F453072
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 336 | 435 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10113513|Ga0081455_101135133 |
| Length | 151 |
| Sequence | MPNTVRLHRVLATTPEKLYRAFLEPDAVAKWLPPNGFACTVHHLEARVGGTHKMSFRNFTAGDSSFGSHSFGGQYLELVPNERLRYTDKFDDPNLPGEMTVTVTLKKVSVGTELSIVQEGVPDAIPAEACYLGWQESLENLKRLVEPDIKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 6 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 7 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 8 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 9 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 10 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 11 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 12 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 13 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 16 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 17 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 18 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 19 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 20 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 21 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 22 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 23 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 24 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 25 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 26 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 27 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 28 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 29 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 30 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 31 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 32 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 33 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 34 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 35 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 36 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 37 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 38 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 39 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 40 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 41 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 42 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 43 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 44 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 45 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 46 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 47 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 48 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 49 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 50 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 53 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 54 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 55 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 56 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 57 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 58 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 59 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 60 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 203 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 301 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 336 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.69 |
| Metatranscriptomes | 0 |
| Isolates | 10.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.9 |
| Nodule | 5.57 |
| Rhizoplane | 6.8 |
| Rhizosphere | 67.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10069978 | 3300001979 | Bacteria | 942 |
| 2 | JGI24739J22299_10008098 | 3300001989 | Bacteria | 3925 |
| 3 | JGI24739J22299_10008222 | 3300001989 | Bacteria | 3894 |
| 4 | JGI24739J22299_10036751 | 3300001989 | Bacteria | 1653 |
| 5 | JGI24737J22298_10002958 | 3300001990 | Bacteria | 6023 |
| 6 | JGI24737J22298_10038715 | 3300001990 | Bacteria | 1467 |
| 7 | JGI24737J22298_10102394 | 3300001990 | Bacteria | 848 |
| 8 | JGI24735J21928_10000985 | 3300002067 | Bacteria | 10197 |
| 9 | JGI24735J21928_10003569 | 3300002067 | Bacteria | 5290 |
| 10 | JGI24735J21928_10047422 | 3300002067 | Bacteria | 1245 |
| 11 | JGI25162J39368_1000551 | 3300002737 | Bacteria | 27687 |
| 12 | JGI25162J39368_1000604 | 3300002737 | Bacteria | 25862 |
| 13 | JGI25157J39369_1000485 | 3300002741 | Bacteria | 24711 |
| 14 | JGI25164J39214_1000046 | 3300002772 | Bacteria | 124984 |
| 15 | JGI25164J39214_1000191 | 3300002772 | Bacteria | 53327 |
| 16 | JGI25152J39213_1005748 | 3300002773 | Bacteria | 3535 |
| 17 | JGI25165J46597_1000096 | 3300003214 | Bacteria | 161294 |
| 18 | rootH1_10179127 | 3300003323 | Bacteria | 2873 |
| 19 | JGI25160J50197_1021273 | 3300003354 | Bacteria | 1933 |
| 20 | Ga0055527_1003070 | 3300003760 | Bacteria | 2588 |
| 21 | Ga0055535_1000336 | 3300003761 | Bacteria | 46983 |
| 22 | Ga0055535_1000675 | 3300003761 | Bacteria | 26608 |
| 23 | Ga0055542_1000348 | 3300003762 | Bacteria | 48634 |
| 24 | Ga0055529_1000309 | 3300003763 | Bacteria | 56116 |
| 25 | Ga0055526_1002537 | 3300003771 | Bacteria | 12254 |
| 26 | Ga0055524_1018412 | 3300003775 | Bacteria | 2426 |
| 27 | Ga0055536_1073791 | 3300003781 | Bacteria | 665 |
| 28 | Ga0055528_1019123 | 3300003790 | Bacteria | 2289 |
| 29 | Ga0065714_10074392 | 3300005288 | Bacteria | 3043 |
| 30 | Ga0070658_10096885 | 3300005327 | Bacteria | 2436 |
| 31 | Ga0070658_10723659 | 3300005327 | Bacteria | 864 |
| 32 | Ga0070683_100000046 | 3300005329 | Bacteria | 95134 |
| 33 | Ga0070670_100000126 | 3300005331 | Bacteria | 71644 |
| 34 | Ga0070666_10004034 | 3300005335 | Bacteria | 8911 |
| 35 | Ga0070660_100162290 | 3300005339 | Bacteria | 1801 |
| 36 | Ga0070660_100654436 | 3300005339 | Bacteria | 880 |
| 37 | Ga0070689_100289903 | 3300005340 | Bacteria | 1360 |
| 38 | Ga0070671_100596748 | 3300005355 | Bacteria | 954 |
| 39 | Ga0070659_100168552 | 3300005366 | Bacteria | 1793 |
| 40 | Ga0070659_100355858 | 3300005366 | Bacteria | 1229 |
| 41 | Ga0070667_100000057 | 3300005367 | Bacteria | 150501 |
| 42 | Ga0070663_100294172 | 3300005455 | Bacteria | 1298 |
| 43 | Ga0070662_100151727 | 3300005457 | Bacteria | 1805 |
| 44 | Ga0070662_100421674 | 3300005457 | Bacteria | 1104 |
| 45 | Ga0070698_100753693 | 3300005471 | Bacteria | 917 |
| 46 | Ga0070679_100108721 | 3300005530 | Bacteria | 2759 |
| 47 | Ga0070679_100307380 | 3300005530 | Unclassified | 1536 |
| 48 | Ga0070679_100398176 | 3300005530 | Bacteria | 1323 |
| 49 | Ga0070684_100025052 | 3300005535 | Bacteria | 5010 |
| 50 | Ga0068853_100005841 | 3300005539 | Bacteria | 9693 |
| 51 | Ga0068853_100066614 | 3300005539 | Bacteria | 3128 |
| 52 | Ga0068853_100207754 | 3300005539 | Bacteria | 1784 |
| 53 | Ga0070672_100008032 | 3300005543 | Bacteria | 7207 |
| 54 | Ga0070686_100804530 | 3300005544 | Bacteria | 758 |
| 55 | Ga0068855_100007720 | 3300005563 | Bacteria | 12990 |
| 56 | Ga0068855_100080510 | 3300005563 | Bacteria | 3777 |
| 57 | Ga0068855_100286825 | 3300005563 | Bacteria | 1826 |
| 58 | Ga0068857_100125711 | 3300005577 | Bacteria | 2310 |
| 59 | Ga0068857_100375420 | 3300005577 | Bacteria | 1319 |
| 60 | Ga0068854_100028297 | 3300005578 | Bacteria | 3871 |
| 61 | Ga0068856_100006599 | 3300005614 | Bacteria | 11374 |
| 62 | Ga0068856_100020287 | 3300005614 | Bacteria | 6455 |
| 63 | Ga0068856_102028578 | 3300005614 | Bacteria | 585 |
| 64 | Ga0068852_100039942 | 3300005616 | Bacteria | 3954 |
| 65 | Ga0068852_100167206 | 3300005616 | Bacteria | 2058 |
| 66 | Ga0068859_100720060 | 3300005617 | Bacteria | 1088 |
| 67 | Ga0068863_100336489 | 3300005841 | Bacteria | 1468 |
| 68 | Ga0068858_101946208 | 3300005842 | Bacteria | 581 |
| 69 | Ga0068860_100216290 | 3300005843 | Bacteria | 1860 |
| 70 | Ga0081455_10113513 | 3300005937 | Bacteria | 2149 |
| 71 | Ga0075365_10592613 | 3300006038 | Bacteria | 784 |
| 72 | Ga0070712_101359833 | 3300006175 | Bacteria | 619 |
| 73 | Ga0075362_10625984 | 3300006177 | Bacteria | 557 |
| 74 | Ga0075369_10161475 | 3300006186 | Bacteria | 1027 |
| 75 | Ga0075366_10015915 | 3300006195 | Bacteria | 4317 |
