F453016

General Info

Members Datasets Scaffolds Average Seq Length
484 377 968 130

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937861824|2937867277
Length 150
Sequence GRGPARLDPVMTDYDRGKRAMKIKLTSVYVDNQENALRFYTDVLGFTKKADFSNGPYRWLTVASAEEPDGTELQLALNDNPAAKAYQEAIFKQGQPAVMFFTDDVKGDYERIKAKGGAFIQPPTEATGSTIAQLNDSCGNLVQITQLARW

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
104 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
209 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
210 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
211 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
212 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
213 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
214 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
215 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
216 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
217 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
218 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
219 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
220 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
221 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
222 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
223 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
224 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
225 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
226 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
227 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
228 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
229 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
230 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
231 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
232 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
233 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
234 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
235 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
236 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
237 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
238 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
239 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
240 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
241 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
242 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
243 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
244 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
245 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
246 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
247 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
248 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
249 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
250 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
251 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
252 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
253 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
254 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
255 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
256 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
257 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
258 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
259 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
260 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
261 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
262 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
263 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
264 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
265 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
266 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
267 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
268 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
269 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
270 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
271 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
272 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
273 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
274 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
275 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
276 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
277 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
278 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
279 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
280 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
281 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
282 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
283 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
284 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
285 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
286 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
287 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
288 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
289 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
290 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
291 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
292 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
293 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
294 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
