_48968_49432 147
438 3300048921 Ga0496118_0041023 Ga0496118_0041023_3011_3457 147
439 3300048921 Ga0496118_0130406 Ga0496118_0130406_162_608 147
440 3300048922 Ga0496119_0066367 Ga0496119_0066367_98_541 147
441 3300048923 Ga0496120_0199814 Ga0496120_0199814_220_666 147
442 3300048924 Ga0496121_0014098 Ga0496121_0014098_7764_8210 147
443 3300048924 Ga0496121_0132690 Ga0496121_0132690_879_1322 147
444 3300048924 Ga0496121_0503456 Ga0496121_0503456_198_644 147
445 3300048924 Ga0496121_0679145 Ga0496121_0679145_77_523 147
446 3300048925 Ga0496122_0022670 Ga0496122_0022670_4763_5209 147
447 3300048927 Ga0496124_0015110 Ga0496124_0015110_2242_2688 147
448 3300048927 Ga0496124_0106290 Ga0496124_0106290_1625_2119 147
449 3300048927 Ga0496124_0269764 Ga0496124_0269764_32_493 147
450 3300048928 Ga0496125_0016492 Ga0496125_0016492_4990_5436 147
451 3300048928 Ga0496125_0138492 Ga0496125_0138492_1033_1479 147
452 3300048928 Ga0496125_0322219 Ga0496125_0322219_146_589 147
453 3300049459 Ga0495678_013126 Ga0495678_013126_2176_2622 147
454 3300049459 Ga0495678_139707 Ga0495678_139707_36_515 147
455 3300049460 Ga0495682_0225148 Ga0495682_0225148_40_486 147
456 3300049569 Ga0501032_0204630 Ga0501032_0204630_17_466 147
457 3300049570 Ga0501033_0002576 Ga0501033_0002576_10797_11258 147
458 3300049571 Ga0501034_0001752 Ga0501034_0001752_14287_14730 147
459 3300049580 Ga0501046_0000681 Ga0501046_0000681_23019_23480 147
460 3300049581 Ga0501047_0169969 Ga0501047_0169969_472_921 147
461 3300049581 Ga0501047_0246811 Ga0501047_0246811_340_801 147
462 3300049582 Ga0501048_0033584 Ga0501048_0033584_2396_2857 147
463 3300049584 Ga0501068_0059802 Ga0501068_0059802_616_1059 147
464 3300049585 Ga0501069_0567032 Ga0501069_0567032_172_615 147
465 3300049586 Ga0501070_1027080 Ga0501070_1027080_173_616 147
466 3300049589 Ga0501073_0277345 Ga0501073_0277345_608_1138 147
467 3300049744 Ga0501083_0013438 Ga0501083_0013438_2223_2666 147
468 3300049822 Ga0501035_0191925 Ga0501035_0191925_694_1137 147
469 3300049823 Ga0501044_0004164 Ga0501044_0004164_8953_9414 147
470 3300049823 Ga0501044_0031553 Ga0501044_0031553_1299_1742 147
471 3300050489 nmdc:mga03683_111263_c1 nmdc:mga03683_111263_c1_95_538 147
472 3300050491 nmdc:mga00v17_1036767_c1 nmdc:mga00v17_1036767_c1_40_483 147
473 3300050493 nmdc:mga0k408_140244_c1 nmdc:mga0k408_140244_c1_663_1106 147
474 3300050493 nmdc:mga0k408_566314_c1 nmdc:mga0k408_566314_c1_181_645 147
475 3300050494 nmdc:mga06z11_537535_c1 nmdc:mga06z11_537535_c1_196_639 147
476 3300050509 nmdc:mga0qj67_209526_c1 nmdc:mga0qj67_209526_c1_1055_1501 147
477 3300050511 nmdc:mga08y16_148450_c1 nmdc:mga08y16_148450_c1_39_491 147
478 3300050515 nmdc:mga0a205_269415_c1 nmdc:mga0a205_269415_c1_143_586 147
479 3300050516 nmdc:mga0sz30_151384_c1 nmdc:mga0sz30_151384_c1_46_510 147
480 3300053078 Ga0495612_0190889 Ga0495612_0190889_444_887 147
481 3300053161 Ga0500634_0010102 Ga0500634_0010102_1784_2245 147
482 3300053178 Ga0500637_0206334 Ga0500637_0206334_104_550 147
483 3300054114 Ga0501084_0264337 Ga0501084_0264337_401_931 147
484 3300061719 Ga0466962_0011071 Ga0466962_0011071_3884_4330 147
485 3300061734 Ga0530510_0002166 Ga0530510_0002166_8507_8983 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9954 2 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9909 2 144
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9883 2 144
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.988 1 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9839 2 144
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9952 2 144 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.988 2 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8986 4 142 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8682 3 139 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.855 3 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A023XIA1-F1-model_v4 deleted 1.002 1 147
AF-A0A0Q6VIA6-F1-model_v4 Toxin 1.002 1 147
AF-Q98IR1-F1-model_v4 Mlr2292 protein 1.002 1 147
AF-A0A656Z4X0-F1-model_v4 Polyketide cyclase 1.002 18 147
AF-A0A3S1ZYZ0-F1-model_v4 deleted 1.001 1 147

Feature Viewer

pLDDT pTM Quality
95.68 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map