| 76 | Ga0097621_100551902 | 3300006237 | Bacteria | 1049 |
| 77 | Ga0068871_100107162 | 3300006358 | Bacteria | 2347 |
| 78 | Ga0075430_100227517 | 3300006846 | Bacteria | 1547 |
| 79 | Ga0068865_100077636 | 3300006881 | Bacteria | 2374 |
| 80 | Ga0097620_100720082 | 3300006931 | Bacteria | 1088 |
| 81 | Ga0099794_10020591 | 3300007265 | Bacteria | 2987 |
| 82 | Ga0105251_10000029 | 3300009011 | Bacteria | 125097 |
| 83 | Ga0105251_10002461 | 3300009011 | Bacteria | 14537 |
| 84 | Ga0105251_10009781 | 3300009011 | Bacteria | 5624 |
| 85 | Ga0105250_10073212 | 3300009092 | Bacteria | 1385 |
| 86 | Ga0105240_10057758 | 3300009093 | Bacteria | 4845 |
| 87 | Ga0105240_10240159 | 3300009093 | Bacteria | 2101 |
| 88 | Ga0105247_10019748 | 3300009101 | Bacteria | 4047 |
| 89 | Ga0105247_10705861 | 3300009101 | Bacteria | 760 |
| 90 | Ga0105248_10004912 | 3300009177 | Bacteria | 14768 |
| 91 | Ga0105248_11203229 | 3300009177 | Bacteria | 857 |
| 92 | Ga0105237_10037680 | 3300009545 | Bacteria | 4886 |
| 93 | Ga0105237_10096426 | 3300009545 | Bacteria | 2948 |
| 94 | Ga0105237_10263158 | 3300009545 | Bacteria | 1727 |
| 95 | Ga0105237_10313555 | 3300009545 | Bacteria | 1572 |
| 96 | Ga0105238_10053312 | 3300009551 | Bacteria | 4064 |
| 97 | Ga0105238_10473898 | 3300009551 | Bacteria | 1251 |
| 98 | Ga0105147_106359 | 3300009982 | Bacteria | 1001 |
| 99 | Ga0105239_10005426 | 3300010375 | Bacteria | 14965 |
| 100 | Ga0105239_10542815 | 3300010375 | Bacteria | 1324 |
| 101 | Ga0157370_10042767 | 3300013104 | Bacteria | 4364 |
| 102 | Ga0157369_10000783 | 3300013105 | Bacteria | 40985 |
| 103 | Ga0157369_10086121 | 3300013105 | Bacteria | 3356 |
| 104 | Ga0157369_10238473 | 3300013105 | Bacteria | 1900 |
| 105 | Ga0157369_10511527 | 3300013105 | Bacteria | 1242 |
| 106 | Ga0157374_10310621 | 3300013296 | Bacteria | 1561 |
| 107 | Ga0163162_10021856 | 3300013306 | Bacteria | 6303 |
| 108 | Ga0157372_10107526 | 3300013307 | Bacteria | 3192 |
| 109 | Ga0157375_10435014 | 3300013308 | Bacteria | 1478 |
| 110 | Ga0157375_10667664 | 3300013308 | Bacteria | 1195 |
| 111 | Ga0163163_10007443 | 3300014325 | Bacteria | 9663 |
| 112 | Ga0163163_10739000 | 3300014325 | Bacteria | 1047 |
| 113 | Ga0163163_10911047 | 3300014325 | Bacteria | 943 |
| 114 | Ga0182007_10003546 | 3300015262 | Bacteria | 7350 |
| 115 | Ga0163161_10000244 | 3300017792 | Bacteria | 49165 |
| 116 | Ga0163161_10352956 | 3300017792 | Bacteria | 1169 |
| 117 | Ga0209672_100160 | 3300025228 | Bacteria | 57654 |
| 118 | Ga0209672_100651 | 3300025228 | Bacteria | 17730 |
| 119 | Ga0207427_100040 | 3300025231 | Bacteria | 265135 |
| 120 | Ga0209437_100172 | 3300025233 | Bacteria | 140146 |
| 121 | Ga0209258_100246 | 3300025242 | Bacteria | 99606 |
| 122 | Ga0209258_100272 | 3300025242 | Bacteria | 88382 |
| 123 | Ga0209646_1002050 | 3300025246 | Bacteria | 4774 |
| 124 | Ga0209026_1001902 | 3300025250 | Bacteria | 8480 |
| 125 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 126 | Ga0209148_1000185 | 3300025254 | Bacteria | 118117 |
| 127 | Ga0209759_1000287 | 3300025256 | Bacteria | 70252 |
| 128 | Ga0209759_1000807 | 3300025256 | Bacteria | 25155 |
| 129 | Ga0209129_1002556 | 3300025258 | Bacteria | 8791 |
| 130 | Ga0209233_1000108 | 3300025261 | Bacteria | 265137 |
| 131 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 132 | Ga0209455_1002195 | 3300025272 | Bacteria | 7724 |
| 133 | Ga0209676_1020428 | 3300025292 | Bacteria | 2250 |
| 134 | Ga0209564_1022954 | 3300025295 | Bacteria | 2185 |
| 135 | Ga0209050_1012438 | 3300025298 | Bacteria | 3901 |
| 136 | Ga0209256_1007394 | 3300025299 | Bacteria | 5431 |
| 137 | Ga0207426_1001990 | 3300025302 | Bacteria | 14441 |
| 138 | Ga0207426_1002441 | 3300025302 | Bacteria | 11864 |
| 139 | Ga0209051_1030486 | 3300025303 | Bacteria | 2092 |
| 140 | Ga0207696_1056476 | 3300025711 | Bacteria | 1111 |
| 141 | Ga0207713_1000112 | 3300025735 | Bacteria | 133341 |
| 142 | Ga0207710_10021471 | 3300025900 | Bacteria | 2767 |
| 143 | Ga0207647_10000712 | 3300025904 | Bacteria | 26107 |
| 144 | Ga0207647_10005249 | 3300025904 | Bacteria | 9535 |
| 145 | Ga0207654_10017149 | 3300025911 | Bacteria | 3782 |
| 146 | Ga0207695_10001998 | 3300025913 | Bacteria | 31500 |
| 147 | Ga0207695_10280257 | 3300025913 | Bacteria | 1561 |
| 148 | Ga0207671_10067018 | 3300025914 | Bacteria | 2673 |
| 149 | Ga0207671_10181398 | 3300025914 | Bacteria | 1638 |
| 150 | Ga0207657_10024087 | 3300025919 | Bacteria | 5651 |
| 151 | Ga0207657_10108986 | 3300025919 | Bacteria | 2289 |
| 152 | Ga0207652_10366941 | 3300025921 | Bacteria | 1300 |
| 153 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 154 | Ga0207694_10047369 | 3300025924 | Bacteria | 3325 |
| 155 | Ga0207694_10677543 | 3300025924 | Bacteria | 869 |
| 156 | Ga0207650_10000035 | 3300025925 | Bacteria | 215488 |
| 157 | Ga0207687_10371507 | 3300025927 | Bacteria | 1169 |
| 158 | Ga0207644_10186065 | 3300025931 | Bacteria | 1631 |
| 159 | Ga0207644_11177973 | 3300025931 | Bacteria | 644 |
| 160 | Ga0207690_10095918 | 3300025932 | Bacteria | 2108 |
| 161 | Ga0207690_10356594 | 3300025932 | Bacteria | 1157 |
| 162 | Ga0207706_10432701 | 3300025933 | Bacteria | 1139 |
| 163 | Ga0207706_11566268 | 3300025933 | Bacteria | 535 |
| 164 | Ga0207669_11015887 | 3300025937 | Bacteria | 697 |
| 165 | Ga0207704_10077521 | 3300025938 | Bacteria | 2134 |
| 166 | Ga0207691_10029682 | 3300025940 | Bacteria | 5114 |
| 167 | Ga0207711_10006267 | 3300025941 | Bacteria | 10036 |
| 168 | Ga0207711_10322871 | 3300025941 | Bacteria | 1427 |
| 169 | Ga0207661_10000002 | 3300025944 | Bacteria | 816104 |
| 170 | Ga0207667_10011520 | 3300025949 | Bacteria | 10275 |
| 171 | Ga0207667_10029315 | 3300025949 | Bacteria | 5969 |
| 172 | Ga0207667_10232189 | 3300025949 | Bacteria | 1889 |
| 173 | Ga0207667_10506453 | 3300025949 | Bacteria | 1224 |
| 174 | Ga0207651_10211575 | 3300025960 | Bacteria | 1561 |
| 175 | Ga0207668_10181221 | 3300025972 | Bacteria | 1662 |
| 176 | Ga0207640_10066447 | 3300025981 | Bacteria | 2409 |
| 177 | Ga0207640_10079919 | 3300025981 | Bacteria | 2230 |
| 178 | Ga0207658_10000551 | 3300025986 | Bacteria | 33984 |
| 179 | Ga0207703_11832796 | 3300026035 | Bacteria | 583 |
| 180 | Ga0207639_10014940 | 3300026041 | Bacteria | 5470 |
| 181 | Ga0207639_10174172 | 3300026041 | Bacteria | 1825 |
| 182 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 183 | Ga0207702_10058373 | 3300026078 | Bacteria | 3284 |
| 184 | Ga0207641_10318843 | 3300026088 | Bacteria | 1473 |
| 185 | Ga0207674_10035480 | 3300026116 | Bacteria | 5204 |
| 186 | Ga0207674_10036525 | 3300026116 | Bacteria | 5117 |
| 187 | Ga0207675_100069139 | 3300026118 | Bacteria | 3300 |
| 188 | Ga0207698_10018538 | 3300026142 | Bacteria | 4745 |
| 189 | Ga0207698_10109072 | 3300026142 | Bacteria | 2315 |
| 190 | Ga0207428_10331846 | 3300027907 | Unclassified | 1121 |
| 191 | Ga0265338_10001292 | 3300028800 | Bacteria | 41039 |
| 192 | Ga0265316_10531041 | 3300031344 | Bacteria | 838 |
| 193 | Ga0307508_10223576 | 3300031616 | Bacteria | 1482 |
| 194 | Ga0307516_10210142 | 3300031730 | Bacteria | 1661 |
| 195 | Ga0307516_10428245 | 3300031730 | Bacteria | 981 |
| 196 | Ga0307413_10015606 | 3300031824 | Bacteria | 3899 |
| 197 | Ga0307413_11716223 | 3300031824 | Bacteria | 560 |
| 198 | Ga0307410_10014537 | 3300031852 | Bacteria | 4636 |
| 199 | Ga0307410_10511415 | 3300031852 | Bacteria | 990 |
| 200 | Ga0307406_10006870 | 3300031901 | Bacteria | 6300 |
| 201 | Ga0307412_10000403 | 3300031911 | Bacteria | 26350 |
| 202 | Ga0307412_10004374 | 3300031911 | Bacteria | 7875 |
| 203 | Ga0307409_100139931 | 3300031995 | Bacteria | 2084 |
| 204 | Ga0307409_100154375 | 3300031995 | Bacteria | 1998 |
| 205 | Ga0307416_101351818 | 3300032002 | Bacteria | 818 |
| 206 | Ga0307416_101395116 | 3300032002 | Bacteria | 806 |
| 207 | Ga0307414_10139252 | 3300032004 | Bacteria | 1897 |
| 208 | Ga0307411_10570279 | 3300032005 | Bacteria | 969 |
| 209 | Ga0307510_10243474 | 3300033180 | Bacteria | 1291 |
| 210 | Ga0373924_0104960 | 3300035410 | Bacteria | 1218 |
| 211 | Ga0373935_0711414 | 3300035692 | Bacteria | 739 |
| 212 | Ga0373927_0064899 | 3300035695 | Bacteria | 2362 |