295 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
296 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
297 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
298 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
299 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
300 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
301 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
302 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
303 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
304 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
305 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
306 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
307 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
308 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
309 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
310 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
311 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
312 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
313 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
314 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
315 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
316 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
317 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
318 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
319 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
320 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
321 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
322 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
323 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
324 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
325 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
326 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
327 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
328 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
329 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
330 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
331 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
332 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
333 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
334 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
335 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
336 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
337 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
338 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
339 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
340 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
341 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
342 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
343 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
344 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
345 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
346 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
347 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
348 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
349 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
350 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
351 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
352 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
353 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
354 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
355 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
356 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
357 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
358 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
359 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
360 3004167301 Mesorhizobium loti 582 Isolate Unclassified
361 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
362 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
363 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
364 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
365 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
366 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
367 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
368 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
369 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
370 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
371 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
372 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
373 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
374 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
375 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
376 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
377 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.4
Metatranscriptomes 2.27
Isolates 35.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 32.85
Rhizoplane 1.65
Rhizosphere 53.51
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10092137 3300001979 Bacteria 781
2 JGI24735J21928_10047578 3300002067 Bacteria 1243
3 Ga0006762J43184_107771 3300002872 Bacteria 573
4 Ga0006759J45824_1020392 3300003163 Bacteria 839
5 JGI25153J46596_10040856 3300003215 Bacteria 1433
6 Ga0032354_1041803 3300003693 Bacteria 973
7 Ga0065707_10891599 3300005295 Bacteria 569
8 Ga0070658_10296456 3300005327 Bacteria 1378
9 Ga0070690_100191153 3300005330 Bacteria 1419
10 Ga0068868_102025979 3300005338 Bacteria 547