| 213 | Ga0373927_0330969 | 3300035695 | Bacteria | 1003 |
| 214 | Ga0373947_0066274 | 3300035725 | Bacteria | 2204 |
| 215 | Ga0373937_0460211 | 3300036401 | Bacteria | 1208 |
| 216 | Ga0373925_0123325 | 3300037068 | Bacteria | 2013 |
| 217 | Ga0395900_0611925 | 3300037418 | Bacteria | 1029 |
| 218 | Ga0395898_0000069 | 3300037466 | Bacteria | 254587 |
| 219 | Ga0395898_0046274 | 3300037466 | Bacteria | 4274 |
| 220 | Ga0395898_0633899 | 3300037466 | Bacteria | 1011 |
| 221 | Ga0395905_0087632 | 3300037471 | Bacteria | 2918 |
| 222 | Ga0395901_1887468 | 3300038443 | Bacteria | 545 |
| 223 | Ga0436361_0636518 | 3300039447 | Bacteria | 1575 |
| 224 | Ga0451853_0346831 | 3300041512 | Bacteria | 726 |
| 225 | Ga0439432_164630 | 3300042006 | Bacteria | 648 |
| 226 | Ga0439450_199417 | 3300042008 | Bacteria | 535 |
| 227 | Ga0450888_067479 | 3300042126 | Bacteria | 533 |
| 228 | Ga0451577_0406956 | 3300042876 | Bacteria | 1235 |
| 229 | Ga0451577_1140824 | 3300042876 | Unclassified | 697 |
| 230 | Ga0466969_0001473 | 3300044656 | Bacteria | 12646 |
| 231 | Ga0466966_0007303 | 3300044684 | Bacteria | 7323 |
| 232 | Ga0466961_0030016 | 3300044693 | Bacteria | 3493 |
| 233 | Ga0453684_0330795 | 3300044712 | Bacteria | 1723 |
| 234 | Ga0453684_0582139 | 3300044712 | Bacteria | 1229 |
| 235 | Ga0466971_0091847 | 3300044719 | Bacteria | 1391 |
| 236 | Ga0466970_0120415 | 3300044765 | Bacteria | 1437 |
| 237 | Ga0466959_0847721 | 3300045049 | Bacteria | 610 |
| 238 | Ga0466958_0786159 | 3300045836 | Bacteria | 620 |
| 239 | Ga0466967_2142461 | 3300045976 | Bacteria | 555 |
| 240 | Ga0466967_2158366 | 3300045976 | Bacteria | 553 |
| 241 | Ga0495603_0040452 | 3300046455 | Bacteria | 2790 |
| 242 | Ga0495590_0001159 | 3300046457 | Bacteria | 11537 |
| 243 | Ga0495590_0214361 | 3300046457 | Bacteria | 710 |
| 244 | Ga0495629_0002103 | 3300046459 | Bacteria | 15450 |
| 245 | Ga0495629_0008214 | 3300046459 | Bacteria | 7676 |
| 246 | Ga0495629_0453515 | 3300046459 | Bacteria | 868 |
| 247 | Ga0495638_0000047 | 3300046460 | Bacteria | 216004 |
| 248 | Ga0495651_0488419 | 3300046462 | Bacteria | 790 |
| 249 | Ga0495653_0001072 | 3300046463 | Bacteria | 21091 |
| 250 | Ga0495653_0030079 | 3300046463 | Bacteria | 4329 |
| 251 | Ga0495653_0152035 | 3300046463 | Bacteria | 1616 |
| 252 | Ga0495650_0002203 | 3300046471 | Bacteria | 16442 |
| 253 | Ga0495650_0008031 | 3300046471 | Bacteria | 6231 |
| 254 | Ga0495650_0047109 | 3300046471 | Bacteria | 1805 |
| 255 | Ga0495580_0131551 | 3300046472 | Bacteria | 1735 |
| 256 | Ga0495582_0030950 | 3300046473 | Bacteria | 2940 |
| 257 | Ga0495582_0085386 | 3300046473 | Bacteria | 1756 |
| 258 | Ga0495605_0128337 | 3300046474 | Bacteria | 1145 |
| 259 | Ga0495639_0077396 | 3300046475 | Bacteria | 1544 |
| 260 | Ga0495662_0175327 | 3300046476 | Bacteria | 1057 |
| 261 | Ga0495664_0169338 | 3300046477 | Bacteria | 1325 |
| 262 | Ga0495664_0249838 | 3300046477 | Bacteria | 1072 |
| 263 | Ga0495664_0478992 | 3300046477 | Bacteria | 744 |
| 264 | Ga0495584_0050207 | 3300046491 | Bacteria | 2101 |
| 265 | Ga0495585_0125169 | 3300046492 | Bacteria | 1357 |
| 266 | Ga0495596_0039387 | 3300046500 | Bacteria | 1867 |
| 267 | Ga0495583_0001083 | 3300046506 | Bacteria | 30244 |
| 268 | Ga0495606_0096953 | 3300046507 | Bacteria | 1803 |
| 269 | Ga0495606_0366724 | 3300046507 | Bacteria | 759 |
| 270 | Ga0495608_0195826 | 3300046511 | Bacteria | 1275 |
| 271 | Ga0495610_0023438 | 3300046512 | Bacteria | 3355 |
| 272 | Ga0495628_0018832 | 3300046516 | Bacteria | 5714 |
| 273 | Ga0495630_0008047 | 3300046517 | Bacteria | 7580 |
| 274 | Ga0495630_0046692 | 3300046517 | Bacteria | 3238 |
| 275 | Ga0495643_0000160 | 3300046522 | Bacteria | 107502 |
| 276 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 277 | Ga0495648_0501738 | 3300046524 | Bacteria | 520 |
| 278 | Ga0495642_0003905 | 3300046528 | Bacteria | 5836 |
| 279 | Ga0495652_0006134 | 3300046529 | Bacteria | 11233 |
| 280 | Ga0495654_0062663 | 3300046530 | Bacteria | 1782 |
| 281 | Ga0495665_0000015 | 3300046531 | Bacteria | 66451 |
| 282 | Ga0495665_0034780 | 3300046531 | Bacteria | 2695 |
| 283 | Ga0495665_0475883 | 3300046531 | Bacteria | 630 |
| 284 | Ga0495586_0139914 | 3300046535 | Bacteria | 1358 |
| 285 | Ga0495586_0285557 | 3300046535 | Bacteria | 945 |
| 286 | Ga0495609_0024578 | 3300046538 | Bacteria | 2763 |
| 287 | Ga0495609_0024851 | 3300046538 | Bacteria | 2746 |
| 288 | Ga0495597_0001887 | 3300046542 | Bacteria | 14297 |
| 289 | Ga0495597_0006955 | 3300046542 | Bacteria | 5799 |
| 290 | Ga0495645_0000238 | 3300046543 | Bacteria | 40111 |
| 291 | Ga0495645_0008669 | 3300046543 | Bacteria | 7103 |
| 292 | Ga0495645_0055693 | 3300046543 | Bacteria | 2871 |
| 293 | Ga0495622_0000071 | 3300046557 | Bacteria | 89071 |
| 294 | Ga0495633_0000077 | 3300046558 | Bacteria | 129051 |
| 295 | Ga0495667_0249528 | 3300046559 | Bacteria | 1130 |
| 296 | Ga0495656_0112847 | 3300046615 | Bacteria | 1274 |
| 297 | Ga0495668_0698423 | 3300046616 | Bacteria | 561 |
| 298 | Ga0495634_0124025 | 3300046642 | Bacteria | 1652 |
| 299 | Ga0495634_0436845 | 3300046642 | Bacteria | 774 |
| 300 | Ga0495625_0000447 | 3300046660 | Bacteria | 62017 |
| 301 | Ga0495635_0022197 | 3300046663 | Bacteria | 4420 |
| 302 | Ga0495588_0166166 | 3300046674 | Bacteria | 1167 |
| 303 | Ga0495657_0371119 | 3300046675 | Bacteria | 845 |
| 304 | Ga0495599_0221932 | 3300046678 | Bacteria | 1156 |
| 305 | Ga0495623_0004100 | 3300046679 | Bacteria | 9601 |
| 306 | Ga0495623_0299521 | 3300046679 | Bacteria | 889 |
| 307 | Ga0495646_0000652 | 3300046680 | Bacteria | 19006 |
| 308 | Ga0495646_0016576 | 3300046680 | Bacteria | 4678 |
| 309 | Ga0495646_0400514 | 3300046680 | Bacteria | 714 |
| 310 | Ga0495647_0166604 | 3300046681 | Bacteria | 952 |
| 311 | Ga0495658_0289957 | 3300046683 | Bacteria | 1034 |
| 312 | Ga0495669_0176246 | 3300046684 | Bacteria | 1018 |
| 313 | Ga0495669_0344953 | 3300046684 | Bacteria | 720 |
| 314 | Ga0495669_0457848 | 3300046684 | Bacteria | 619 |
| 315 | Ga0495613_0009049 | 3300046689 | Bacteria | 7389 |
| 316 | Ga0495624_0001634 | 3300046690 | Bacteria | 17184 |
| 317 | Ga0495624_0495809 | 3300046690 | Bacteria | 731 |
| 318 | Ga0495670_0316194 | 3300046691 | Bacteria | 838 |
| 319 | Ga0495649_0012211 | 3300046694 | Bacteria | 5008 |
| 320 | Ga0495649_0017723 | 3300046694 | Bacteria | 4016 |
| 321 | Ga0495589_0003916 | 3300046794 | Bacteria | 7991 |
| 322 | Ga0495589_0031567 | 3300046794 | Bacteria | 2666 |
| 323 | Ga0495600_0101428 | 3300046809 | Bacteria | 1876 |
| 324 | Ga0495660_0008470 | 3300046810 | Bacteria | 6023 |
| 325 | Ga0495660_0086167 | 3300046810 | Bacteria | 1640 |
| 326 | Ga0495581_0002045 | 3300047315 | Bacteria | 11345 |
| 327 | Ga0495581_0094984 | 3300047315 | Bacteria | 1731 |
| 328 | Ga0495674_0009227 | 3300047319 | Bacteria | 9375 |
| 329 | Ga0495674_0020521 | 3300047319 | Bacteria | 6114 |
| 330 | Ga0495674_0141015 | 3300047319 | Bacteria | 2026 |
| 331 | Ga0495674_0573261 | 3300047319 | Bacteria | 896 |
| 332 | Ga0495672_0020134 | 3300047320 | Bacteria | 4380 |
| 333 | Ga0495680_0012736 | 3300047322 | Bacteria | 7378 |
| 334 | Ga0495680_0106869 | 3300047322 | Bacteria | 2079 |
| 335 | Ga0495683_0009451 | 3300047323 | Bacteria | 5194 |
| 336 | Ga0495683_0073548 | 3300047323 | Bacteria | 1676 |
| 337 | Ga0495683_0097890 | 3300047323 | Bacteria | 1414 |
| 338 | Ga0495687_000005 | 3300047443 | Bacteria | 610401 |
| 339 | Ga0495687_000172 | 3300047443 | Bacteria | 95963 |
| 340 | Ga0495687_007044 | 3300047443 | Bacteria | 6730 |
| 341 | Ga0495681_0184495 | 3300047470 | Bacteria | 855 |
| 342 | Ga0495684_0493761 | 3300047471 | Bacteria | 843 |
| 343 | Ga0495686_0025442 | 3300047472 | Bacteria | 3880 |
| 344 | Ga0495593_0000133 | 3300047673 | Bacteria | 35691 |
| 345 | Ga0495602_0009012 | 3300048088 | Bacteria | 10396 |
| 346 | Ga0495602_0113176 | 3300048088 | Bacteria | 2200 |
| 347 | Ga0495626_0307871 | 3300048091 | Bacteria | 625 |
| 348 | Ga0496100_0015692 | 3300048903 | Bacteria | 4427 |
| 349 | Ga0496100_0128792 | 3300048903 | Bacteria | 1780 |
| 350 | Ga0496100_0794018 | 3300048903 | Bacteria | 741 |
| 351 | Ga0496101_0012004 | 3300048904 | Bacteria | 5773 |
| 352 | Ga0496101_0251968 | 3300048904 | Bacteria | 1376 |