11 Ga0070660_100088171 3300005339 Bacteria 2443
12 Ga0070660_101804201 3300005339 Bacteria 521
13 Ga0070675_102091130 3300005354 Bacteria 522
14 Ga0070659_100130898 3300005366 Bacteria 2038
15 Ga0070659_100152998 3300005366 Bacteria 1883
16 Ga0070709_11208151 3300005434 Bacteria 608
17 Ga0070714_100140618 3300005435 Bacteria 2166
18 Ga0070713_100138799 3300005436 Bacteria 2151
19 Ga0070713_101178915 3300005436 Bacteria 741
20 Ga0070663_100117620 3300005455 Bacteria 2004
21 Ga0068867_100211214 3300005459 Bacteria 1559
22 Ga0070707_100803185 3300005468 Bacteria 905
23 Ga0070698_100625267 3300005471 Bacteria 1018
24 Ga0070699_100134280 3300005518 Bacteria 2182
25 Ga0070679_100070937 3300005530 Bacteria 3475
26 Ga0068853_100740715 3300005539 Bacteria 939
27 Ga0068853_100785926 3300005539 Bacteria 911
28 Ga0070686_101321070 3300005544 Bacteria 603
29 Ga0070696_100495930 3300005546 Bacteria 971
30 Ga0070665_100002081 3300005548 Bacteria 22454
31 Ga0070665_100034562 3300005548 Bacteria 5083
32 Ga0070665_100101677 3300005548 Bacteria 2878
33 Ga0070704_102313681 3300005549 Bacteria 500
34 Ga0068855_100008122 3300005563 Bacteria 12684
35 Ga0068855_100372258 3300005563 Bacteria 1570
36 Ga0068857_100295040 3300005577 Bacteria 1494
37 Ga0068854_101381639 3300005578 Bacteria 636
38 Ga0068856_100053673 3300005614 Bacteria 3974
39 Ga0068856_100332632 3300005614 Bacteria 1537
40 Ga0068851_10191222 3300005834 Bacteria 1138
41 Ga0068858_100102656 3300005842 Bacteria 2667
42 Ga0068858_100500646 3300005842 Bacteria 1174
43 Ga0068858_101804967 3300005842 Unclassified 604
44 Ga0081455_10142640 3300005937 Bacteria 1858
45 Ga0081540_1024741 3300005983 Bacteria 3476
46 Ga0081540_1197644 3300005983 Bacteria 734
47 Ga0075365_10027545 3300006038 Bacteria 3617
48 Ga0075365_10131197 3300006038 Bacteria 1734
49 Ga0075365_10495181 3300006038 Bacteria 864
50 Ga0075363_100030992 3300006048 Bacteria 2771
51 Ga0075363_100516888 3300006048 Bacteria 710
52 Ga0070716_100158454 3300006173 Bacteria 1464
53 Ga0070712_100380390 3300006175 Bacteria 1162
54 Ga0075362_10138977 3300006177 Bacteria 1160
55 Ga0075367_10007530 3300006178 Bacteria 5583
56 Ga0075367_10768216 3300006178 Bacteria 613
57 Ga0075366_10193101 3300006195 Bacteria 1237
58 Ga0075370_10198894 3300006353 Bacteria 1182
59 Ga0075370_10468542 3300006353 Bacteria 759
60 Ga0075370_10688236 3300006353 Bacteria 621
61 Ga0068871_100000626 3300006358 Bacteria 24276
62 Ga0068871_100733612 3300006358 Bacteria 907
63 Ga0075434_100034550 3300006871 Bacteria 4993
64 Ga0075434_100864752 3300006871 Bacteria 919
65 Ga0075436_100087342 3300006914 Bacteria 2166
66 Ga0075435_100021797 3300007076 Bacteria 4935
67 Ga0099794_10449377 3300007265 Bacteria 676
68 Ga0099795_10540236 3300007788 Bacteria 548
69 Ga0105240_10115309 3300009093 Bacteria 3244
70 Ga0105240_10513089 3300009093 Bacteria 1331
71 Ga0105245_10562389 3300009098 Bacteria 1163
72 Ga0105245_10683109 3300009098 Bacteria 1059
73 Ga0105245_10896608 3300009098 Bacteria 928
74 Ga0105245_11907862 3300009098 Bacteria 647
75 Ga0105247_10013717 3300009101 Bacteria 4860
76 Ga0105247_10591554 3300009101 Unclassified 821
77 Ga0105247_11230488 3300009101 Bacteria 598
78 Ga0114129_10201533 3300009147 Bacteria 2695
79 Ga0105243_11476713 3300009148 Bacteria 703
80 Ga0105241_10470173 3300009174 Bacteria 1116
81 Ga0105242_10496311 3300009176 Bacteria 1160
82 Ga0105242_11486800 3300009176 Bacteria 708
83 Ga0105248_10645982 3300009177 Bacteria 1194
84 Ga0105248_12232591 3300009177 Bacteria 623
85 Ga0105237_10002582 3300009545 Bacteria 22325
86 Ga0105238_10033516 3300009551 Bacteria 5227
87 Ga0105238_10052021 3300009551 Bacteria 4118
88 Ga0105238_10378133 3300009551 Bacteria 1407
89 Ga0105238_11479985 3300009551 Bacteria 707
90 Ga0105249_12176040 3300009553 Bacteria 627
91 Ga0105239_10005031 3300010375 Bacteria 15611
92 Ga0105239_10775497 3300010375 Bacteria 1098
93 Ga0105239_10775896 3300010375 Bacteria 1098
94 Ga0157373_10950295 3300013100 Bacteria 639
95 Ga0157378_10411514 3300013297 Bacteria 1335
96 Ga0163162_11851707 3300013306 Bacteria 690
97 Ga0157375_10563951 3300013308 Bacteria 1300
98 Ga0157375_11087314 3300013308 Bacteria 936
99 Ga0157379_10543857 3300014968 Bacteria 1080
100 Ga0157376_10072383 3300014969 Bacteria 2932
101 Ga0157376_10339464 3300014969 Bacteria 1434
102 Ga0157376_10956637 3300014969 Bacteria 877
103 Ga0163161_11342154 3300017792 Bacteria 623
104 Ga0206350_11287543 3300020080 Unclassified 534
105 Ga0213874_10104050 3300021377 Unclassified 947
106 Ga0213876_10106378 3300021384 Bacteria 1489
107 Ga0213875_10542100 3300021388 Bacteria 560
108 Ga0224569_109283 3300022732 Bacteria 699
109 Ga0209233_1000028 3300025261 Bacteria 642062
110 Ga0209758_1008925 3300025297 Bacteria 6361
111 Ga0207656_10151769 3300025321 Bacteria 1097
112 Ga0207647_10003549 3300025904 Bacteria 11706
113 Ga0207647_10233820 3300025904 Bacteria 1057
114 Ga0207699_10505248 3300025906 Bacteria 873
115 Ga0207699_10621227 3300025906 Bacteria 788
116 Ga0207705_10001777 3300025909 Bacteria 17014
117 Ga0207705_10093120 3300025909 Bacteria 2209
118 Ga0207671_10003373 3300025914 Bacteria 15993
119 Ga0207693_10210904 3300025915 Bacteria 1527
120 Ga0207693_10562482 3300025915 Bacteria 889
121 Ga0207657_10001831 3300025919 Bacteria 22955
122 Ga0207657_10652377 3300025919 Bacteria 819
123 Ga0207652_10059335 3300025921 Bacteria 3298
124 Ga0207694_10053368 3300025924 Bacteria 3134
125 Ga0207694_10168381 3300025924 Bacteria 1773
126 Ga0207694_10660918 3300025924 Bacteria 881
127 Ga0207694_11656720 3300025924 Bacteria 539
128 Ga0207687_10134473 3300025927 Bacteria 1868
129 Ga0207687_10486315 3300025927 Bacteria 1028
130 Ga0207700_10144482 3300025928 Bacteria 1959
131 Ga0207700_10637076 3300025928 Bacteria 950
132 Ga0207664_10254408 3300025929 Bacteria 1534
133 Ga0207664_10753933 3300025929 Bacteria 875
134 Ga0207690_10124982 3300025932 Bacteria 1874
135 Ga0207665_10137517 3300025939 Bacteria 1740
136 Ga0207711_10359016 3300025941 Bacteria 1350
137 Ga0207711_10591409 3300025941 Bacteria 1035
138 Ga0207689_10443618 3300025942 Bacteria 1084
139 Ga0207667_10011897 3300025949 Bacteria 10078
140 Ga0207667_10197159 3300025949 Bacteria 2066
141 Ga0207640_11148242 3300025981 Bacteria 689
142 Ga0207703_10266810 3300026035 Bacteria 1549
143 Ga0207703_10493370 3300026035 Bacteria 1149
144 Ga0207703_11073689 3300026035 Bacteria 773
145 Ga0207703_11999003 3300026035 Bacteria 556
146 Ga0207639_10163723 3300026041 Bacteria 1877
147 Ga0207639_10479131 3300026041 Bacteria 1134
148 Ga0207639_10592661 3300026041 Bacteria 1021
149 Ga0207639_11780915 3300026041 Bacteria 576
150 Ga0207678_10028660 3300026067 Bacteria 4859
151 Ga0207678_10141472 3300026067 Bacteria 2053
152 Ga0207702_10308779 3300026078 Bacteria 1503
153 Ga0207648_10431822 3300026089 Bacteria 1197
154 Ga0207648_12282348 3300026089 Bacteria 502
155 Ga0207674_10069130 3300026116 Bacteria 3552
156 Ga0207675_100993401 3300026118 Bacteria 857
157 Ga0207698_10140793 3300026142 Bacteria 2078
158 Ga0207698_10584508 3300026142 Bacteria 1099
159 Ga0209974_10066617 3300027876 Bacteria 1224
160 Ga0265356_1011643 3300028017 Bacteria 971
161 Ga0265355_1005624 3300028036 Bacteria 966
162 Ga0268266_10000677 3300028379 Bacteria 46024
163 Ga0268266_10020817 3300028379 Bacteria 5593
164 Ga0268266_10037869 3300028379 Bacteria 4106
165 Ga0265318_10010201 3300028577 Bacteria 4101
166 Ga0265318_10194261 3300028577 Bacteria 742
167 Ga0265323_10075744 3300028653 Bacteria 1143
168 Ga0265760_10001912 3300031090 Bacteria 6114
169 Ga0265760_10104323 3300031090 Bacteria 898
170 Ga0265760_10143238 3300031090 Bacteria 780
171 Ga0265330_10044035 3300031235 Bacteria 1972
172 Ga0265332_10033725 3300031238 Bacteria 2228
173 Ga0265328_10076326 3300031239 Bacteria 1233
174 Ga0265325_10128854 3300031241 Bacteria 1213
175 Ga0265329_10328021 3300031242 Bacteria 521
176 Ga0265339_10103967 3300031249 Bacteria 1475
177 Ga0265339_10115410 3300031249 Bacteria 1385
178 Ga0265339_10143699 3300031249 Bacteria 1212
179 Ga0265331_10165878 3300031250 Bacteria 1000
180 Ga0265316_10004511 3300031344 Bacteria 13833
181 Ga0265316_10401661 3300031344 Bacteria 987
182 Ga0307513_10318937 3300031456 Bacteria 1313
183 Ga0265313_10010943 3300031595 Bacteria 5684
184 Ga0265314_10248108 3300031711 Bacteria 1023
185 Ga0265314_10251007 3300031711 Bacteria 1016
186 Ga0307405_11680149 3300031731 Bacteria 562
187 Ga0307406_11721190 3300031901 Bacteria 556
188 Ga0307407_11475251 3300031903 Bacteria 537
189 Ga0307416_100162964 3300032002 Bacteria 2064
190 Ga0373948_0209926 3300034817 Bacteria 511
191 Ga0373934_0204723 3300035086 Bacteria 813
192 Ga0373936_0114623 3300035113 Bacteria 1147
193 Ga0373943_0101359 3300035170 Bacteria 1506
194 Ga0373947_0589187 3300035725 Bacteria 758
195 Ga0395900_0466963 3300037418 Bacteria 1216
196 Ga0395900_0721111 3300037418 Bacteria 929
197 Ga0395900_0961977 3300037418 Bacteria 775
198 Ga0395905_0016581 3300037471 Bacteria 7002
199 Ga0395905_0027438 3300037471 Bacteria 5370
200 Ga0395905_0620799 3300037471 Bacteria 983
201 Ga0436364_0002033 3300037853 Bacteria 506
202 Ga0436364_0015656 3300037853 Bacteria 2042
203 Ga0436364_0153115 3300037853 Bacteria 1412
204 Ga0436364_0500990 3300037853 Bacteria 2436
205 Ga0436364_1367405 3300037853 Bacteria 6939
206 Ga0436364_1500540 3300037853 Bacteria 611
207 Ga0395901_0022706 3300038443 Bacteria 6433
208 Ga0395901_0686157 3300038443 Bacteria 1023
209 Ga0395901_0793050 3300038443 Unclassified 937
210 Ga0395901_1093345 3300038443 Bacteria 768
211 Ga0436365_1223310 3300039437 Bacteria 1725
212 Ga0436365_1887675 3300039437 Bacteria 2165
213 Ga0436361_0234853 3300039447 Bacteria 623
214 Ga0436363_0494209 3300039450 Unclassified 836
215 Ga0436363_0548579 3300039450 Bacteria 806
216 Ga0436363_1072018 3300039450 Bacteria 1012
217 Ga0436362_1254551 3300039453 Bacteria 987
218 Ga0451807_1733467 3300041486 Bacteria 518
219 Ga0451837_1205308 3300041494 Bacteria 691
220 Ga0451843_0568285 3300041509 Bacteria 677
221 Ga0466972_0017816 3300044658 Bacteria 3554
222 Ga0466968_0050183 3300044735 Bacteria 1780
223 Ga0466960_0009252 3300044901 Bacteria 4057
224 Ga0466967_0435800 3300045976 Bacteria 1279
225 Ga0495603_0156127 3300046455 Bacteria 1324
226 Ga0495629_0310886 3300046459 Bacteria 1078
227 Ga0495629_0440902 3300046459 Bacteria 882
228 Ga0495629_0453687 3300046459 Bacteria 868
229 Ga0495641_0337862 3300046461 Bacteria 680
230 Ga0495580_0014710 3300046472 Bacteria 5931
231 Ga0495582_0046539 3300046473 Bacteria 2389
232 Ga0495639_0139638 3300046475 Bacteria 1164
233 Ga0495662_0040153 3300046476 Bacteria 2260
234 Ga0495606_0007401 3300046507 Bacteria 9843
235 Ga0495608_0825241 3300046511 Bacteria 546
236 Ga0495618_0800778 3300046514 Bacteria 549
237 Ga0495665_0158612 3300046531 Bacteria 1180
238 Ga0495640_0051614 3300046533 Bacteria 2826
239 Ga0495640_0478749 3300046533 Bacteria 759
240 Ga0495586_0186195 3300046535 Bacteria 1175