| 353 | Ga0496102_0022504 | 3300048905 | Bacteria | 5585 |
| 354 | Ga0496102_0214240 | 3300048905 | Bacteria | 1816 |
| 355 | Ga0496102_0596241 | 3300048905 | Bacteria | 1028 |
| 356 | Ga0496102_1109306 | 3300048905 | Bacteria | 711 |
| 357 | Ga0496103_0016864 | 3300048906 | Bacteria | 4362 |
| 358 | Ga0496103_0224087 | 3300048906 | Bacteria | 1209 |
| 359 | Ga0496103_0289879 | 3300048906 | Bacteria | 1053 |
| 360 | Ga0496104_0024340 | 3300048907 | Bacteria | 5570 |
| 361 | Ga0496105_0055448 | 3300048908 | Bacteria | 3272 |
| 362 | Ga0496105_0071221 | 3300048908 | Bacteria | 2873 |
| 363 | Ga0496105_0091086 | 3300048908 | Bacteria | 2518 |
| 364 | Ga0496106_0000927 | 3300048909 | Bacteria | 21342 |
| 365 | Ga0496106_0482163 | 3300048909 | Bacteria | 996 |
| 366 | Ga0496107_0011986 | 3300048910 | Bacteria | 6050 |
| 367 | Ga0496108_0424873 | 3300048911 | Bacteria | 1161 |
| 368 | Ga0496109_0349456 | 3300048912 | Bacteria | 1397 |
| 369 | Ga0496109_0499632 | 3300048912 | Bacteria | 1148 |
| 370 | Ga0496110_0005273 | 3300048913 | Bacteria | 10118 |
| 371 | Ga0496110_0177993 | 3300048913 | Bacteria | 1931 |
| 372 | Ga0496111_0408452 | 3300048914 | Bacteria | 1003 |
| 373 | Ga0496112_0027280 | 3300048915 | Bacteria | 5506 |
| 374 | Ga0496113_0052182 | 3300048916 | Bacteria | 3053 |
| 375 | Ga0496113_0311212 | 3300048916 | Bacteria | 1262 |
| 376 | Ga0496114_0011278 | 3300048917 | Bacteria | 7137 |
| 377 | Ga0496114_0111384 | 3300048917 | Bacteria | 2346 |
| 378 | Ga0496114_0827189 | 3300048917 | Bacteria | 805 |
| 379 | Ga0496115_0105671 | 3300048918 | Bacteria | 2311 |
| 380 | Ga0496116_0008625 | 3300048919 | Bacteria | 8820 |
| 381 | Ga0496116_0012173 | 3300048919 | Bacteria | 7040 |
| 382 | Ga0496116_0215728 | 3300048919 | Bacteria | 989 |
| 383 | Ga0496116_0276127 | 3300048919 | Bacteria | 817 |
| 384 | Ga0496117_0018118 | 3300048920 | Bacteria | 5854 |
| 385 | Ga0496117_0511245 | 3300048920 | Bacteria | 580 |
| 386 | Ga0496118_0000692 | 3300048921 | Bacteria | 54767 |
| 387 | Ga0496118_0041023 | 3300048921 | Bacteria | 3671 |
| 388 | Ga0496118_0130406 | 3300048921 | Bacteria | 1616 |
| 389 | Ga0496119_0066367 | 3300048922 | Bacteria | 2132 |
| 390 | Ga0496120_0199814 | 3300048923 | Bacteria | 969 |
| 391 | Ga0496121_0014098 | 3300048924 | Bacteria | 8521 |
| 392 | Ga0496121_0132690 | 3300048924 | Bacteria | 1861 |
| 393 | Ga0496121_0503456 | 3300048924 | Bacteria | 768 |
| 394 | Ga0496121_0679145 | 3300048924 | Bacteria | 623 |
| 395 | Ga0496122_0022670 | 3300048925 | Bacteria | 5573 |
| 396 | Ga0496124_0015110 | 3300048927 | Bacteria | 7422 |
| 397 | Ga0496124_0106290 | 3300048927 | Bacteria | 2266 |
| 398 | Ga0496124_0269764 | 3300048927 | Bacteria | 1247 |
| 399 | Ga0496125_0016492 | 3300048928 | Bacteria | 7090 |
| 400 | Ga0496125_0138492 | 3300048928 | Bacteria | 1697 |
| 401 | Ga0496125_0322219 | 3300048928 | Bacteria | 936 |
| 402 | Ga0495678_013126 | 3300049459 | Bacteria | 3900 |
| 403 | Ga0495678_139707 | 3300049459 | Bacteria | 794 |
| 404 | Ga0495682_0225148 | 3300049460 | Bacteria | 664 |
| 405 | Ga0501032_0204630 | 3300049569 | Bacteria | 1288 |
| 406 | Ga0501033_0002576 | 3300049570 | Bacteria | 15299 |
| 407 | Ga0501034_0001752 | 3300049571 | Bacteria | 27816 |
| 408 | Ga0501046_0000681 | 3300049580 | Bacteria | 33000 |
| 409 | Ga0501047_0169969 | 3300049581 | Bacteria | 2049 |
| 410 | Ga0501047_0246811 | 3300049581 | Bacteria | 1634 |
| 411 | Ga0501048_0033584 | 3300049582 | Bacteria | 3706 |
| 412 | Ga0501068_0059802 | 3300049584 | Bacteria | 2313 |
| 413 | Ga0501069_0567032 | 3300049585 | Bacteria | 680 |
| 414 | Ga0501070_1027080 | 3300049586 | Bacteria | 638 |
| 415 | Ga0501073_0277345 | 3300049589 | Bacteria | 1156 |
| 416 | Ga0501083_0013438 | 3300049744 | Bacteria | 5722 |
| 417 | Ga0501035_0191925 | 3300049822 | Bacteria | 1756 |
| 418 | Ga0501044_0004164 | 3300049823 | Bacteria | 16251 |
| 419 | Ga0501044_0031553 | 3300049823 | Bacteria | 5576 |
| 420 | nmdc:mga03683_111263_c1 | 3300050489 | Bacteria | 1211 |
| 421 | nmdc:mga00v17_1036767_c1 | 3300050491 | Bacteria | 515 |
| 422 | nmdc:mga0k408_140244_c1 | 3300050493 | Bacteria | 1438 |
| 423 | nmdc:mga0k408_566314_c1 | 3300050493 | Bacteria | 671 |
| 424 | nmdc:mga06z11_537535_c1 | 3300050494 | Bacteria | 709 |
| 425 | nmdc:mga0qj67_209526_c1 | 3300050509 | Bacteria | 1583 |
| 426 | nmdc:mga08y16_148450_c1 | 3300050511 | Unclassified | 2437 |
| 427 | nmdc:mga0a205_269415_c1 | 3300050515 | Bacteria | 1580 |
| 428 | nmdc:mga0sz30_151384_c1 | 3300050516 | Bacteria | 1026 |
| 429 | Ga0495612_0190889 | 3300053078 | Bacteria | 902 |
| 430 | Ga0500566_0397442 | 3300053094 | Bacteria | 618 |
| 431 | Ga0500634_0010102 | 3300053161 | Bacteria | 4811 |
| 432 | Ga0500637_0206334 | 3300053178 | Bacteria | 1117 |
| 433 | Ga0501084_0264337 | 3300054114 | Bacteria | 1453 |
| 434 | Ga0466962_0011071 | 3300061719 | Bacteria | 4343 |
| 435 | Ga0530510_0002166 | 3300061734 | Bacteria | 13474 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0636518 | Ga0436361_0636518_882_1295 | 137 |
| 2 | 3300045976 | Ga0466967_2142461 | Ga0466967_2142461_130_543 | 137 |
| 3 | 3300046462 | Ga0495651_0488419 | Ga0495651_0488419_358_771 | 137 |
| 4 | 3300046476 | Ga0495662_0175327 | Ga0495662_0175327_622_1035 | 137 |
| 5 | 3300046507 | Ga0495606_0096953 | Ga0495606_0096953_1358_1771 | 137 |
| 6 | 3300046517 | Ga0495630_0046692 | Ga0495630_0046692_11_424 | 137 |
| 7 | 3300046680 | Ga0495646_0400514 | Ga0495646_0400514_11_424 | 137 |
| 8 | 3300046690 | Ga0495624_0495809 | Ga0495624_0495809_301_714 | 137 |
| 9 | 3300047470 | Ga0495681_0184495 | Ga0495681_0184495_12_425 | 137 |
| 10 | 3300048919 | Ga0496116_0215728 | Ga0496116_0215728_24_437 | 137 |
| 11 | 3300014325 | Ga0163163_10739000 | Ga0163163_107390002 | 138 |
| 12 | 3300053094 | Ga0500566_0397442 | Ga0500566_0397442_30_446 | 138 |
| 13 | 3300047319 | Ga0495674_0573261 | Ga0495674_0573261_38_472 | 143 |
| 14 | iso_pu_bacteria | 2512875026 | 2512974870 | 143 |
| 15 | iso_pu_bacteria | 2513237089 | 2513603794 | 143 |
| 16 | iso_pu_bacteria | 2513237160 | 2514004248 | 143 |
| 17 | iso_pu_bacteria | 2802428858 | 2802718289 | 143 |
| 18 | iso_pu_bacteria | 2802428859 | 2802725917 | 143 |
| 19 | iso_pu_bacteria | 2802428861 | 2802736435 | 143 |
| 20 | iso_pu_bacteria | 2802428862 | 2802744409 | 143 |
| 21 | iso_pu_bacteria | 2840878972 | 2840882532 | 143 |
| 22 | iso_pu_bacteria | 2915980308 | 2915981061 | 143 |
| 23 | iso_pu_bacteria | 2916061851 | 2916066016 | 143 |
| 24 | iso_pu_bacteria | 2937029754 | 2937035990 | 143 |
| 25 | iso_pu_bacteria | 2937036028 | 2937038918 | 143 |
| 26 | iso_pu_bacteria | 2937078374 | 2937084845 | 143 |
| 27 | iso_pu_bacteria | 2937084907 | 2937088667 | 143 |
| 28 | iso_pu_bacteria | 2957375807 | 2957376098 | 143 |
| 29 | iso_pu_bacteria | 2957437181 | 2957439685 | 143 |
| 30 | iso_pu_bacteria | 2960591022 | 2960592567 | 143 |
| 31 | iso_pu_bacteria | 2960631154 | 2960636048 | 143 |
| 32 | iso_pu_bacteria | 2960680706 | 2960681204 | 143 |
| 33 | iso_pu_bacteria | 2960693952 | 2960694003 | 143 |
| 34 | iso_pu_bacteria | 2967686174 | 2967691930 | 143 |
| 35 | iso_pu_bacteria | 2967728569 | 2967733326 | 143 |
| 36 | iso_pu_bacteria | 2970026789 | 2970029734 | 143 |
| 37 | iso_pu_bacteria | 2970122695 | 2970127277 | 143 |
| 38 | iso_pu_bacteria | 2970143518 | 2970145716 | 143 |
| 39 | iso_pu_bacteria | 2977530762 | 2977537208 | 143 |
| 40 | iso_pu_bacteria | 2977544691 | 2977550176 | 143 |
| 41 | iso_pu_bacteria | 8003999396 | 8004006234 | 143 |
| 42 | iso_pu_bacteria | 2501025502 | 2501080187 | 144 |
| 43 | iso_pu_bacteria | 2501025504 | 2501409894 | 144 |
| 44 | iso_pu_bacteria | 2510917013 | 2511089834 | 144 |
| 45 | iso_pu_bacteria | 2510917014 | 2511095225 | 144 |
| 46 | iso_pu_bacteria | 2510917015 | 2511104883 | 144 |
| 47 | iso_pu_bacteria | 2515154189 | 2516016661 | 144 |
| 48 | iso_pu_bacteria | 2599185292 | 2599905202 | 144 |
| 49 | iso_pu_bacteria | 2643221569 | 2643858588 | 144 |
| 50 | iso_pu_bacteria | 2643221594 | 2643982369 | 144 |
| 51 | iso_pu_bacteria | 2643221621 | 2644121616 | 144 |
| 52 | iso_pu_bacteria | 2643221654 | 2644304180 | 144 |
| 53 | iso_pu_bacteria | 2808606395 | 2809034479 | 144 |