241 Ga0495668_0110857 3300046616 Bacteria 1501
242 Ga0495634_0020786 3300046642 Bacteria 4650
243 Ga0495625_0022295 3300046660 Bacteria 4859
244 Ga0495635_0736938 3300046663 Bacteria 637
245 Ga0495647_0027946 3300046681 Bacteria 2077
246 Ga0495647_0628681 3300046681 Unclassified 505
247 Ga0495658_0025134 3300046683 Bacteria 3181
248 Ga0495658_0049136 3300046683 Bacteria 2382
249 Ga0495624_0129344 3300046690 Bacteria 1549
250 Ga0495624_0932621 3300046690 Bacteria 510
251 Ga0495600_0883456 3300046809 Bacteria 528
252 Ga0495604_0005116 3300047317 Bacteria 10380
253 Ga0495674_0422128 3300047319 Bacteria 1074
254 Ga0495684_0027880 3300047471 Bacteria 4338
255 Ga0495684_0777674 3300047471 Bacteria 628
256 Ga0495614_0078578 3300048089 Bacteria 1428
257 Ga0496102_0549235 3300048905 Bacteria 1078
258 Ga0496108_1161482 3300048911 Bacteria 654
259 Ga0496109_1513962 3300048912 Bacteria 606
260 Ga0496111_0852763 3300048914 Bacteria 658
261 Ga0496112_0413537 3300048915 Bacteria 1288
262 Ga0496115_0504158 3300048918 Bacteria 972
263 Ga0496121_0023145 3300048924 Bacteria 5997
264 Ga0496126_0004395 3300048929 Bacteria 16896
265 Ga0501031_0202310 3300049568 Bacteria 1296
266 Ga0501032_0331269 3300049569 Bacteria 982
267 Ga0501034_0338943 3300049571 Bacteria 1434
268 Ga0501034_0608053 3300049571 Unclassified 998
269 Ga0501034_1681448 3300049571 Bacteria 507
270 Ga0501037_0028197 3300049573 Bacteria 4148
271 Ga0501067_0054254 3300049583 Bacteria 2221
272 Ga0501076_0144336 3300049592 Bacteria 1935
273 Ga0501077_0805114 3300049593 Bacteria 604
274 Ga0501035_0382772 3300049822 Bacteria 1173
275 Ga0501044_0706648 3300049823 Bacteria 893
276 Ga0501044_1260247 3300049823 Bacteria 606
277 nmdc:mga03683_123728_c1 3300050489 Bacteria 1152
278 nmdc:mga03683_38989_c1 3300050489 Bacteria 1343
279 nmdc:mga03n38_173147_c1 3300050490 Bacteria 1101
280 nmdc:mga03n38_31248_c1 3300050490 Bacteria 2245
281 nmdc:mga0yw44_1358_c2 3300050492 Bacteria 3798
282 nmdc:mga0yw44_136862_c1 3300050492 Bacteria 1590
283 nmdc:mga0yw44_248239_c1 3300050492 Bacteria 1184
284 nmdc:mga0yw44_31499_c1 3300050492 Bacteria 3084
285 nmdc:mga0yw44_40628_c1 3300050492 Bacteria 2765
286 nmdc:mga06z11_176173_c1 3300050494 Bacteria 1231
287 nmdc:mga06z11_328618_c1 3300050494 Bacteria 913
288 nmdc:mga04h51_68868_c1 3300050495 Bacteria 1231
289 nmdc:mga07m45_45562_c1 3300050496 Bacteria 1877
290 nmdc:mga05p37_633341_c1 3300050507 Bacteria 1201
291 nmdc:mga0n895_1097540_c1 3300050512 Bacteria 773
292 nmdc:mga0n895_214402_c1 3300050512 Bacteria 1955
293 nmdc:mga0n895_278083_c1 3300050512 Bacteria 1698
294 nmdc:mga0n895_425165_c1 3300050512 Bacteria 1343
295 nmdc:mga0rr50_3523_c1 3300050513 Bacteria 9028
296 nmdc:mga08x19_19725_c1 3300050514 Bacteria 4142
297 nmdc:mga08x19_201130_c1 3300050514 Bacteria 1366
298 nmdc:mga08x19_432478_c1 3300050514 Bacteria 925
299 nmdc:mga0a205_7904_c1 3300050515 Bacteria 9658
300 nmdc:mga0sz30_34186_c1 3300050516 Bacteria 1363
301 Ga0495601_0003741 3300053077 Bacteria 8753
302 Ga0495601_0762410 3300053077 Bacteria 615
303 Ga0495619_0020852 3300053085 Bacteria 4180
304 Ga0495619_0251284 3300053085 Bacteria 1225
305 Ga0495619_0835997 3300053085 Bacteria 622
306 Ga0500604_0128748 3300053151 Bacteria 850
307 Ga0500627_0052322 3300053158 Bacteria 1782
308 Ga0501084_1052527 3300054114 Bacteria 683
309 Ga0587088_020231 3300059508 Bacteria 1102
310 Ga0587113_033302 3300059625 Bacteria 593
311 Ga0587072_026733 3300059643 Bacteria 1056
312 Ga0587114_010862 3300059655 Bacteria 1122
313 Ga0501082_1236449 3300060353 Bacteria 653
314 2937867277 2937861824 Bacteria 6660327
315 2509118770 2508501123 Bacteria 6283661
316 2509367552 2509276018 Bacteria 6910194
317 2510313665 2510065059 Bacteria 6847884
318 2513608862 2513237090 Bacteria 7096802
319 2514420155 2513237305 Bacteria 7293571
320 2599939743 2599185301 Bacteria 6161860
321 2644158510 2643221627 Bacteria 6761570
322 2688598720 2687453392 Bacteria 6880454
323 2694628888 2693429783 Bacteria 7019804
324 2723575670 2721755686 Bacteria 7343952
325 2756675971 2756170246 Bacteria 7451806
326 2792749529 2791355123 Bacteria 8049106
327 2844007137 2844002411 Bacteria 7168230
328 2856331376 2856328259 Bacteria 6528202
329 2856339356 2856334872 Bacteria 7037011
330 2856362231 2856356410 Bacteria 6297484
331 2856366979 2856364286 Bacteria 6939991
332 2857352136 2857349434 Bacteria 7926032
333 2857371865 2857367948 Bacteria 6965560
334 2869175455 2869169390 Bacteria 6659796
335 2869237994 2869234852 Bacteria 6654993
336 2869249125 2869242130 Bacteria 6609239
337 2869255006 2869249662 Bacteria 6868783
338 2869264080 2869256925 Bacteria 6981691
339 2869265936 2869264136 Bacteria 6880765
340 2869272419 2869271264 Bacteria 6908218
341 2869283540 2869278585 Bacteria 7077053
342 2869289060 2869285874 Bacteria 6901219
343 2871432229 2871429161 Bacteria 6547891
344 2871439928 2871435913 Bacteria 6880295
345 2871452236 2871451962 Bacteria 7336357
346 2871460742 2871459585 Bacteria 6866887
347 2871468378 2871466892 Bacteria 6923287
348 2871487030 2871481445 Bacteria 6700002
349 2871488955 2871488783 Bacteria 6929816
350 2874116181 2874109183 Bacteria 6517025
351 2874120302 2874116593 Bacteria 6674494
352 2874136350 2874131515 Bacteria 6820270
353 2874143771 2874139085 Bacteria 7021506
354 2874151240 2874146452 Bacteria 7533118
355 2874158874 2874155637 Bacteria 6724144
356 2874164367 2874162495 Bacteria 6174670
357 2874174517 2874168670 Bacteria 8062617