| 54 | iso_pu_bacteria | 2818991450 | 2819621268 | 144 |
| 55 | iso_pu_bacteria | 2857537821 | 2857540029 | 144 |
| 56 | iso_pu_bacteria | 2858950400 | 2858953317 | 144 |
| 57 | iso_pu_bacteria | 2881927736 | 2881930567 | 144 |
| 58 | iso_pu_bacteria | 2883087390 | 2883090660 | 144 |
| 59 | iso_pu_bacteria | 2900634093 | 2900638957 | 144 |
| 60 | iso_pu_bacteria | 2928108538 | 2928109220 | 144 |
| 61 | iso_pu_bacteria | 2928135762 | 2928136443 | 144 |
| 62 | iso_pu_bacteria | 2928503688 | 2928503776 | 144 |
| 63 | iso_pu_bacteria | 2945984333 | 2945988393 | 144 |
| 64 | 3300005471 | Ga0070698_100753693 | Ga0070698_1007536931 | 145 |
| 65 | 3300028800 | Ga0265338_10001292 | Ga0265338_100012925 | 145 |
| 66 | 3300001979 | JGI24740J21852_10069978 | JGI24740J21852_100699781 | 147 |
| 67 | 3300001989 | JGI24739J22299_10008098 | JGI24739J22299_100080984 | 147 |
| 68 | 3300001989 | JGI24739J22299_10008222 | JGI24739J22299_100082222 | 147 |
| 69 | 3300001989 | JGI24739J22299_10036751 | JGI24739J22299_100367513 | 147 |
| 70 | 3300001990 | JGI24737J22298_10002958 | JGI24737J22298_100029587 | 147 |
| 71 | 3300001990 | JGI24737J22298_10038715 | JGI24737J22298_100387152 | 147 |
| 72 | 3300001990 | JGI24737J22298_10102394 | JGI24737J22298_101023942 | 147 |
| 73 | 3300002067 | JGI24735J21928_10000985 | JGI24735J21928_100009858 | 147 |
| 74 | 3300002067 | JGI24735J21928_10003569 | JGI24735J21928_100035695 | 147 |
| 75 | 3300002067 | JGI24735J21928_10047422 | JGI24735J21928_100474221 | 147 |
| 76 | 3300002737 | JGI25162J39368_1000551 | JGI25162J39368_10005513 | 147 |
| 77 | 3300002737 | JGI25162J39368_1000604 | JGI25162J39368_10006049 | 147 |
| 78 | 3300002741 | JGI25157J39369_1000485 | JGI25157J39369_100048518 | 147 |
| 79 | 3300002772 | JGI25164J39214_1000046 | JGI25164J39214_100004619 | 147 |
| 80 | 3300002772 | JGI25164J39214_1000191 | JGI25164J39214_100019121 | 147 |
| 81 | 3300002773 | JGI25152J39213_1005748 | JGI25152J39213_10057483 | 147 |
| 82 | 3300003214 | JGI25165J46597_1000096 | JGI25165J46597_100009646 | 147 |
| 83 | 3300003323 | rootH1_10179127 | rootH1_101791273 | 147 |
| 84 | 3300003354 | JGI25160J50197_1021273 | JGI25160J50197_10212732 | 147 |
| 85 | 3300003760 | Ga0055527_1003070 | Ga0055527_10030701 | 147 |
| 86 | 3300003761 | Ga0055535_1000336 | Ga0055535_100033619 | 147 |
| 87 | 3300003761 | Ga0055535_1000675 | Ga0055535_100067520 | 147 |
| 88 | 3300003762 | Ga0055542_1000348 | Ga0055542_10003489 | 147 |
| 89 | 3300003763 | Ga0055529_1000309 | Ga0055529_100030921 | 147 |
| 90 | 3300003771 | Ga0055526_1002537 | Ga0055526_100253710 | 147 |
| 91 | 3300003775 | Ga0055524_1018412 | Ga0055524_10184122 | 147 |
| 92 | 3300003781 | Ga0055536_1073791 | Ga0055536_10737911 | 147 |
| 93 | 3300003790 | Ga0055528_1019123 | Ga0055528_10191234 | 147 |
| 94 | 3300005288 | Ga0065714_10074392 | Ga0065714_100743923 | 147 |
| 95 | 3300005327 | Ga0070658_10096885 | Ga0070658_100968854 | 147 |
| 96 | 3300005327 | Ga0070658_10723659 | Ga0070658_107236592 | 147 |
| 97 | 3300005329 | Ga0070683_100000046 | Ga0070683_1000000464 | 147 |
| 98 | 3300005331 | Ga0070670_100000126 | Ga0070670_10000012632 | 147 |
| 99 | 3300005335 | Ga0070666_10004034 | Ga0070666_100040343 | 147 |
| 100 | 3300005339 | Ga0070660_100162290 | Ga0070660_1001622903 | 147 |
| 101 | 3300005339 | Ga0070660_100654436 | Ga0070660_1006544362 | 147 |
| 102 | 3300005340 | Ga0070689_100289903 | Ga0070689_1002899032 | 147 |
| 103 | 3300005355 | Ga0070671_100596748 | Ga0070671_1005967482 | 147 |
| 104 | 3300005366 | Ga0070659_100168552 | Ga0070659_1001685523 | 147 |
| 105 | 3300005366 | Ga0070659_100355858 | Ga0070659_1003558582 | 147 |
| 106 | 3300005367 | Ga0070667_100000057 | Ga0070667_100000057143 | 147 |
| 107 | 3300005455 | Ga0070663_100294172 | Ga0070663_1002941721 | 147 |
| 108 | 3300005457 | Ga0070662_100151727 | Ga0070662_1001517272 | 147 |
| 109 | 3300005457 | Ga0070662_100421674 | Ga0070662_1004216742 | 147 |
| 110 | 3300005530 | Ga0070679_100108721 | Ga0070679_1001087212 | 147 |
| 111 | 3300005530 | Ga0070679_100307380 | Ga0070679_1003073802 | 147 |
| 112 | 3300005530 | Ga0070679_100398176 | Ga0070679_1003981762 | 147 |
| 113 | 3300005535 | Ga0070684_100025052 | Ga0070684_1000250523 | 147 |
| 114 | 3300005539 | Ga0068853_100005841 | Ga0068853_1000058415 | 147 |
| 115 | 3300005539 | Ga0068853_100066614 | Ga0068853_1000666143 | 147 |
| 116 | 3300005539 | Ga0068853_100207754 | Ga0068853_1002077542 | 147 |
| 117 | 3300005543 | Ga0070672_100008032 | Ga0070672_1000080326 | 147 |
| 118 | 3300005544 | Ga0070686_100804530 | Ga0070686_1008045302 | 147 |
| 119 | 3300005563 | Ga0068855_100007720 | Ga0068855_10000772014 | 147 |
| 120 | 3300005563 | Ga0068855_100080510 | Ga0068855_1000805103 | 147 |
| 121 | 3300005563 | Ga0068855_100286825 | Ga0068855_1002868253 | 147 |
| 122 | 3300005577 | Ga0068857_100125711 | Ga0068857_1001257112 | 147 |
| 123 | 3300005577 | Ga0068857_100375420 | Ga0068857_1003754202 | 147 |
| 124 | 3300005578 | Ga0068854_100028297 | Ga0068854_1000282974 | 147 |
| 125 | 3300005614 | Ga0068856_100006599 | Ga0068856_1000065992 | 147 |
| 126 | 3300005614 | Ga0068856_100020287 | Ga0068856_1000202878 | 147 |
| 127 | 3300005614 | Ga0068856_102028578 | Ga0068856_1020285782 | 147 |
| 128 | 3300005616 | Ga0068852_100039942 | Ga0068852_1000399422 | 147 |
| 129 | 3300005616 | Ga0068852_100167206 | Ga0068852_1001672062 | 147 |
| 130 | 3300005617 | Ga0068859_100720060 | Ga0068859_1007200602 | 147 |
| 131 | 3300005841 | Ga0068863_100336489 | Ga0068863_1003364893 | 147 |
| 132 | 3300005842 | Ga0068858_101946208 | Ga0068858_1019462081 | 147 |
| 133 | 3300005843 | Ga0068860_100216290 | Ga0068860_1002162902 | 147 |
| 134 | 3300005937 | Ga0081455_10113513 | Ga0081455_101135133 | 147 |
| 135 | 3300006038 | Ga0075365_10592613 | Ga0075365_105926131 | 147 |
| 136 | 3300006175 | Ga0070712_101359833 | Ga0070712_1013598332 | 147 |
| 137 | 3300006177 | Ga0075362_10625984 | Ga0075362_106259842 | 147 |
| 138 | 3300006186 | Ga0075369_10161475 | Ga0075369_101614752 | 147 |
| 139 | 3300006195 | Ga0075366_10015915 | Ga0075366_100159155 | 147 |
| 140 | 3300006237 | Ga0097621_100551902 | Ga0097621_1005519021 | 147 |
| 141 | 3300006358 | Ga0068871_100107162 | Ga0068871_1001071622 | 147 |
| 142 | 3300006846 | Ga0075430_100227517 | Ga0075430_1002275173 | 147 |
| 143 | 3300006881 | Ga0068865_100077636 | Ga0068865_1000776364 | 147 |
| 144 | 3300006931 | Ga0097620_100720082 | Ga0097620_1007200822 | 147 |
| 145 | 3300007265 | Ga0099794_10020591 | Ga0099794_100205912 | 147 |
| 146 | 3300009011 | Ga0105251_10000029 | Ga0105251_1000002990 | 147 |
| 147 | 3300009011 | Ga0105251_10002461 | Ga0105251_100024617 | 147 |
| 148 | 3300009011 | Ga0105251_10009781 | Ga0105251_100097814 | 147 |
| 149 | 3300009092 | Ga0105250_10073212 | Ga0105250_100732122 | 147 |
| 150 | 3300009093 | Ga0105240_10057758 | Ga0105240_100577586 | 147 |
| 151 | 3300009093 | Ga0105240_10240159 | Ga0105240_102401593 | 147 |
| 152 | 3300009101 | Ga0105247_10019748 | Ga0105247_100197483 | 147 |
| 153 | 3300009101 | Ga0105247_10705861 | Ga0105247_107058611 | 147 |
| 154 | 3300009177 | Ga0105248_10004912 | Ga0105248_100049129 | 147 |
| 155 | 3300009177 | Ga0105248_11203229 | Ga0105248_112032291 | 147 |
| 156 | 3300009545 | Ga0105237_10037680 | Ga0105237_100376807 | 147 |
| 157 | 3300009545 | Ga0105237_10096426 | Ga0105237_100964262 | 147 |
| 158 | 3300009545 | Ga0105237_10263158 | Ga0105237_102631582 | 147 |
| 159 | 3300009545 | Ga0105237_10313555 | Ga0105237_103135552 | 147 |
| 160 | 3300009551 | Ga0105238_10053312 | Ga0105238_100533122 | 147 |
| 161 | 3300009551 | Ga0105238_10473898 | Ga0105238_104738982 | 147 |
| 162 | 3300009982 | Ga0105147_106359 | Ga0105147_1063591 | 147 |
| 163 | 3300010375 | Ga0105239_10005426 | Ga0105239_100054262 | 147 |
| 164 | 3300010375 | Ga0105239_10542815 | Ga0105239_105428152 | 147 |
| 165 | 3300013104 | Ga0157370_10042767 | Ga0157370_100427673 | 147 |
| 166 | 3300013105 | Ga0157369_10000783 | Ga0157369_1000078325 | 147 |
| 167 | 3300013105 | Ga0157369_10086121 | Ga0157369_100861213 | 147 |
| 168 | 3300013105 | Ga0157369_10238473 | Ga0157369_102384733 | 147 |
| 169 | 3300013105 | Ga0157369_10511527 | Ga0157369_105115273 | 147 |