358 2876373119 2876369609 Bacteria 6807521
359 2876378193 2876377896 Bacteria 6565995
360 2876392447 2876386047 Bacteria 6698674
361 2876405923 2876399893 Bacteria 6927900
362 2876407219 2876406927 Bacteria 6191900
363 2876417293 2876413966 Bacteria 6831344
364 2876427526 2876420981 Bacteria 6687741
365 2878738289 2878730984 Bacteria 6380721
366 2878739033 2878738818 Bacteria 7136951
367 2878749006 2878745973 Bacteria 6867388
368 2878753717 2878753008 Bacteria 6922523
369 2878778833 2878774303 Bacteria 6108671
370 2878788435 2878781027 Bacteria 6834456
371 2881846530 2881845957 Bacteria 6611900
372 2881867175 2881861095 Bacteria 7128710
373 2882636555 2882632389 Bacteria 8154593
374 2882919637 2882912400 Bacteria 6801539
375 2885313920 2885312484 Bacteria 6415165
376 2885324173 2885318864 Bacteria 6729568
377 2888338979 2888337043 Bacteria 6629336
378 2889016429 2889010040 Bacteria 6749192
379 2889018546 2889016732 Bacteria 6700763
380 2889796008 2889790730 Bacteria 5689708
381 2889920059 2889914905 Bacteria 5702301
382 2903495614 2903492973 Bacteria 13473544
383 2903503408 2903492973 Bacteria 13473544
384 2906311300 2906308376 Bacteria 6841989
385 2906324076 2906321335 Bacteria 6579571
386 2906370638 2906363423 Bacteria 6856682
387 2906371656 2906370794 Bacteria 6881062
388 2906385397 2906378014 Bacteria 6911440
389 2906388750 2906386501 Bacteria 5977019
390 2906395358 2906393657 Bacteria 6790866
391 2906401808 2906401398 Bacteria 6693206
392 2906412185 2906408224 Bacteria 6162342
393 2906428491 2906427513 Bacteria 6375796
394 2922151389 2922151315 Bacteria 6902399
395 2922174520 2922172374 Bacteria 6167644
396 2922179071 2922178524 Bacteria 6025201
397 2924718027 2924710171 Bacteria 6752351
398 2924739437 2924733363 Bacteria 7574837
399 2924741947 2924741084 Bacteria 6661321
400 2924753961 2924748358 Bacteria 6154725
401 2924776395 2924776078 Bacteria 7492003
402 2924789931 2924784321 Bacteria 7416538
403 2937816982 2937813078 Bacteria 7783518
404 2937875103 2937868953 Bacteria 6639878
405 2937884152 2937877337 Bacteria 7246526
406 2937979746 2937972304 Bacteria 7532020
407 2937986495 2937980651 Bacteria 6517427
408 2938019986 2938014810 Bacteria 6700592
409 2958040052 2958034702 Bacteria 6989922
410 2958054396 2958041894 Bacteria 13082850
411 2958065301 2958064165 Bacteria 7158582
412 2958091463 2958084443 Bacteria 7312792
413 2958093949 2958092219 Bacteria 6861151
414 2958107110 2958100919 Bacteria 6800575
415 2958110829 2958108152 Bacteria 6681128
416 2958125805 2958122699 Bacteria 7280457
417 2958133390 2958130278 Bacteria 6897202
418 2958144056 2958137437 Bacteria 6050276
419 2958147669 2958144490 Bacteria 6677056
420 2958158058 2958158011 Bacteria 6058449
421 2958177913 2958172287 Bacteria 6716688
422 2958183053 2958179912 Bacteria 6874908
423 2961081017 2961077736 Bacteria 7079850
424 2961140758 2961136820 Bacteria 6775228
425 2961170905 2961170736 Bacteria 7072258
426 2961184602 2961183825 Bacteria 6688536
427 2965026434 2965025482 Bacteria 6532201
428 2965036382 2965032056 Bacteria 6887443
429 2965041621 2965040258 Bacteria 6855979
430 2965049666 2965047637 Bacteria 6623551
431 2965091125 2965089291 Bacteria 6866420
432 2965106922 2965102966 Bacteria 6800987
433 2965113901 2965110997 Bacteria 6693150
434 2965125065 2965119406 Bacteria 6956431
435 2968003484 2967996073 Bacteria 6787468
436 2968004251 2968003550 Bacteria 6929263
437 2970495622 2970489779 Bacteria 6517260
438 2970503495 2970503327 Bacteria 7099517
439 2970517702 2970510686 Bacteria 7006402
440 2970533008 2970532167 Bacteria 6553173
441 2970549359 2970547951 Bacteria 6931819
442 2970598035 2970593180 Bacteria 7073582
443 2970619566 2970619444 Bacteria 6986144
444 2970633615 2970627176 Bacteria 6680862
445 2977822932 2977821940 Bacteria 6906439
446 2977832606 2977828996 Bacteria 7007971
447 2977847273 2977843712 Bacteria 6753583
448 2977857094 2977851361 Bacteria 6694324
449 2977877411 2977872689 Bacteria 7270173
450 2977903304 2977898635 Bacteria 6675551
451 2977912944 2977907340 Bacteria 6577984
452 2977917497 2977915119 Bacteria 6829656
453 2977941372 2977935797 Bacteria 6252826
454 2977945093 2977942078 Bacteria 7570577
455 2977951188 2977950692 Bacteria 6893264
456 2977960109 2977957713 Bacteria 6877875
457 2979715306 2979710463 Bacteria 6785254
458 2979770990 2979764755 Bacteria 6610066
459 2979773766 2979772303 Bacteria 6618277
460 2979796600 2979793036 Bacteria 6808957
461 2979815724 2979808191 Bacteria 7179355
462 2987639320 2987636660 Bacteria 8088555
463 2987651380 2987645492 Bacteria 6117018
464 2987677002 2987673487 Bacteria 6884027
465 2996356532 2996348954 Bacteria 7239054
466 2996389931 2996386984 Bacteria 6978667
467 3004169209 3004167301 Bacteria 8330599
468 3004200621 3004195979 Bacteria 6776956
469 3004204436 3004203850 Bacteria 7307914
470 3004241513 3004239961 Bacteria 6892290
471 3004253343 3004248173 Bacteria 6563236
472 3004268813 3004268573 Bacteria 7043476
473 3004282835 3004275668 Bacteria 7114440
474 3004294245 3004289098 Bacteria 6135450
475 649873237 649633066 Bacteria 6690028
476 8004306638 8004300914 Bacteria 6132239
477 8004317211 8004312739 Bacteria 7444653
478 8004362808 8004361976 Bacteria 6858373
479 8004375288 8004374579 Bacteria 6898112
480 8004391921 8004387939 Bacteria 7049250
481 8004643402 8004640170 Bacteria 6723001
482 8004700965 8004695233 Bacteria 6731676
483 8004717614 8004714634 Bacteria 6776161