| 170 | 3300013296 | Ga0157374_10310621 | Ga0157374_103106213 | 147 |
| 171 | 3300013306 | Ga0163162_10021856 | Ga0163162_100218562 | 147 |
| 172 | 3300013307 | Ga0157372_10107526 | Ga0157372_101075264 | 147 |
| 173 | 3300013308 | Ga0157375_10435014 | Ga0157375_104350142 | 147 |
| 174 | 3300013308 | Ga0157375_10667664 | Ga0157375_106676642 | 147 |
| 175 | 3300014325 | Ga0163163_10007443 | Ga0163163_100074438 | 147 |
| 176 | 3300014325 | Ga0163163_10911047 | Ga0163163_109110472 | 147 |
| 177 | 3300015262 | Ga0182007_10003546 | Ga0182007_100035464 | 147 |
| 178 | 3300017792 | Ga0163161_10000244 | Ga0163161_1000024433 | 147 |
| 179 | 3300017792 | Ga0163161_10352956 | Ga0163161_103529562 | 147 |
| 180 | 3300025228 | Ga0209672_100160 | Ga0209672_10016035 | 147 |
| 181 | 3300025228 | Ga0209672_100651 | Ga0209672_10065120 | 147 |
| 182 | 3300025231 | Ga0207427_100040 | Ga0207427_100040104 | 147 |
| 183 | 3300025233 | Ga0209437_100172 | Ga0209437_100172104 | 147 |
| 184 | 3300025242 | Ga0209258_100246 | Ga0209258_10024664 | 147 |
| 185 | 3300025242 | Ga0209258_100272 | Ga0209258_10027218 | 147 |
| 186 | 3300025246 | Ga0209646_1002050 | Ga0209646_10020504 | 147 |
| 187 | 3300025250 | Ga0209026_1001902 | Ga0209026_10019029 | 147 |
| 188 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024468 | 147 |
| 189 | 3300025254 | Ga0209148_1000185 | Ga0209148_100018518 | 147 |
| 190 | 3300025256 | Ga0209759_1000287 | Ga0209759_100028736 | 147 |
| 191 | 3300025256 | Ga0209759_1000807 | Ga0209759_10008073 | 147 |
| 192 | 3300025258 | Ga0209129_1002556 | Ga0209129_10025564 | 147 |
| 193 | 3300025261 | Ga0209233_1000108 | Ga0209233_1000108122 | 147 |
| 194 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025468 | 147 |
| 195 | 3300025272 | Ga0209455_1002195 | Ga0209455_10021953 | 147 |
| 196 | 3300025292 | Ga0209676_1020428 | Ga0209676_10204283 | 147 |
| 197 | 3300025295 | Ga0209564_1022954 | Ga0209564_10229542 | 147 |
| 198 | 3300025298 | Ga0209050_1012438 | Ga0209050_10124382 | 147 |
| 199 | 3300025299 | Ga0209256_1007394 | Ga0209256_10073945 | 147 |
| 200 | 3300025302 | Ga0207426_1001990 | Ga0207426_100199011 | 147 |
| 201 | 3300025302 | Ga0207426_1002441 | Ga0207426_10024415 | 147 |
| 202 | 3300025303 | Ga0209051_1030486 | Ga0209051_10304863 | 147 |
| 203 | 3300025711 | Ga0207696_1056476 | Ga0207696_10564762 | 147 |
| 204 | 3300025735 | Ga0207713_1000112 | Ga0207713_100011231 | 147 |
| 205 | 3300025900 | Ga0207710_10021471 | Ga0207710_100214712 | 147 |
| 206 | 3300025904 | Ga0207647_10000712 | Ga0207647_1000071211 | 147 |
| 207 | 3300025904 | Ga0207647_10005249 | Ga0207647_1000524912 | 147 |
| 208 | 3300025911 | Ga0207654_10017149 | Ga0207654_100171491 | 147 |
| 209 | 3300025913 | Ga0207695_10001998 | Ga0207695_1000199819 | 147 |
| 210 | 3300025913 | Ga0207695_10280257 | Ga0207695_102802572 | 147 |
| 211 | 3300025914 | Ga0207671_10067018 | Ga0207671_100670183 | 147 |
| 212 | 3300025914 | Ga0207671_10181398 | Ga0207671_101813982 | 147 |
| 213 | 3300025919 | Ga0207657_10024087 | Ga0207657_100240874 | 147 |
| 214 | 3300025919 | Ga0207657_10108986 | Ga0207657_101089862 | 147 |
| 215 | 3300025921 | Ga0207652_10366941 | Ga0207652_103669412 | 147 |
| 216 | 3300025924 | Ga0207694_10000157 | Ga0207694_1000015716 | 147 |
| 217 | 3300025924 | Ga0207694_10047369 | Ga0207694_100473692 | 147 |
| 218 | 3300025924 | Ga0207694_10677543 | Ga0207694_106775431 | 147 |
| 219 | 3300025925 | Ga0207650_10000035 | Ga0207650_10000035121 | 147 |
| 220 | 3300025927 | Ga0207687_10371507 | Ga0207687_103715071 | 147 |
| 221 | 3300025931 | Ga0207644_10186065 | Ga0207644_101860653 | 147 |
| 222 | 3300025931 | Ga0207644_11177973 | Ga0207644_111779731 | 147 |
| 223 | 3300025932 | Ga0207690_10095918 | Ga0207690_100959183 | 147 |
| 224 | 3300025932 | Ga0207690_10356594 | Ga0207690_103565941 | 147 |
| 225 | 3300025933 | Ga0207706_10432701 | Ga0207706_104327012 | 147 |
| 226 | 3300025933 | Ga0207706_11566268 | Ga0207706_115662681 | 147 |
| 227 | 3300025937 | Ga0207669_11015887 | Ga0207669_110158871 | 147 |
| 228 | 3300025938 | Ga0207704_10077521 | Ga0207704_100775213 | 147 |
| 229 | 3300025940 | Ga0207691_10029682 | Ga0207691_100296825 | 147 |
| 230 | 3300025941 | Ga0207711_10006267 | Ga0207711_100062675 | 147 |
| 231 | 3300025941 | Ga0207711_10322871 | Ga0207711_103228711 | 147 |
| 232 | 3300025944 | Ga0207661_10000002 | Ga0207661_10000002481 | 147 |
| 233 | 3300025949 | Ga0207667_10011520 | Ga0207667_100115204 | 147 |
| 234 | 3300025949 | Ga0207667_10029315 | Ga0207667_100293152 | 147 |
| 235 | 3300025949 | Ga0207667_10232189 | Ga0207667_102321893 | 147 |
| 236 | 3300025949 | Ga0207667_10506453 | Ga0207667_105064532 | 147 |
| 237 | 3300025960 | Ga0207651_10211575 | Ga0207651_102115753 | 147 |
| 238 | 3300025972 | Ga0207668_10181221 | Ga0207668_101812212 | 147 |
| 239 | 3300025981 | Ga0207640_10066447 | Ga0207640_100664474 | 147 |
| 240 | 3300025981 | Ga0207640_10079919 | Ga0207640_100799191 | 147 |
| 241 | 3300025986 | Ga0207658_10000551 | Ga0207658_100005519 | 147 |
| 242 | 3300026035 | Ga0207703_11832796 | Ga0207703_118327961 | 147 |
| 243 | 3300026041 | Ga0207639_10014940 | Ga0207639_100149402 | 147 |
| 244 | 3300026041 | Ga0207639_10174172 | Ga0207639_101741723 | 147 |
| 245 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002272 | 147 |
| 246 | 3300026078 | Ga0207702_10058373 | Ga0207702_100583732 | 147 |
| 247 | 3300026088 | Ga0207641_10318843 | Ga0207641_103188433 | 147 |
| 248 | 3300026116 | Ga0207674_10035480 | Ga0207674_100354807 | 147 |
| 249 | 3300026116 | Ga0207674_10036525 | Ga0207674_100365252 | 147 |
| 250 | 3300026118 | Ga0207675_100069139 | Ga0207675_1000691394 | 147 |
| 251 | 3300026142 | Ga0207698_10018538 | Ga0207698_100185383 | 147 |
| 252 | 3300026142 | Ga0207698_10109072 | Ga0207698_101090723 | 147 |
| 253 | 3300027907 | Ga0207428_10331846 | Ga0207428_103318462 | 147 |
| 254 | 3300031344 | Ga0265316_10531041 | Ga0265316_105310411 | 147 |
| 255 | 3300031616 | Ga0307508_10223576 | Ga0307508_102235762 | 147 |
| 256 | 3300031730 | Ga0307516_10210142 | Ga0307516_102101422 | 147 |
| 257 | 3300031730 | Ga0307516_10428245 | Ga0307516_104282452 | 147 |
| 258 | 3300031824 | Ga0307413_10015606 | Ga0307413_100156064 | 147 |
| 259 | 3300031824 | Ga0307413_11716223 | Ga0307413_117162231 | 147 |
| 260 | 3300031852 | Ga0307410_10014537 | Ga0307410_100145378 | 147 |
| 261 | 3300031852 | Ga0307410_10511415 | Ga0307410_105114153 | 147 |
| 262 | 3300031901 | Ga0307406_10006870 | Ga0307406_1000687011 | 147 |
| 263 | 3300031911 | Ga0307412_10000403 | Ga0307412_100004032 | 147 |
| 264 | 3300031911 | Ga0307412_10004374 | Ga0307412_100043746 | 147 |
| 265 | 3300031995 | Ga0307409_100139931 | Ga0307409_1001399313 | 147 |
| 266 | 3300031995 | Ga0307409_100154375 | Ga0307409_1001543754 | 147 |
| 267 | 3300032002 | Ga0307416_101351818 | Ga0307416_1013518181 | 147 |
| 268 | 3300032002 | Ga0307416_101395116 | Ga0307416_1013951161 | 147 |
| 269 | 3300032004 | Ga0307414_10139252 | Ga0307414_101392524 | 147 |
| 270 | 3300032005 | Ga0307411_10570279 | Ga0307411_105702791 | 147 |
| 271 | 3300033180 | Ga0307510_10243474 | Ga0307510_102434741 | 147 |
| 272 | 3300035410 | Ga0373924_0104960 | Ga0373924_0104960_365_808 | 147 |
| 273 | 3300035692 | Ga0373935_0711414 | Ga0373935_0711414_146_589 | 147 |
| 274 | 3300035695 | Ga0373927_0064899 | Ga0373927_0064899_1326_1769 | 147 |
| 275 | 3300035695 | Ga0373927_0330969 | Ga0373927_0330969_280_723 | 147 |
| 276 | 3300035725 | Ga0373947_0066274 | Ga0373947_0066274_1658_2101 | 147 |
| 277 | 3300036401 | Ga0373937_0460211 | Ga0373937_0460211_754_1197 | 147 |
| 278 | 3300037068 | Ga0373925_0123325 | Ga0373925_0123325_848_1291 | 147 |
| 279 | 3300037418 | Ga0395900_0611925 | Ga0395900_0611925_249_692 | 147 |
| 280 | 3300037466 | Ga0395898_0000069 | Ga0395898_0000069_200756_201202 | 147 |
| 281 | 3300037466 | Ga0395898_0046274 | Ga0395898_0046274_1366_1809 | 147 |
| 282 | 3300037466 | Ga0395898_0633899 | Ga0395898_0633899_464_907 | 147 |
| 283 | 3300037471 | Ga0395905_0087632 | Ga0395905_0087632_1996_2442 | 147 |
| 284 | 3300038443 | Ga0395901_1887468 | Ga0395901_1887468_12_455 | 147 |
| 285 | 3300041512 | Ga0451853_0346831 | Ga0451853_0346831_34_480 | 147 |