484 8004731929 8004727605 Bacteria 6643904
485 JGI24740J21852_10092137
486 JGI24735J21928_10047578
487 Ga0006762J43184_107771
488 Ga0006759J45824_1020392
489 JGI25153J46596_10040856
490 Ga0032354_1041803
491 Ga0065707_10891599
492 Ga0070658_10296456
493 Ga0070690_100191153
494 Ga0068868_102025979
495 Ga0070660_100088171
496 Ga0070660_101804201
497 Ga0070675_102091130
498 Ga0070659_100130898
499 Ga0070659_100152998
500 Ga0070709_11208151
501 Ga0070714_100140618
502 Ga0070713_100138799
503 Ga0070713_101178915
504 Ga0070663_100117620
505 Ga0068867_100211214
506 Ga0070707_100803185
507 Ga0070698_100625267
508 Ga0070699_100134280
509 Ga0070679_100070937
510 Ga0068853_100740715
511 Ga0068853_100785926
512 Ga0070686_101321070
513 Ga0070696_100495930
514 Ga0070665_100002081
515 Ga0070665_100034562
516 Ga0070665_100101677
517 Ga0070704_102313681
518 Ga0068855_100008122
519 Ga0068855_100372258
520 Ga0068857_100295040
521 Ga0068854_101381639
522 Ga0068856_100053673
523 Ga0068856_100332632
524 Ga0068851_10191222
525 Ga0068858_100102656
526 Ga0068858_100500646
527 Ga0068858_101804967
528 Ga0081455_10142640
529 Ga0081540_1024741
530 Ga0081540_1197644
531 Ga0075365_10027545
532 Ga0075365_10131197
533 Ga0075365_10495181
534 Ga0075363_100030992
535 Ga0075363_100516888
536 Ga0070716_100158454
537 Ga0070712_100380390
538 Ga0075362_10138977
539 Ga0075367_10007530
540 Ga0075367_10768216
541 Ga0075366_10193101
542 Ga0075370_10198894
543 Ga0075370_10468542
544 Ga0075370_10688236
545 Ga0068871_100000626
546 Ga0068871_100733612
547 Ga0075434_100034550
548 Ga0075434_100864752
549 Ga0075436_100087342
550 Ga0075435_100021797
551 Ga0099794_10449377
552 Ga0099795_10540236
553 Ga0105240_10115309
554 Ga0105240_10513089
555 Ga0105245_10562389
556 Ga0105245_10683109
557 Ga0105245_10896608
558 Ga0105245_11907862
559 Ga0105247_10013717
560 Ga0105247_10591554
561 Ga0105247_11230488
562 Ga0114129_10201533
563 Ga0105243_11476713
564 Ga0105241_10470173
565 Ga0105242_10496311
566 Ga0105242_11486800
567 Ga0105248_10645982
568 Ga0105248_12232591
569 Ga0105237_10002582
570 Ga0105238_10033516
571 Ga0105238_10052021
572 Ga0105238_10378133
573 Ga0105238_11479985
574 Ga0105249_12176040
575 Ga0105239_10005031
576 Ga0105239_10775497
577 Ga0105239_10775896
578 Ga0157373_10950295
579 Ga0157378_10411514
580 Ga0163162_11851707
581 Ga0157375_10563951
582 Ga0157375_11087314
583 Ga0157379_10543857
584 Ga0157376_10072383
585 Ga0157376_10339464
586 Ga0157376_10956637
587 Ga0163161_11342154
588 Ga0206350_11287543
589 Ga0213874_10104050
590 Ga0213876_10106378
591 Ga0213875_10542100
592 Ga0224569_109283
593 Ga0209233_1000028
594 Ga0209758_1008925
595 Ga0207656_10151769
596 Ga0207647_10003549
597 Ga0207647_10233820
598 Ga0207699_10505248
599 Ga0207699_10621227
600 Ga0207705_10001777
601 Ga0207705_10093120
602 Ga0207671_10003373
603 Ga0207693_10210904
604 Ga0207693_10562482
605 Ga0207657_10001831
606 Ga0207657_10652377
607 Ga0207652_10059335
608 Ga0207694_10053368
609 Ga0207694_10168381
610 Ga0207694_10660918
611 Ga0207694_11656720
612 Ga0207687_10134473
613 Ga0207687_10486315
614 Ga0207700_10144482
615 Ga0207700_10637076
616 Ga0207664_10254408
617 Ga0207664_10753933
618 Ga0207690_10124982
619 Ga0207665_10137517
620 Ga0207711_10359016
621 Ga0207711_10591409
622 Ga0207689_10443618
623 Ga0207667_10011897
624 Ga0207667_10197159
625 Ga0207640_11148242
626 Ga0207703_10266810
627 Ga0207703_10493370
628 Ga0207703_11073689
629 Ga0207703_11999003
630 Ga0207639_10163723
631 Ga0207639_10479131
632 Ga0207639_10592661
633 Ga0207639_11780915
634 Ga0207678_10028660
635 Ga0207678_10141472
636 Ga0207702_10308779
637 Ga0207648_10431822
638 Ga0207648_12282348
639 Ga0207674_10069130
640 Ga0207675_100993401
641 Ga0207698_10140793
642 Ga0207698_10584508
643 Ga0209974_10066617
644 Ga0265356_1011643
645 Ga0265355_1005624
646 Ga0268266_10000677
647 Ga0268266_10020817
648 Ga0268266_10037869
649 Ga0265318_10010201
650 Ga0265318_10194261
651 Ga0265323_10075744
652 Ga0265760_10001912
653 Ga0265760_10104323
654 Ga0265760_10143238
655 Ga0265330_10044035
656 Ga0265332_10033725
657 Ga0265328_10076326
658 Ga0265325_10128854
659 Ga0265329_10328021
660 Ga0265339_10103967
661 Ga0265339_10115410
662 Ga0265339_10143699
663 Ga0265331_10165878
664 Ga0265316_10004511
665 Ga0265316_10401661
666 Ga0307513_10318937
667 Ga0265313_10010943
668 Ga0265314_10248108
669 Ga0265314_10251007
670 Ga0307405_11680149
671 Ga0307406_11721190
672 Ga0307407_11475251
673 Ga0307416_100162964
674 Ga0373948_0209926
675 Ga0373934_0204723
676 Ga0373936_0114623
677 Ga0373943_0101359
678 Ga0373947_0589187
679 Ga0395900_0466963
680 Ga0395900_0721111
681 Ga0395900_0961977
682 Ga0395905_0016581
683 Ga0395905_0027438
684 Ga0395905_0620799
685 Ga0436364_0002033
686 Ga0436364_0015656
687 Ga0436364_0153115
688 Ga0436364_0500990
689 Ga0436364_1367405
690 Ga0436364_1500540
691 Ga0395901_0022706
692 Ga0395901_0686157
693 Ga0395901_0793050
694 Ga0395901_1093345
695 Ga0436365_1223310
696 Ga0436365_1887675
697 Ga0436361_0234853
698 Ga0436363_0494209
699 Ga0436363_0548579
700 Ga0436363_1072018
701 Ga0436362_1254551
702 Ga0451807_1733467
703 Ga0451837_1205308
704 Ga0451843_0568285
705 Ga0466972_0017816
706 Ga0466968_0050183
707 Ga0466960_0009252
708 Ga0466967_0435800
709 Ga0495603_0156127
710 Ga0495629_0310886
711 Ga0495629_0440902
712 Ga0495629_0453687
713 Ga0495641_0337862
714 Ga0495580_0014710
715 Ga0495582_0046539
716 Ga0495639_0139638
717 Ga0495662_0040153
718 Ga0495606_0007401
719 Ga0495608_0825241
720 Ga0495618_0800778
721 Ga0495665_0158612
722 Ga0495640_0051614
723 Ga0495640_0478749
724 Ga0495586_0186195
725 Ga0495668_0110857
726 Ga0495634_0020786
727 Ga0495625_0022295
728 Ga0495635_0736938
729 Ga0495647_0027946
730 Ga0495647_0628681
731 Ga0495658_0025134
732 Ga0495658_0049136
733 Ga0495624_0129344
734 Ga0495624_0932621
735 Ga0495600_0883456
736 Ga0495604_0005116
737 Ga0495674_0422128
738 Ga0495684_0027880
739 Ga0495684_0777674
740 Ga0495614_0078578
741 Ga0496102_0549235
742 Ga0496108_1161482
743 Ga0496109_1513962
744 Ga0496111_0852763
745 Ga0496112_0413537
746 Ga0496115_0504158
747 Ga0496121_0023145
748 Ga0496126_0004395
749 Ga0501031_0202310
750 Ga0501032_0331269
751 Ga0501034_0338943
752 Ga0501034_0608053
753 Ga0501034_1681448
754 Ga0501037_0028197
755 Ga0501067_0054254
756 Ga0501076_0144336
757 Ga0501077_0805114
758 Ga0501035_0382772
759 Ga0501044_0706648
760 Ga0501044_1260247
761 nmdc:mga03683_123728_c1
762 nmdc:mga03683_38989_c1
763 nmdc:mga03n38_173147_c1
764 nmdc:mga03n38_31248_c1
765 nmdc:mga0yw44_1358_c2
766 nmdc:mga0yw44_136862_c1
767 nmdc:mga0yw44_248239_c1
768 nmdc:mga0yw44_31499_c1
769 nmdc:mga0yw44_40628_c1
770 nmdc:mga06z11_176173_c1
771 nmdc:mga06z11_328618_c1
772 nmdc:mga04h51_68868_c1
773 nmdc:mga07m45_45562_c1
774 nmdc:mga05p37_633341_c1
775 nmdc:mga0n895_1097540_c1
776 nmdc:mga0n895_214402_c1
777 nmdc:mga0n895_278083_c1
778 nmdc:mga0n895_425165_c1
779 nmdc:mga0rr50_3523_c1
780 nmdc:mga08x19_19725_c1
781 nmdc:mga08x19_201130_c1
782 nmdc:mga08x19_432478_c1
783 nmdc:mga0a205_7904_c1
784 nmdc:mga0sz30_34186_c1
785 Ga0495601_0003741
786 Ga0495601_0762410
787 Ga0495619_0020852
788 Ga0495619_0251284
789 Ga0495619_0835997
790 Ga0500604_0128748
791 Ga0500627_0052322
792 Ga0501084_1052527
793 Ga0587088_020231
794 Ga0587113_033302
795 Ga0587072_026733
796 Ga0587114_010862
797 Ga0501082_1236449
798 2937867277
799 2509118770
800 2509367552
801 2510313665
802 2513608862
803 2514420155
804 2599939743
805 2644158510
806 2688598720
807 2694628888
808 2723575670
809 2756675971
810 2792749529
811 2844007137
812 2856331376
813 2856339356
814 2856362231
815 2856366979
816 2857352136
817 2857371865
818 2869175455
819 2869237994
820 2869249125
821 2869255006
822 2869264080
823 2869265936
824 2869272419
825 2869283540
826 2869289060
827 2871432229
828 2871439928
829 2871452236
830 2871460742
831 2871468378
832 2871487030
833 2871488955
834 2874116181
835 2874120302
836 2874136350
837 2874143771
838 2874151240
839 2874158874
840 2874164367
841 2874174517
842 2876373119
843 2876378193
844 2876392447
845 2876405923
846 2876407219
847 2876417293
848 2876427526
849 2878738289
850 2878739033
851 2878749006
852 2878753717
853 2878778833
854 2878788435
855 2881846530
856 2881867175
857 2882636555
858 2882919637
859 2885313920
860 2885324173
861 2888338979
862 2889016429
863 2889018546
864 2889796008
865 2889920059
866 2903495614
867 2903503408
868 2906311300
869 2906324076
870 2906370638
871 2906371656
872 2906385397
873 2906388750
874 2906395358
875 2906401808
876 2906412185
877 2906428491
878 2922151389
879 2922174520
880 2922179071
881 2924718027
882 2924739437
883 2924741947
884 2924753961
885 2924776395
886 2924789931
887 2937816982
888 2937875103
889 2937884152
890 2937979746
891 2937986495
892 2938019986
893 2958040052
894 2958054396
895 2958065301
896 2958091463
897 2958093949
898 2958107110
899 2958110829
900 2958125805
901 2958133390
902 2958144056
903 2958147669
904 2958158058
905 2958177913
906 2958183053
907 2961081017
908 2961140758
909 2961170905
910 2961184602
911 2965026434
912 2965036382
913 2965041621
914 2965049666
915 2965091125
916 2965106922
917 2965113901
918 2965125065
919 2968003484
920 2968004251
921 2970495622
922 2970503495
923 2970517702
924 2970533008
925 2970549359
926 2970598035
927 2970619566
928 2970633615
929 2977822932
930 2977832606
931 2977847273
932 2977857094
933 2977877411
934 2977903304
935 2977912944
936 2977917497
937 2977941372
938 2977945093
939 2977951188
940 2977960109
941 2979715306
942 2979770990
943 2979773766
944 2979796600
945 2979815724
946 2987639320
947 2987651380
948 2987677002
949 2996356532
950 2996389931
951 3004169209
952 3004200621
953 3004204436
954 3004241513
955 3004253343
956 3004268813
957 3004282835
958 3004294245
959 649873237
960 8004306638
961 8004317211
962 8004362808
963 8004375288
964 8004391921
965 8004643402
966 8004700965
967 8004717614
968 8004731929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

144

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9736 1 127
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9515 1 127
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8611 1 129
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.861 1 125
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.849 1 129
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9758 2 127 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9532 2 127 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8998 78 128 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8925 78 124 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8495 78 129 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A529UK40-F1-model_v4 VOC family protein 0.9912 1 130
AF-A0A3S1HCR2-F1-model_v4 VOC family protein 0.989 1 130
AF-V7FSZ2-F1-model_v4 VOC domain-containing protein 0.988 1 130
AF-A0A4S1AD61-F1-model_v4 deleted 0.9875 1 130
AF-A0A435B0I4-F1-model_v4 deleted 0.986 1 128

Map