| 286 | 3300042006 | Ga0439432_164630 | Ga0439432_164630_130_579 | 147 |
| 287 | 3300042008 | Ga0439450_199417 | Ga0439450_199417_57_503 | 147 |
| 288 | 3300042126 | Ga0450888_067479 | Ga0450888_067479_40_486 | 147 |
| 289 | 3300042876 | Ga0451577_0406956 | Ga0451577_0406956_660_1106 | 147 |
| 290 | 3300042876 | Ga0451577_1140824 | Ga0451577_1140824_163_609 | 147 |
| 291 | 3300044656 | Ga0466969_0001473 | Ga0466969_0001473_4976_5422 | 147 |
| 292 | 3300044684 | Ga0466966_0007303 | Ga0466966_0007303_6838_7284 | 147 |
| 293 | 3300044693 | Ga0466961_0030016 | Ga0466961_0030016_74_520 | 147 |
| 294 | 3300044712 | Ga0453684_0330795 | Ga0453684_0330795_1187_1633 | 147 |
| 295 | 3300044712 | Ga0453684_0582139 | Ga0453684_0582139_32_478 | 147 |
| 296 | 3300044719 | Ga0466971_0091847 | Ga0466971_0091847_930_1376 | 147 |
| 297 | 3300044765 | Ga0466970_0120415 | Ga0466970_0120415_960_1406 | 147 |
| 298 | 3300045049 | Ga0466959_0847721 | Ga0466959_0847721_125_571 | 147 |
| 299 | 3300045836 | Ga0466958_0786159 | Ga0466958_0786159_80_526 | 147 |
| 300 | 3300045976 | Ga0466967_2158366 | Ga0466967_2158366_91_537 | 147 |
| 301 | 3300046455 | Ga0495603_0040452 | Ga0495603_0040452_141_587 | 147 |
| 302 | 3300046457 | Ga0495590_0001159 | Ga0495590_0001159_2161_2607 | 147 |
| 303 | 3300046457 | Ga0495590_0214361 | Ga0495590_0214361_26_472 | 147 |
| 304 | 3300046459 | Ga0495629_0002103 | Ga0495629_0002103_102_548 | 147 |
| 305 | 3300046459 | Ga0495629_0008214 | Ga0495629_0008214_3180_3626 | 147 |
| 306 | 3300046459 | Ga0495629_0453515 | Ga0495629_0453515_135_578 | 147 |
| 307 | 3300046460 | Ga0495638_0000047 | Ga0495638_0000047_8062_8508 | 147 |
| 308 | 3300046463 | Ga0495653_0001072 | Ga0495653_0001072_16764_17210 | 147 |
| 309 | 3300046463 | Ga0495653_0030079 | Ga0495653_0030079_1691_2137 | 147 |
| 310 | 3300046463 | Ga0495653_0152035 | Ga0495653_0152035_466_912 | 147 |
| 311 | 3300046471 | Ga0495650_0002203 | Ga0495650_0002203_13682_14128 | 147 |
| 312 | 3300046471 | Ga0495650_0008031 | Ga0495650_0008031_4059_4505 | 147 |
| 313 | 3300046471 | Ga0495650_0047109 | Ga0495650_0047109_1278_1724 | 147 |
| 314 | 3300046472 | Ga0495580_0131551 | Ga0495580_0131551_359_805 | 147 |
| 315 | 3300046473 | Ga0495582_0030950 | Ga0495582_0030950_1018_1464 | 147 |
| 316 | 3300046473 | Ga0495582_0085386 | Ga0495582_0085386_1173_1616 | 147 |
| 317 | 3300046474 | Ga0495605_0128337 | Ga0495605_0128337_230_676 | 147 |
| 318 | 3300046475 | Ga0495639_0077396 | Ga0495639_0077396_479_925 | 147 |
| 319 | 3300046477 | Ga0495664_0169338 | Ga0495664_0169338_650_1096 | 147 |
| 320 | 3300046477 | Ga0495664_0249838 | Ga0495664_0249838_11_457 | 147 |
| 321 | 3300046477 | Ga0495664_0478992 | Ga0495664_0478992_258_722 | 147 |
| 322 | 3300046491 | Ga0495584_0050207 | Ga0495584_0050207_1497_1943 | 147 |
| 323 | 3300046492 | Ga0495585_0125169 | Ga0495585_0125169_256_702 | 147 |
| 324 | 3300046500 | Ga0495596_0039387 | Ga0495596_0039387_611_1057 | 147 |
| 325 | 3300046506 | Ga0495583_0001083 | Ga0495583_0001083_1732_2178 | 147 |
| 326 | 3300046507 | Ga0495606_0366724 | Ga0495606_0366724_185_631 | 147 |
| 327 | 3300046511 | Ga0495608_0195826 | Ga0495608_0195826_517_963 | 147 |
| 328 | 3300046512 | Ga0495610_0023438 | Ga0495610_0023438_840_1286 | 147 |
| 329 | 3300046516 | Ga0495628_0018832 | Ga0495628_0018832_4504_4950 | 147 |
| 330 | 3300046517 | Ga0495630_0008047 | Ga0495630_0008047_228_674 | 147 |
| 331 | 3300046522 | Ga0495643_0000160 | Ga0495643_0000160_46424_46870 | 147 |
| 332 | 3300046524 | Ga0495648_0000019 | Ga0495648_0000019_66228_66674 | 147 |
| 333 | 3300046524 | Ga0495648_0501738 | Ga0495648_0501738_55_507 | 147 |
| 334 | 3300046528 | Ga0495642_0003905 | Ga0495642_0003905_3237_3683 | 147 |
| 335 | 3300046529 | Ga0495652_0006134 | Ga0495652_0006134_3911_4357 | 147 |
| 336 | 3300046530 | Ga0495654_0062663 | Ga0495654_0062663_806_1252 | 147 |
| 337 | 3300046531 | Ga0495665_0000015 | Ga0495665_0000015_6042_6488 | 147 |
| 338 | 3300046531 | Ga0495665_0034780 | Ga0495665_0034780_926_1372 | 147 |
| 339 | 3300046531 | Ga0495665_0475883 | Ga0495665_0475883_60_506 | 147 |
| 340 | 3300046535 | Ga0495586_0139914 | Ga0495586_0139914_543_989 | 147 |
| 341 | 3300046535 | Ga0495586_0285557 | Ga0495586_0285557_78_524 | 147 |
| 342 | 3300046538 | Ga0495609_0024578 | Ga0495609_0024578_396_842 | 147 |
| 343 | 3300046538 | Ga0495609_0024851 | Ga0495609_0024851_1725_2171 | 147 |
| 344 | 3300046542 | Ga0495597_0001887 | Ga0495597_0001887_8104_8550 | 147 |
| 345 | 3300046542 | Ga0495597_0006955 | Ga0495597_0006955_230_676 | 147 |
| 346 | 3300046543 | Ga0495645_0000238 | Ga0495645_0000238_27699_28145 | 147 |
| 347 | 3300046543 | Ga0495645_0008669 | Ga0495645_0008669_3518_3964 | 147 |
| 348 | 3300046543 | Ga0495645_0055693 | Ga0495645_0055693_1774_2220 | 147 |
| 349 | 3300046557 | Ga0495622_0000071 | Ga0495622_0000071_37330_37776 | 147 |
| 350 | 3300046558 | Ga0495633_0000077 | Ga0495633_0000077_27061_27507 | 147 |
| 351 | 3300046559 | Ga0495667_0249528 | Ga0495667_0249528_206_652 | 147 |
| 352 | 3300046615 | Ga0495656_0112847 | Ga0495656_0112847_57_503 | 147 |
| 353 | 3300046616 | Ga0495668_0698423 | Ga0495668_0698423_25_471 | 147 |
| 354 | 3300046642 | Ga0495634_0124025 | Ga0495634_0124025_104_550 | 147 |
| 355 | 3300046642 | Ga0495634_0436845 | Ga0495634_0436845_233_679 | 147 |
| 356 | 3300046660 | Ga0495625_0000447 | Ga0495625_0000447_13932_14378 | 147 |
| 357 | 3300046663 | Ga0495635_0022197 | Ga0495635_0022197_1774_2220 | 147 |
| 358 | 3300046674 | Ga0495588_0166166 | Ga0495588_0166166_69_515 | 147 |
| 359 | 3300046675 | Ga0495657_0371119 | Ga0495657_0371119_359_805 | 147 |
| 360 | 3300046678 | Ga0495599_0221932 | Ga0495599_0221932_289_735 | 147 |
| 361 | 3300046679 | Ga0495623_0004100 | Ga0495623_0004100_2239_2685 | 147 |
| 362 | 3300046679 | Ga0495623_0299521 | Ga0495623_0299521_49_495 | 147 |
| 363 | 3300046680 | Ga0495646_0000652 | Ga0495646_0000652_14406_14852 | 147 |
| 364 | 3300046680 | Ga0495646_0016576 | Ga0495646_0016576_2137_2583 | 147 |
| 365 | 3300046681 | Ga0495647_0166604 | Ga0495647_0166604_477_920 | 147 |
| 366 | 3300046683 | Ga0495658_0289957 | Ga0495658_0289957_495_938 | 147 |
| 367 | 3300046684 | Ga0495669_0176246 | Ga0495669_0176246_288_734 | 147 |
| 368 | 3300046684 | Ga0495669_0344953 | Ga0495669_0344953_263_709 | 147 |
| 369 | 3300046684 | Ga0495669_0457848 | Ga0495669_0457848_115_594 | 147 |
| 370 | 3300046689 | Ga0495613_0009049 | Ga0495613_0009049_4494_4940 | 147 |
| 371 | 3300046690 | Ga0495624_0001634 | Ga0495624_0001634_12844_13290 | 147 |
| 372 | 3300046691 | Ga0495670_0316194 | Ga0495670_0316194_277_723 | 147 |
| 373 | 3300046694 | Ga0495649_0012211 | Ga0495649_0012211_2602_3081 | 147 |
| 374 | 3300046694 | Ga0495649_0017723 | Ga0495649_0017723_1622_2068 | 147 |
| 375 | 3300046794 | Ga0495589_0003916 | Ga0495589_0003916_5567_6013 | 147 |
| 376 | 3300046794 | Ga0495589_0031567 | Ga0495589_0031567_517_996 | 147 |
| 377 | 3300046809 | Ga0495600_0101428 | Ga0495600_0101428_415_861 | 147 |
| 378 | 3300046810 | Ga0495660_0008470 | Ga0495660_0008470_4186_4632 | 147 |
| 379 | 3300046810 | Ga0495660_0086167 | Ga0495660_0086167_264_710 | 147 |
| 380 | 3300047315 | Ga0495581_0002045 | Ga0495581_0002045_5979_6425 | 147 |
| 381 | 3300047315 | Ga0495581_0094984 | Ga0495581_0094984_487_930 | 147 |
| 382 | 3300047319 | Ga0495674_0009227 | Ga0495674_0009227_5049_5513 | 147 |
| 383 | 3300047319 | Ga0495674_0020521 | Ga0495674_0020521_2890_3336 | 147 |
| 384 | 3300047319 | Ga0495674_0141015 | Ga0495674_0141015_96_542 | 147 |
| 385 | 3300047320 | Ga0495672_0020134 | Ga0495672_0020134_3249_3713 | 147 |
| 386 | 3300047322 | Ga0495680_0012736 | Ga0495680_0012736_2113_2559 | 147 |
| 387 | 3300047322 | Ga0495680_0106869 | Ga0495680_0106869_1559_2005 | 147 |
| 388 | 3300047323 | Ga0495683_0009451 | Ga0495683_0009451_4485_4931 | 147 |
| 389 | 3300047323 | Ga0495683_0073548 | Ga0495683_0073548_970_1416 | 147 |
| 390 | 3300047323 | Ga0495683_0097890 | Ga0495683_0097890_363_809 | 147 |
| 391 | 3300047443 | Ga0495687_000005 | Ga0495687_000005_283565_284011 | 147 |
| 392 | 3300047443 | Ga0495687_000172 | Ga0495687_000172_84617_85063 | 147 |
| 393 | 3300047443 | Ga0495687_007044 | Ga0495687_007044_4563_5009 | 147 |
| 394 | 3300047471 | Ga0495684_0493761 | Ga0495684_0493761_256_702 | 147 |
| 395 | 3300047472 | Ga0495686_0025442 | Ga0495686_0025442_2157_2603 | 147 |
| 396 | 3300047673 | Ga0495593_0000133 | Ga0495593_0000133_33579_34025 | 147 |
| 397 | 3300048088 | Ga0495602_0009012 | Ga0495602_0009012_2472_2918 | 147 |
| 398 | 3300048088 | Ga0495602_0113176 | Ga0495602_0113176_461_907 | 147 |
| 399 | 3300048091 | Ga0495626_0307871 | Ga0495626_0307871_82_528 | 147 |
| 400 | 3300048903 | Ga0496100_0015692 | Ga0496100_0015692_1498_1944 | 147 |
| 401 | 3300048903 | Ga0496100_0128792 | Ga0496100_0128792_747_1193 | 147 |
| 402 | 3300048903 | Ga0496100_0794018 | Ga0496100_0794018_201_647 | 147 |
| 403 | 3300048904 | Ga0496101_0012004 | Ga0496101_0012004_5215_5661 | 147 |
| 404 | 3300048904 | Ga0496101_0251968 | Ga0496101_0251968_189_632 | 147 |
| 405 | 3300048905 | Ga0496102_0022504 | Ga0496102_0022504_4407_4853 | 147 |
| 406 | 3300048905 | Ga0496102_0214240 | Ga0496102_0214240_64_528 | 147 |
| 407 | 3300048905 | Ga0496102_0596241 | Ga0496102_0596241_138_653 | 147 |
| 408 | 3300048905 | Ga0496102_1109306 | Ga0496102_1109306_228_674 | 147 |
| 409 | 3300048906 | Ga0496103_0016864 | Ga0496103_0016864_734_1180 | 147 |
| 410 | 3300048906 | Ga0496103_0224087 | Ga0496103_0224087_94_540 | 147 |
| 411 | 3300048906 | Ga0496103_0289879 | Ga0496103_0289879_341_805 | 147 |
| 412 | 3300048907 | Ga0496104_0024340 | Ga0496104_0024340_150_596 | 147 |
| 413 | 3300048908 | Ga0496105_0055448 | Ga0496105_0055448_2008_2454 | 147 |
| 414 | 3300048908 | Ga0496105_0071221 | Ga0496105_0071221_958_1401 | 147 |
| 415 | 3300048908 | Ga0496105_0091086 | Ga0496105_0091086_1960_2406 | 147 |
| 416 | 3300048909 | Ga0496106_0000927 | Ga0496106_0000927_13765_14211 | 147 |
| 417 | 3300048909 | Ga0496106_0482163 | Ga0496106_0482163_290_736 | 147 |
| 418 | 3300048910 | Ga0496107_0011986 | Ga0496107_0011986_4988_5434 | 147 |
| 419 | 3300048911 | Ga0496108_0424873 | Ga0496108_0424873_35_481 | 147 |
| 420 | 3300048912 | Ga0496109_0349456 | Ga0496109_0349456_502_948 | 147 |
| 421 | 3300048912 | Ga0496109_0499632 | Ga0496109_0499632_406_852 | 147 |
| 422 | 3300048913 | Ga0496110_0005273 | Ga0496110_0005273_2209_2655 | 147 |
| 423 | 3300048913 | Ga0496110_0177993 | Ga0496110_0177993_935_1381 | 147 |
| 424 | 3300048914 | Ga0496111_0408452 | Ga0496111_0408452_204_650 | 147 |
| 425 | 3300048915 | Ga0496112_0027280 | Ga0496112_0027280_3332_3778 | 147 |
| 426 | 3300048916 | Ga0496113_0052182 | Ga0496113_0052182_860_1306 | 147 |
| 427 | 3300048916 | Ga0496113_0311212 | Ga0496113_0311212_91_534 | 147 |
| 428 | 3300048917 | Ga0496114_0011278 | Ga0496114_0011278_4620_5066 | 147 |
| 429 | 3300048917 | Ga0496114_0111384 | Ga0496114_0111384_1271_1717 | 147 |
| 430 | 3300048917 | Ga0496114_0827189 | Ga0496114_0827189_103_549 | 147 |
| 431 | 3300048918 | Ga0496115_0105671 | Ga0496115_0105671_1489_1935 | 147 |
| 432 | 3300048919 | Ga0496116_0008625 | Ga0496116_0008625_8061_8525 | 147 |
| 433 | 3300048919 | Ga0496116_0012173 | Ga0496116_0012173_4974_5420 | 147 |
| 434 | 3300048919 | Ga0496116_0276127 | Ga0496116_0276127_291_734 | 147 |
| 435 | 3300048920 | Ga0496117_0018118 | Ga0496117_0018118_431_877 | 147 |
| 436 | 3300048920 | Ga0496117_0511245 | Ga0496117_0511245_124_570 | 147 |
| 437 | 3300048921 | Ga0496118_0000692 | Ga0496118_0000692_48968_49432 | 147 |
| 438 | 3300048921 | Ga0496118_0041023 | Ga0496118_0041023_3011_3457 | 147 |
| 439 | 3300048921 | Ga0496118_0130406 | Ga0496118_0130406_162_608 | 147 |
| 440 | 3300048922 | Ga0496119_0066367 | Ga0496119_0066367_98_541 | 147 |
| 441 | 3300048923 | Ga0496120_0199814 | Ga0496120_0199814_220_666 | 147 |
| 442 | 3300048924 | Ga0496121_0014098 | Ga0496121_0014098_7764_8210 | 147 |
| 443 | 3300048924 | Ga0496121_0132690 | Ga0496121_0132690_879_1322 | 147 |
| 444 | 3300048924 | Ga0496121_0503456 | Ga0496121_0503456_198_644 | 147 |
| 445 | 3300048924 | Ga0496121_0679145 | Ga0496121_0679145_77_523 | 147 |
| 446 | 3300048925 | Ga0496122_0022670 | Ga0496122_0022670_4763_5209 | 147 |
| 447 | 3300048927 | Ga0496124_0015110 | Ga0496124_0015110_2242_2688 | 147 |
| 448 | 3300048927 | Ga0496124_0106290 | Ga0496124_0106290_1625_2119 | 147 |
| 449 | 3300048927 | Ga0496124_0269764 | Ga0496124_0269764_32_493 | 147 |
| 450 | 3300048928 | Ga0496125_0016492 | Ga0496125_0016492_4990_5436 | 147 |
| 451 | 3300048928 | Ga0496125_0138492 | Ga0496125_0138492_1033_1479 | 147 |
| 452 | 3300048928 | Ga0496125_0322219 | Ga0496125_0322219_146_589 | 147 |
| 453 | 3300049459 | Ga0495678_013126 | Ga0495678_013126_2176_2622 | 147 |
| 454 | 3300049459 | Ga0495678_139707 | Ga0495678_139707_36_515 | 147 |
| 455 | 3300049460 | Ga0495682_0225148 | Ga0495682_0225148_40_486 | 147 |
| 456 | 3300049569 | Ga0501032_0204630 | Ga0501032_0204630_17_466 | 147 |
| 457 | 3300049570 | Ga0501033_0002576 | Ga0501033_0002576_10797_11258 | 147 |
| 458 | 3300049571 | Ga0501034_0001752 | Ga0501034_0001752_14287_14730 | 147 |
| 459 | 3300049580 | Ga0501046_0000681 | Ga0501046_0000681_23019_23480 | 147 |
| 460 | 3300049581 | Ga0501047_0169969 | Ga0501047_0169969_472_921 | 147 |
| 461 | 3300049581 | Ga0501047_0246811 | Ga0501047_0246811_340_801 | 147 |
| 462 | 3300049582 | Ga0501048_0033584 | Ga0501048_0033584_2396_2857 | 147 |
| 463 | 3300049584 | Ga0501068_0059802 | Ga0501068_0059802_616_1059 | 147 |
| 464 | 3300049585 | Ga0501069_0567032 | Ga0501069_0567032_172_615 | 147 |
| 465 | 3300049586 | Ga0501070_1027080 | Ga0501070_1027080_173_616 | 147 |
| 466 | 3300049589 | Ga0501073_0277345 | Ga0501073_0277345_608_1138 | 147 |
| 467 | 3300049744 | Ga0501083_0013438 | Ga0501083_0013438_2223_2666 | 147 |
| 468 | 3300049822 | Ga0501035_0191925 | Ga0501035_0191925_694_1137 | 147 |
| 469 | 3300049823 | Ga0501044_0004164 | Ga0501044_0004164_8953_9414 | 147 |
| 470 | 3300049823 | Ga0501044_0031553 | Ga0501044_0031553_1299_1742 | 147 |
| 471 | 3300050489 | nmdc:mga03683_111263_c1 | nmdc:mga03683_111263_c1_95_538 | 147 |
| 472 | 3300050491 | nmdc:mga00v17_1036767_c1 | nmdc:mga00v17_1036767_c1_40_483 | 147 |
| 473 | 3300050493 | nmdc:mga0k408_140244_c1 | nmdc:mga0k408_140244_c1_663_1106 | 147 |
| 474 | 3300050493 | nmdc:mga0k408_566314_c1 | nmdc:mga0k408_566314_c1_181_645 | 147 |
| 475 | 3300050494 | nmdc:mga06z11_537535_c1 | nmdc:mga06z11_537535_c1_196_639 | 147 |
| 476 | 3300050509 | nmdc:mga0qj67_209526_c1 | nmdc:mga0qj67_209526_c1_1055_1501 | 147 |
| 477 | 3300050511 | nmdc:mga08y16_148450_c1 | nmdc:mga08y16_148450_c1_39_491 | 147 |
| 478 | 3300050515 | nmdc:mga0a205_269415_c1 | nmdc:mga0a205_269415_c1_143_586 | 147 |
| 479 | 3300050516 | nmdc:mga0sz30_151384_c1 | nmdc:mga0sz30_151384_c1_46_510 | 147 |
| 480 | 3300053078 | Ga0495612_0190889 | Ga0495612_0190889_444_887 | 147 |
| 481 | 3300053161 | Ga0500634_0010102 | Ga0500634_0010102_1784_2245 | 147 |
| 482 | 3300053178 | Ga0500637_0206334 | Ga0500637_0206334_104_550 | 147 |
| 483 | 3300054114 | Ga0501084_0264337 | Ga0501084_0264337_401_931 | 147 |
| 484 | 3300061719 | Ga0466962_0011071 | Ga0466962_0011071_3884_4330 | 147 |
| 485 | 3300061734 | Ga0530510_0002166 | Ga0530510_0002166_8507_8983 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9954 | 2 | 144 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9909 | 2 | 144 |
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9883 | 2 | 144 |
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.988 | 1 | 144 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9839 | 2 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9952 | 2 | 144 | 3.30.530.20 |
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.988 | 2 | 144 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8986 | 4 | 142 | 3.30.530.20 |
| 3eliA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8682 | 3 | 139 | 3.30.530.20 |
| 2lghA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.855 | 3 | 139 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A023XIA1-F1-model_v4 | deleted | 1.002 | 1 | 147 |
|
| AF-A0A0Q6VIA6-F1-model_v4 | Toxin | 1.002 | 1 | 147 |
|
| AF-Q98IR1-F1-model_v4 | Mlr2292 protein | 1.002 | 1 | 147 |
|
| AF-A0A656Z4X0-F1-model_v4 | Polyketide cyclase | 1.002 | 18 | 147 |
|
| AF-A0A3S1ZYZ0-F1-model_v4 | deleted | 1.001 | 1 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar