F452913

General Info

Members Datasets Scaffolds Average Seq Length
484 271 968 253

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100543863|Ga0075434_1005438632
Length 289
Sequence MPKERIDKLMVERGLADSRTRAQALILAGQVLARDQRIDKPGHLLDPSVEIRIKGETLRYASRGGLKLEAALRDFKIDPKDKICIDVGASTGGFTDCLLQHGAQKVWAVDVGHNQLVWRLRQDSRVVSLEGLNARELSADQFPLRFEIATVDVSFISLALILPALYPCLNDSADCVVLVKPQFEVGKGEVGRGGIVTDTRKHRDVLRKINNAALTTGFSTMGLIESPILGAEGNREFLMHLRTRSTEPSALNPGHIQLHSGLSTQHSALITPFDVEAQIDLLVGPNAML

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
271 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 4.13
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100543863 3300006871 Bacteria 1181
2 rootL2_10068455 3300003322 Bacteria 13519
3 JGI26128J50194_1001410 3300003347 Bacteria 1524
4 JGI26145J50221_1000237 3300003371 Bacteria 4718
5 JGI26145J50221_1000606 3300003371 Unclassified 3051
6 Ga0065704_10091032 3300005289 Bacteria 2745
7 Ga0065704_10106398 3300005289 Bacteria 2084
8 Ga0065712_10022819 3300005290 Unclassified 1710
9 Ga0065715_10106731 3300005293 Bacteria 2812
10 Ga0065707_10001513 3300005295 Bacteria 7971
11 Ga0070658_10358715 3300005327 Bacteria 1248
12 Ga0070676_10000928 3300005328 Bacteria 14517
13 Ga0070676_10164817 3300005328 Bacteria 1429
14 Ga0070683_100060190 3300005329 Bacteria 3529
15 Ga0070683_100065199 3300005329 Bacteria 3391
16 Ga0070683_100132117 3300005329 Bacteria 2362
17 Ga0070683_100441666 3300005329 Unclassified 1241
18 Ga0070690_100003081 3300005330 Bacteria 9065
19 Ga0070690_100115039 3300005330 Bacteria 1799
20 Ga0070670_100042790 3300005331 Bacteria 3894
21 Ga0070670_100061877 3300005331 Unclassified 3213
22 Ga0070670_100367330 3300005331 Bacteria 1266
23 Ga0070677_10014736 3300005333 Bacteria 2758
24 Ga0068869_100000329 3300005334 Bacteria 25222
25 Ga0070666_10065573 3300005335 Bacteria 2464
26 Ga0070666_10126682 3300005335 Bacteria 1772
27 Ga0070680_100000246 3300005336 Bacteria 35743
28 Ga0070680_100156391 3300005336 Bacteria 1915
29 Ga0070682_100046401 3300005337 Unclassified 2696
30 Ga0070682_100266265 3300005337 Bacteria 1243
31 Ga0068868_100100033 3300005338 Bacteria 2346
32 Ga0070660_100005551 3300005339 Bacteria 8737
33 Ga0070660_100190874 3300005339 Unclassified 1659
34 Ga0070660_100400309 3300005339 Bacteria 1135
35 Ga0070689_100000804 3300005340 Bacteria 19320
36 Ga0070691_10007544 3300005341 Bacteria 4987
37 Ga0070687_100020205 3300005343 Unclassified 3111
38 Ga0070687_100099677 3300005343 Bacteria 1624
39 Ga0070687_100234486 3300005343 Unclassified 1131
40 Ga0070661_100003732 3300005344 Bacteria 10497
41 Ga0070661_100043742 3300005344 Bacteria 3271
42 Ga0070661_100160397 3300005344 Bacteria 1703
43 Ga0070692_10022071 3300005345 Bacteria 3106
44 Ga0070692_10140147 3300005345 Unclassified 1368
45 Ga0070668_100264008 3300005347 Bacteria 1433
46 Ga0070669_100022666 3300005353 Bacteria 4491
47 Ga0070675_100013839 3300005354 Bacteria 6352
48 Ga0070675_100070387 3300005354 Bacteria 2899
49 Ga0070675_100164521 3300005354 Bacteria 1910
50 Ga0070675_100517310 3300005354 Bacteria 1077
51 Ga0070671_100137960 3300005355 Unclassified 2057
52 Ga0070674_100008800 3300005356 Bacteria 6025
53 Ga0070674_100404483 3300005356 Bacteria 1116
54 Ga0070673_100022617 3300005364 Bacteria 4579
55 Ga0070688_100002885 3300005365 Bacteria 8769
56 Ga0070688_100034822 3300005365 Bacteria 3054
57 Ga0070688_100218970 3300005365 Bacteria 1341
58 Ga0070659_100013725 3300005366 Bacteria 6039
59 Ga0070659_100022011 3300005366 Unclassified 4864
60 Ga0070659_100043704 3300005366 Bacteria 3505
61 Ga0070659_100147736 3300005366 Bacteria 1916
62 Ga0070667_100009553 3300005367 Bacteria 8042
63 Ga0070667_100193214 3300005367 Bacteria 1804
64 Ga0070703_10002080 3300005406 Bacteria 5829
65 Ga0070703_10015897 3300005406 Unclassified 2157
66 Ga0070703_10019286 3300005406 Bacteria 1977
67 Ga0070714_100190224 3300005435 Bacteria 1872
68 Ga0070713_100070862 3300005436 Bacteria 2944
69 Ga0070713_100377317 3300005436 Bacteria 1320
70 Ga0070711_100356176 3300005439 Bacteria 1178
71 Ga0070711_100853542 3300005439 Bacteria 775
72 Ga0070705_100026943 3300005440 Bacteria 3133
73 Ga0070705_100040647 3300005440 Bacteria 2646
74 Ga0070705_100230699 3300005440 Bacteria 1288
75 Ga0070700_100002907 3300005441 Bacteria 8796
76 Ga0070694_100006195 3300005444 Bacteria 7261
77 Ga0070708_100021325 3300005445 Bacteria 5477
78 Ga0070708_100026710 3300005445 Bacteria 4945
79 Ga0070708_100054012 3300005445 Bacteria 3567
80 Ga0070708_100073748 3300005445 Bacteria 3077
81 Ga0070708_100099546 3300005445 Bacteria 2660
82 Ga0070708_100124754 3300005445 Unclassified 2379
83 Ga0070708_100131350 3300005445 Bacteria 2318
84 Ga0070708_100242534 3300005445 Bacteria 1692
85 Ga0070708_100509638 3300005445 Bacteria 1135
86 Ga0070708_100544882 3300005445 Bacteria 1094
87 Ga0070663_100330940 3300005455 Bacteria 1228
88 Ga0070678_100001475 3300005456 Bacteria 12541
89 Ga0070662_100070466 3300005457 Unclassified 2576
90 Ga0070662_100535844 3300005457 Bacteria 980
91 Ga0070681_10006265 3300005458 Bacteria 11574
92 Ga0070681_10381354 3300005458 Bacteria 1320
93 Ga0068867_100002045 3300005459 Bacteria 14130
94 Ga0070685_10086380 3300005466 Bacteria 1891
95 Ga0070685_10259601 3300005466 Bacteria 1155
96 Ga0070685_10301470 3300005466 Bacteria 1080
97 Ga0070706_100001729 3300005467 Bacteria 22631
98 Ga0070706_100008853 3300005467 Bacteria 9376
99 Ga0070706_100031932 3300005467 Bacteria 4855
100 Ga0070706_100032963 3300005467 Bacteria 4779
101 Ga0070706_100319975 3300005467 Bacteria 1447
102 Ga0070706_100481629 3300005467 Bacteria 1154
103 Ga0070707_100073348 3300005468 Bacteria 3300
104 Ga0070707_100140130 3300005468 Bacteria 2354
105 Ga0070707_100167503 3300005468 Bacteria 2141
106 Ga0070707_100273334 3300005468 Bacteria 1643
107 Ga0070698_100008163 3300005471 Bacteria 11319
108 Ga0070699_100017196 3300005518 Bacteria 6210
109 Ga0070699_100057593 3300005518 Bacteria 3366
110 Ga0070699_100256984 3300005518 Bacteria 1562
111 Ga0070679_100008105 3300005530 Bacteria 9870
112 Ga0070679_100383705 3300005530 Bacteria 1352
113 Ga0070684_100011187 3300005535 Bacteria 7144
114 Ga0070684_100024837 3300005535 Bacteria 5030
115 Ga0070684_100319397 3300005535 Bacteria 1426
116 Ga0070697_100001791 3300005536 Bacteria 16388
117 Ga0070697_100006329 3300005536 Bacteria 9164
118 Ga0070697_100024608 3300005536 Bacteria 4795
119 Ga0070697_100085706 3300005536 Bacteria 2599
120 Ga0070697_100629460 3300005536 Bacteria 944
121 Ga0068853_100000043 3300005539 Bacteria 102800
122 Ga0070672_100054462 3300005543 Bacteria 3131
123 Ga0070686_100077245 3300005544 Bacteria 2195
124 Ga0070695_100007639 3300005545 Bacteria 6404
125 Ga0070696_100002240 3300005546 Bacteria 12745
126 Ga0070665_100126357 3300005548 Unclassified 2560
127 Ga0070665_100132701 3300005548 Bacteria 2492
128 Ga0070665_100360515 3300005548 Bacteria 1460
129 Ga0070704_100010586 3300005549 Bacteria 5615
130 Ga0070704_100174784 3300005549 Bacteria 1712
131 Ga0070704_100221073 3300005549 Bacteria 1540
132 Ga0068855_100001002 3300005563 Bacteria 35206
133 Ga0070664_100002016 3300005564 Bacteria 16284
134 Ga0070664_100038543 3300005564 Unclassified 4023
135 Ga0070664_100609526 3300005564 Bacteria 1013
136 Ga0068857_100044269 3300005577 Unclassified 3948
137 Ga0068854_100085727 3300005578 Bacteria 2333
138 Ga0068856_100496676 3300005614 Bacteria 1241
139 Ga0070702_100017913 3300005615 Unclassified 3663
140 Ga0068852_100089466 3300005616 Unclassified 2752
141 Ga0068852_100530038 3300005616 Bacteria 1176
142 Ga0068859_100051423 3300005617 Unclassified 4142
143 Ga0068864_100285911 3300005618 Bacteria 1540
144 Ga0068866_10004885 3300005718 Bacteria 5506
145 Ga0068861_100150754 3300005719 Bacteria 1907
146 Ga0068861_100225989 3300005719 Bacteria 1585
147 Ga0068870_10014642 3300005840 Bacteria 3708
148 Ga0068858_100052523 3300005842 Bacteria 3771
149 Ga0068858_100154839 3300005842 Bacteria 2156
150 Ga0068860_100001302 3300005843 Bacteria 27105
151 Ga0068860_100027361 3300005843 Bacteria 5494
152 Ga0068860_100083144 3300005843 Unclassified 3045
153 Ga0068862_100027824 3300005844 Bacteria 4762
154 Ga0081455_10001718 3300005937 Bacteria 26508
155 Ga0081455_10028782 3300005937 Bacteria 5072
156 Ga0081455_10073521 3300005937 Bacteria 2826
157 Ga0081455_10128751 3300005937 Bacteria 1982
158 Ga0081455_10167364 3300005937 Bacteria 1678
159 Ga0081455_10370211 3300005937 Bacteria 1004
160 Ga0081540_1000007 3300005983 Bacteria 205328
161 Ga0081540_1000506 3300005983 Bacteria 38278
162 Ga0081540_1013501 3300005983 Bacteria 5305
163 Ga0081539_10017820 3300005985 Bacteria 4961
164 Ga0070717_10031353 3300006028 Bacteria 4276
165 Ga0070717_10311817 3300006028 Viruses 1400
166 Ga0070717_10727948 3300006028 Bacteria 902
167 Ga0070717_10809886 3300006028 Bacteria 852
168 Ga0075432_10015963 3300006058 Bacteria 2564
169 Ga0070716_100241329 3300006173 Bacteria 1225
170 Ga0070712_100056454 3300006175 Bacteria 2754
171 Ga0070712_100088868 3300006175 Bacteria 2259
172 Ga0070712_100098605 3300006175 Bacteria 2155
173 Ga0070712_100417270 3300006175 Bacteria 1112
174 Ga0070712_100468611 3300006175 Bacteria 1051
175 Ga0070712_101050723 3300006175 Bacteria 706
176 Ga0075427_10004876 3300006194 Bacteria 1897
177 Ga0097621_100019892 3300006237 Bacteria 5164
178 Ga0068871_100001101 3300006358 Bacteria 18130
179 Ga0068871_100230974 3300006358 Bacteria 1606
180 Ga0075428_100071086 3300006844 Bacteria 3804
181 Ga0075428_100082058 3300006844 Bacteria 3518
182 Ga0075428_100219741 3300006844 Bacteria 2052
183 Ga0075430_100001365 3300006846 Bacteria 19782
184 Ga0075430_100003363 3300006846 Bacteria 13391
185 Ga0075431_100010930 3300006847 Bacteria 9132
186 Ga0075433_10170390 3300006852 Bacteria 1937
187 Ga0075433_10506440 3300006852 Unclassified 1062
188 Ga0075434_100160917 3300006871 Bacteria 2265
189 Ga0075434_100913473 3300006871 Bacteria 893
190 Ga0075429_100010213 3300006880 Bacteria 8129
191 Ga0068865_100000247 3300006881 Bacteria 30118
192 Ga0075436_100038439 3300006914 Bacteria 3303
193 Ga0075436_100128223 3300006914 Bacteria 1778
194 Ga0097620_100051422 3300006931 Unclassified 4142
195 Ga0099795_10239280 3300007788 Bacteria 779
196 Ga0105240_10158604 3300009093 Bacteria 2689
197 Ga0111539_10066233 3300009094 Bacteria 4266
198 Ga0105245_10000631 3300009098 Bacteria 32008
199 Ga0105245_10045204 3300009098 Unclassified 3932
200 Ga0105245_10106812 3300009098 Bacteria 2598
201 Ga0114129_10005245 3300009147 Bacteria 18264
202 Ga0114129_10024321 3300009147 Bacteria 8582
203 Ga0114129_10047603 3300009147 Bacteria 6024
204 Ga0114129_10081044 3300009147 Bacteria 4511
205 Ga0114129_10114579 3300009147 Bacteria 3717
206 Ga0114129_10565682 3300009147 Bacteria 1477
207 Ga0105243_10001540 3300009148 Bacteria 20159
208 Ga0105241_10139711 3300009174 Bacteria 1971
209 Ga0105242_10006763 3300009176 Bacteria 8841
210 Ga0105249_10008379 3300009553 Bacteria 9005
211 Ga0105249_10024672 3300009553 Bacteria 5405
212 Ga0105249_10314240 3300009553 Bacteria 1576
213 Ga0105239_10001429 3300010375 Bacteria 31858
214 Ga0105239_10205065 3300010375 Bacteria 2209
215 Ga0105239_10911711 3300010375 Bacteria 1009
216 Ga0105246_10000503 3300011119 Bacteria 21268
217 Ga0105246_10366977 3300011119 Bacteria 1185
218 Ga0157370_10549085 3300013104 Bacteria 1059
219 Ga0157374_10000071 3300013296 Bacteria 102927
220 Ga0157374_10066612 3300013296 Bacteria 3384
221 Ga0157374_10090170 3300013296 Bacteria 2922
222 Ga0157374_10117547 3300013296 Bacteria 2563
223 Ga0157374_10168700 3300013296 Bacteria 2134
224 Ga0157374_10325749 3300013296 Bacteria 1523
225 Ga0157378_10006734 3300013297 Bacteria 10037
226 Ga0157378_10008473 3300013297 Bacteria 8956
227 Ga0157378_10056332 3300013297 Bacteria 3503
228 Ga0157378_10083029 3300013297 Bacteria 2898
229 Ga0163162_10128673 3300013306 Bacteria 2640
230 Ga0163162_10218334 3300013306 Bacteria 2037
231 Ga0163162_10647968 3300013306 Bacteria 1180
232 Ga0157372_10023463 3300013307 Bacteria 6687
233 Ga0157372_10603816 3300013307 Unclassified 1279
234 Ga0157372_11118184 3300013307 Bacteria 911
235 Ga0157375_10147742 3300013308 Bacteria 2483
236 Ga0157375_10170001 3300013308 Bacteria 2327
237 Ga0157375_10631623 3300013308 Bacteria 1228
238 Ga0157375_11231604 3300013308 Bacteria 878
239 Ga0163163_10224173 3300014325 Bacteria 1929
240 Ga0157377_10022943 3300014745 Unclassified 3301
241 Ga0157379_10183632 3300014968 Bacteria 1890
242 Ga0157376_10000170 3300014969 Bacteria 45040
243 Ga0157376_10000178 3300014969 Bacteria 43694
244 Ga0157376_10183934 3300014969 Bacteria 1912
245 Ga0213876_10113037 3300021384 Bacteria 1441
246 Ga0207697_10007813 3300025315 Bacteria 4735
247 Ga0207697_10008397 3300025315 Bacteria 4519
248 Ga0207697_10014692 3300025315 Unclassified 3245
249 Ga0207697_10016060 3300025315 Bacteria 3088
250 Ga0207697_10185534 3300025315 Unclassified 913
251 Ga0207682_10003816 3300025893 Bacteria 6468
252 Ga0207692_10068827 3300025898 Bacteria 1858
253 Ga0207642_10020838 3300025899 Unclassified 2569
254 Ga0207688_10006772 3300025901 Bacteria 6238
255 Ga0207688_10334540 3300025901 Bacteria 931
256 Ga0207680_10007089 3300025903 Bacteria 5447
257 Ga0207685_10047875 3300025905 Bacteria 1635
258 Ga0207645_10000009 3300025907 Bacteria 142449
259 Ga0207643_10003609 3300025908 Bacteria 8342
260 Ga0207684_10000129 3300025910 Bacteria 138143
261 Ga0207684_10010315 3300025910 Bacteria 8224
262 Ga0207684_10012153 3300025910 Bacteria 7493
263 Ga0207684_10077201 3300025910 Bacteria 2832
264 Ga0207684_10164524 3300025910 Bacteria 1911
265 Ga0207684_10199316 3300025910 Bacteria 1727
266 Ga0207684_10199823 3300025910 Bacteria 1725
267 Ga0207684_10299117 3300025910 Bacteria 1387
268 Ga0207707_10021346 3300025912 Bacteria 5661
269 Ga0207695_10430974 3300025913 Bacteria 1202
270 Ga0207693_10022511 3300025915 Bacteria 5007
271 Ga0207693_10026344 3300025915 Bacteria 4601
272 Ga0207693_10163826 3300025915 Bacteria 1750
273 Ga0207693_10281506 3300025915 Bacteria 1303
274 Ga0207663_10086152 3300025916 Bacteria 2071
275 Ga0207663_10671940 3300025916 Bacteria 819
276 Ga0207660_10170910 3300025917 Bacteria 1682
277 Ga0207662_10001944 3300025918 Bacteria 10186
278 Ga0207662_10011213 3300025918 Bacteria 4964
279 Ga0207657_10004684 3300025919 Bacteria 14438
280 Ga0207657_10124128 3300025919 Unclassified 2122
281 Ga0207649_10144858 3300025920 Bacteria 1630
282 Ga0207652_10091022 3300025921 Bacteria 2681
283 Ga0207652_10157443 3300025921 Bacteria 2035
284 Ga0207646_10017251 3300025922 Bacteria 6762
285 Ga0207646_10017989 3300025922 Bacteria 6599
286 Ga0207646_10298533 3300025922 Unclassified 1455
287 Ga0207681_10026348 3300025923 Unclassified 3749
288 Ga0207681_10078805 3300025923 Bacteria 2319
289 Ga0207650_10086039 3300025925 Bacteria 2392
290 Ga0207659_10046920 3300025926 Unclassified 3054
291 Ga0207659_10063317 3300025926 Bacteria 2673
292 Ga0207659_10072093 3300025926 Bacteria 2524
293 Ga0207659_10132250 3300025926 Bacteria 1927
294 Ga0207659_10145089 3300025926 Bacteria 1847
295 Ga0207659_10171566 3300025926 Bacteria 1711
296 Ga0207659_10431393 3300025926 Bacteria 1107
297 Ga0207687_10018962 3300025927 Bacteria 4551
298 Ga0207700_10184222 3300025928 Bacteria 1750
299 Ga0207700_10485342 3300025928 Bacteria 1092
300 Ga0207690_10034421 3300025932 Bacteria 3265
301 Ga0207690_10411490 3300025932 Unclassified 1080
302 Ga0207706_10000134 3300025933 Bacteria 80573
303 Ga0207686_10002747 3300025934 Bacteria 9540
304 Ga0207709_10025896 3300025935 Bacteria 3363
305 Ga0207670_10033441 3300025936 Bacteria 3313
306 Ga0207669_10001813 3300025937 Bacteria 9046
307 Ga0207704_10000768 3300025938 Bacteria 14117
308 Ga0207665_10721208 3300025939 Bacteria 785
309 Ga0207691_10000066 3300025940 Bacteria 84662
310 Ga0207691_10072704 3300025940 Unclassified 3102
311 Ga0207691_10334716 3300025940 Bacteria 1297
312 Ga0207689_10001426 3300025942 Bacteria 22810
313 Ga0207661_10149424 3300025944 Bacteria 2018
314 Ga0207661_10171428 3300025944 Bacteria 1889
315 Ga0207661_10264494 3300025944 Bacteria 1533
316 Ga0207661_10607667 3300025944 Bacteria 1004
317 Ga0207679_10000771 3300025945 Bacteria 20959
318 Ga0207679_10002206 3300025945 Bacteria 12034
319 Ga0207667_10000834 3300025949 Bacteria 39795
320 Ga0207651_10147421 3300025960 Bacteria 1827
321 Ga0207712_10086166 3300025961 Unclassified 2301
322 Ga0207712_10098978 3300025961 Bacteria 2164
323 Ga0207668_10074564 3300025972 Bacteria 2436
324 Ga0207640_10079992 3300025981 Bacteria 2229
325 Ga0207658_10070914 3300025986 Unclassified 2637
326 Ga0207677_10069988 3300026023 Bacteria 2470
327 Ga0207677_10432656 3300026023 Bacteria 1123
328 Ga0207703_10044516 3300026035 Bacteria 3568
329 Ga0207639_10000002 3300026041 Bacteria 903066
330 Ga0207678_10012787 3300026067 Bacteria 7370
331 Ga0207708_10000212 3300026075 Bacteria 46204
332 Ga0207708_10061950 3300026075 Unclassified 2857
333 Ga0207648_10000049 3300026089 Bacteria 108876
334 Ga0207676_10238879 3300026095 Bacteria 1629
335 Ga0207676_10260242 3300026095 Bacteria 1566
336 Ga0207674_10021053 3300026116 Bacteria 7034
337 Ga0207675_100062462 3300026118 Bacteria 3479
338 Ga0207675_100173472 3300026118 Unclassified 2062
339 Ga0207675_100517180 3300026118 Bacteria 1189
340 Ga0207683_10000023 3300026121 Bacteria 114463
341 Ga0207698_10052334 3300026142 Bacteria 3128
342 Ga0209973_1001137 3300027252 Bacteria 2238
343 Ga0209969_1000002 3300027360 Bacteria 43628
344 Ga0209967_1000034 3300027364 Bacteria 17316
345 Ga0209967_1003882 3300027364 Unclassified 1973
346 Ga0209996_1000024 3300027395 Bacteria 22414
347 Ga0209984_1000007 3300027424 Bacteria 19843
348 Ga0210000_1000014 3300027462 Bacteria 31267
349 Ga0209968_1000059 3300027526 Bacteria 19496
350 Ga0209999_1000040 3300027543 Bacteria 14369
351 Ga0209982_1000114 3300027552 Bacteria 8648
352 Ga0209982_1008683 3300027552 Bacteria 1493
353 Ga0209970_1000255 3300027614 Bacteria 8718
354 Ga0209970_1003009 3300027614 Bacteria 2840
355 Ga0210002_1000004 3300027617 Bacteria 38105
356 Ga0209983_1000028 3300027665 Bacteria 19716
357 Ga0209983_1022869 3300027665 Bacteria 1312
358 Ga0209971_1000211 3300027682 Bacteria 17212
359 Ga0209966_1000028 3300027695 Bacteria 65208
360 Ga0209998_10000144 3300027717 Bacteria 27469
361 Ga0209974_10001164 3300027876 Bacteria 9375
362 Ga0209974_10061181 3300027876 Unclassified 1275
363 Ga0207428_10005567 3300027907 Bacteria 11728
364 Ga0268266_10070930 3300028379 Bacteria 3019
365 Ga0268266_10221763 3300028379 Bacteria 1738
366 Ga0268266_10698849 3300028379 Bacteria 977
367 Ga0268265_10089640 3300028380 Bacteria 2454
368 Ga0268265_10365749 3300028380 Bacteria 1322
369 Ga0268264_10000659 3300028381 Bacteria 40567
370 Ga0268264_10070573 3300028381 Unclassified 2957
371 Ga0268264_10404449 3300028381 Bacteria 1313
372 Ga0307508_10070459 3300031616 Bacteria 3069
373 Ga0307416_100140676 3300032002 Unclassified 2193
374 Ga0307414_10114060 3300032004 Bacteria 2064
375 Ga0373938_0044283 3300034957 Bacteria 998
376 Ga0373944_0051187 3300035089 Bacteria 1302
377 Ga0373945_0013417 3300035116 Bacteria 2734
378 Ga0373953_0132661 3300035117 Bacteria 1063
379 Ga0373960_0020967 3300035121 Unclassified 1733
380 Ga0373943_0045743 3300035170 Bacteria 2134
381 Ga0373943_0107579 3300035170 Unclassified 1467
382 Ga0373946_0054687 3300035171 Unclassified 1681
383 Ga0373942_0041855 3300035207 Bacteria 1254
384 Ga0373935_0014437 3300035692 Bacteria 4766
385 Ga0373935_0171824 3300035692 Bacteria 1483
386 Ga0373933_0131067 3300035724 Unclassified 1577
387 Ga0373937_0152637 3300036401 Bacteria 2164
388 Ga0373937_0350916 3300036401 Bacteria 1397
389 Ga0373925_0084228 3300037068 Unclassified 2423
390 Ga0395900_0013816 3300037418 Bacteria 8240
391 Ga0395900_0335380 3300037418 Bacteria 1489
392 Ga0395898_0438276 3300037466 Unclassified 1245
393 Ga0395905_0165959 3300037471 Bacteria 2075
394 Ga0395901_0002600 3300038443 Bacteria 18294
395 Ga0395901_0123091 3300038443 Unclassified 2726
396 Ga0436365_0080702 3300039437 Bacteria 4673
397 Ga0436362_0690459 3300039453 Bacteria 2428
398 Ga0451853_1907896 3300041512 Bacteria 1943
399 Ga0450889_001934 3300042144 Bacteria 2083
400 Ga0439464_0052405 3300042439 Bacteria 1182
401 Ga0451577_0031714 3300042876 Bacteria 4767
402 Ga0466964_0113855 3300044706 Unclassified 1210
403 Ga0453684_0021154 3300044712 Bacteria 9745
404 Ga0453684_0034151 3300044712 Bacteria 7068
405 Ga0453684_0187067 3300044712 Bacteria 2426
406 Ga0453684_1095221 3300044712 Bacteria 842
407 Ga0451576_0004548 3300045051 Bacteria 17956
408 Ga0451576_0068637 3300045051 Bacteria 3689
409 Ga0451576_0082422 3300045051 Bacteria 3345
410 Ga0451576_0786897 3300045051 Bacteria 999
411 Ga0466967_0082308 3300045976 Unclassified 2909
412 Ga0495603_0072957 3300046455 Bacteria 2017
413 Ga0495628_0026278 3300046516 Bacteria 4749
414 Ga0495628_0282231 3300046516 Bacteria 1233
415 Ga0495630_0100126 3300046517 Bacteria 2192
416 Ga0495652_0021508 3300046529 Bacteria 5732
417 Ga0495640_0248048 3300046533 Bacteria 1116
418 Ga0495586_0014095 3300046535 Bacteria 4247
419 Ga0495587_0030836 3300046536 Bacteria 3250
420 Ga0495645_0010794 3300046543 Bacteria 6417
421 Ga0495634_0106269 3300046642 Bacteria 1809
422 Ga0495635_0078253 3300046663 Bacteria 2264
423 Ga0495599_0000841 3300046678 Bacteria 17299
424 Ga0495623_0040430 3300046679 Bacteria 2977
425 Ga0495646_0021937 3300046680 Bacteria 4031
426 Ga0495669_0065493 3300046684 Bacteria 1650
427 Ga0495613_0119828 3300046689 Bacteria 1890
428 Ga0495613_0187592 3300046689 Unclassified 1463
429 Ga0495604_0026674 3300047317 Bacteria 4598
430 Ga0495604_0181939 3300047317 Bacteria 1470
431 Ga0495636_0007672 3300047318 Bacteria 4243
432 Ga0495674_0081818 3300047319 Bacteria 2769
433 Ga0495680_0146568 3300047322 Bacteria 1724
434 Ga0495675_0163568 3300047444 Bacteria 1369
435 Ga0495684_0001106 3300047471 Bacteria 21716
436 Ga0495602_0068558 3300048088 Bacteria 3045
437 Ga0496102_0078925 3300048905 Bacteria 3031
438 Ga0496104_0030916 3300048907 Bacteria 4978
439 Ga0496104_0368880 3300048907 Bacteria 1348
440 Ga0496105_0005524 3300048908 Bacteria 9594
441 Ga0496106_0168379 3300048909 Bacteria 1735
442 Ga0496106_0412191 3300048909 Bacteria 1086
443 Ga0496108_0009507 3300048911 Bacteria 7874
444 Ga0496108_0292158 3300048911 Bacteria 1419
445 Ga0496108_0697830 3300048911 Bacteria 880
446 Ga0496109_0002718 3300048912 Bacteria 14823
447 Ga0496109_0073328 3300048912 Bacteria 3146
448 Ga0496109_0887720 3300048912 Bacteria 829
449 Ga0496111_0268777 3300048914 Bacteria 1265
450 Ga0496112_0029609 3300048915 Bacteria 5295
451 Ga0496112_0131979 3300048915 Bacteria 2469
452 Ga0496112_0197704 3300048915 Bacteria 1971
453 Ga0496112_0965563 3300048915 Bacteria 773
454 Ga0496113_0010195 3300048916 Bacteria 6203
455 Ga0496114_0071650 3300048917 Bacteria 2913
456 Ga0496114_0400599 3300048917 Bacteria 1215
457 Ga0501040_0158983 3300049576 Bacteria 1597
458 Ga0501046_0108516 3300049580 Bacteria 2123
459 Ga0501071_0482198 3300049587 Bacteria 950
460 Ga0501077_0038826 3300049593 Bacteria 3032
461 Ga0501080_0472538 3300049742 Bacteria 1122
462 Ga0501262_000544 3300049759 Bacteria 4501
463 nmdc:mga05p37_134406_c1 3300050507 Bacteria 3034
464 nmdc:mga05p37_248175_c1 3300050507 Bacteria 2136
465 nmdc:mga05p37_326812_c1 3300050507 Bacteria 1813
466 nmdc:mga05p37_50693_c1 3300050507 Bacteria 5105
467 nmdc:mga05p37_55882_c1 3300050507 Bacteria 4860
468 nmdc:mga05p37_87149_c1 3300050507 Bacteria 3848
469 nmdc:mga09592_15993_c1 3300050508 Bacteria 6132
470 nmdc:mga0qj67_116974_c1 3300050509 Bacteria 2155
471 nmdc:mga0qj67_20331_c1 3300050509 Bacteria 5082
472 nmdc:mga06r32_4749_c1 3300050510 Bacteria 12212
473 nmdc:mga08y16_148735_c1 3300050511 Bacteria 2435
474 nmdc:mga0n895_1078063_c1 3300050512 Unclassified 781
475 nmdc:mga0n895_767703_c1 3300050512 Bacteria 956
476 nmdc:mga0rr50_115092_c1 3300050513 Bacteria 2134
477 nmdc:mga0a205_16722_c1 3300050515 Bacteria 6870
478 nmdc:mga0a205_52226_c1 3300050515 Bacteria 3576
479 nmdc:mga0a205_709792_c1 3300050515 Unclassified 855
480 Ga0495601_0035027 3300053077 Bacteria 3132
481 Ga0495595_0072046 3300053084 Bacteria 1635
482 Ga0500645_040117 3300053730 Bacteria 1386
483 2852675411 2852673933 Bacteria 3347676
484 2928514139 2928510474 Bacteria 4815308
485 Ga0075434_100543863
486 rootL2_10068455
487 JGI26128J50194_1001410
488 JGI26145J50221_1000237
489 JGI26145J50221_1000606
490 Ga0065704_10091032
491 Ga0065704_10106398
492 Ga0065712_10022819
493 Ga0065715_10106731
494 Ga0065707_10001513
495 Ga0070658_10358715
496 Ga0070676_10000928
497 Ga0070676_10164817
498 Ga0070683_100060190
499 Ga0070683_100065199
500 Ga0070683_100132117
501 Ga0070683_100441666
502 Ga0070690_100003081
503 Ga0070690_100115039
504 Ga0070670_100042790
505 Ga0070670_100061877
506 Ga0070670_100367330
507 Ga0070677_10014736
508 Ga0068869_100000329
509 Ga0070666_10065573
510 Ga0070666_10126682
511 Ga0070680_100000246
512 Ga0070680_100156391
513 Ga0070682_100046401
514 Ga0070682_100266265
515 Ga0068868_100100033
516 Ga0070660_100005551
517 Ga0070660_100190874
518 Ga0070660_100400309
519 Ga0070689_100000804
520 Ga0070691_10007544
521 Ga0070687_100020205
522 Ga0070687_100099677
523 Ga0070687_100234486
524 Ga0070661_100003732
525 Ga0070661_100043742
526 Ga0070661_100160397
527 Ga0070692_10022071
528 Ga0070692_10140147
529 Ga0070668_100264008
530 Ga0070669_100022666
531 Ga0070675_100013839
532 Ga0070675_100070387
533 Ga0070675_100164521
534 Ga0070675_100517310
535 Ga0070671_100137960
536 Ga0070674_100008800
537 Ga0070674_100404483
538 Ga0070673_100022617
539 Ga0070688_100002885
540 Ga0070688_100034822
541 Ga0070688_100218970
542 Ga0070659_100013725
543 Ga0070659_100022011
544 Ga0070659_100043704
545 Ga0070659_100147736
546 Ga0070667_100009553
547 Ga0070667_100193214
548 Ga0070703_10002080
549 Ga0070703_10015897
550 Ga0070703_10019286
551 Ga0070714_100190224
552 Ga0070713_100070862
553 Ga0070713_100377317
554 Ga0070711_100356176
555 Ga0070711_100853542
556 Ga0070705_100026943
557 Ga0070705_100040647
558 Ga0070705_100230699
559 Ga0070700_100002907
560 Ga0070694_100006195
561 Ga0070708_100021325
562 Ga0070708_100026710
563 Ga0070708_100054012
564 Ga0070708_100073748
565 Ga0070708_100099546
566 Ga0070708_100124754
567 Ga0070708_100131350
568 Ga0070708_100242534
569 Ga0070708_100509638
570 Ga0070708_100544882
571 Ga0070663_100330940
572 Ga0070678_100001475
573 Ga0070662_100070466
574 Ga0070662_100535844
575 Ga0070681_10006265
576 Ga0070681_10381354
577 Ga0068867_100002045
578 Ga0070685_10086380
579 Ga0070685_10259601
580 Ga0070685_10301470
581 Ga0070706_100001729
582 Ga0070706_100008853
583 Ga0070706_100031932
584 Ga0070706_100032963
585 Ga0070706_100319975
586 Ga0070706_100481629
587 Ga0070707_100073348
588 Ga0070707_100140130
589 Ga0070707_100167503
590 Ga0070707_100273334
591 Ga0070698_100008163
592 Ga0070699_100017196
593 Ga0070699_100057593
594 Ga0070699_100256984
595 Ga0070679_100008105
596 Ga0070679_100383705
597 Ga0070684_100011187
598 Ga0070684_100024837
599 Ga0070684_100319397
600 Ga0070697_100001791
601 Ga0070697_100006329
602 Ga0070697_100024608
603 Ga0070697_100085706
604 Ga0070697_100629460
605 Ga0068853_100000043
606 Ga0070672_100054462
607 Ga0070686_100077245
608 Ga0070695_100007639
609 Ga0070696_100002240
610 Ga0070665_100126357
611 Ga0070665_100132701
612 Ga0070665_100360515
613 Ga0070704_100010586
614 Ga0070704_100174784
615 Ga0070704_100221073
616 Ga0068855_100001002
617 Ga0070664_100002016
618 Ga0070664_100038543
619 Ga0070664_100609526
620 Ga0068857_100044269
621 Ga0068854_100085727
622 Ga0068856_100496676
623 Ga0070702_100017913
624 Ga0068852_100089466
625 Ga0068852_100530038
626 Ga0068859_100051423
627 Ga0068864_100285911
628 Ga0068866_10004885
629 Ga0068861_100150754
630 Ga0068861_100225989
631 Ga0068870_10014642
632 Ga0068858_100052523
633 Ga0068858_100154839
634 Ga0068860_100001302
635 Ga0068860_100027361
636 Ga0068860_100083144
637 Ga0068862_100027824
638 Ga0081455_10001718
639 Ga0081455_10028782
640 Ga0081455_10073521
641 Ga0081455_10128751
642 Ga0081455_10167364
643 Ga0081455_10370211
644 Ga0081540_1000007
645 Ga0081540_1000506
646 Ga0081540_1013501
647 Ga0081539_10017820
648 Ga0070717_10031353
649 Ga0070717_10311817
650 Ga0070717_10727948
651 Ga0070717_10809886
652 Ga0075432_10015963
653 Ga0070716_100241329
654 Ga0070712_100056454
655 Ga0070712_100088868
656 Ga0070712_100098605
657 Ga0070712_100417270
658 Ga0070712_100468611
659 Ga0070712_101050723
660 Ga0075427_10004876
661 Ga0097621_100019892
662 Ga0068871_100001101
663 Ga0068871_100230974
664 Ga0075428_100071086
665 Ga0075428_100082058
666 Ga0075428_100219741
667 Ga0075430_100001365
668 Ga0075430_100003363
669 Ga0075431_100010930
670 Ga0075433_10170390
671 Ga0075433_10506440
672 Ga0075434_100160917
673 Ga0075434_100913473
674 Ga0075429_100010213
675 Ga0068865_100000247
676 Ga0075436_100038439
677 Ga0075436_100128223
678 Ga0097620_100051422
679 Ga0099795_10239280
680 Ga0105240_10158604
681 Ga0111539_10066233
682 Ga0105245_10000631
683 Ga0105245_10045204
684 Ga0105245_10106812
685 Ga0114129_10005245
686 Ga0114129_10024321
687 Ga0114129_10047603
688 Ga0114129_10081044
689 Ga0114129_10114579
690 Ga0114129_10565682
691 Ga0105243_10001540
692 Ga0105241_10139711
693 Ga0105242_10006763
694 Ga0105249_10008379
695 Ga0105249_10024672
696 Ga0105249_10314240
697 Ga0105239_10001429
698 Ga0105239_10205065
699 Ga0105239_10911711
700 Ga0105246_10000503
701 Ga0105246_10366977
702 Ga0157370_10549085
703 Ga0157374_10000071
704 Ga0157374_10066612
705 Ga0157374_10090170
706 Ga0157374_10117547
707 Ga0157374_10168700
708 Ga0157374_10325749
709 Ga0157378_10006734
710 Ga0157378_10008473
711 Ga0157378_10056332
712 Ga0157378_10083029
713 Ga0163162_10128673
714 Ga0163162_10218334
715 Ga0163162_10647968
716 Ga0157372_10023463
717 Ga0157372_10603816
718 Ga0157372_11118184
719 Ga0157375_10147742
720 Ga0157375_10170001
721 Ga0157375_10631623
722 Ga0157375_11231604
723 Ga0163163_10224173
724 Ga0157377_10022943
725 Ga0157379_10183632
726 Ga0157376_10000170
727 Ga0157376_10000178
728 Ga0157376_10183934
729 Ga0213876_10113037
730 Ga0207697_10007813
731 Ga0207697_10008397
732 Ga0207697_10014692
733 Ga0207697_10016060
734 Ga0207697_10185534
735 Ga0207682_10003816
736 Ga0207692_10068827
737 Ga0207642_10020838
738 Ga0207688_10006772
739 Ga0207688_10334540
740 Ga0207680_10007089
741 Ga0207685_10047875
742 Ga0207645_10000009
743 Ga0207643_10003609
744 Ga0207684_10000129
745 Ga0207684_10010315
746 Ga0207684_10012153
747 Ga0207684_10077201
748 Ga0207684_10164524
749 Ga0207684_10199316
750 Ga0207684_10199823
751 Ga0207684_10299117
752 Ga0207707_10021346
753 Ga0207695_10430974
754 Ga0207693_10022511
755 Ga0207693_10026344
756 Ga0207693_10163826
757 Ga0207693_10281506
758 Ga0207663_10086152
759 Ga0207663_10671940
760 Ga0207660_10170910
761 Ga0207662_10001944
762 Ga0207662_10011213
763 Ga0207657_10004684
764 Ga0207657_10124128
765 Ga0207649_10144858
766 Ga0207652_10091022
767 Ga0207652_10157443
768 Ga0207646_10017251
769 Ga0207646_10017989
770 Ga0207646_10298533
771 Ga0207681_10026348
772 Ga0207681_10078805
773 Ga0207650_10086039
774 Ga0207659_10046920
775 Ga0207659_10063317
776 Ga0207659_10072093
777 Ga0207659_10132250
778 Ga0207659_10145089
779 Ga0207659_10171566
780 Ga0207659_10431393
781 Ga0207687_10018962
782 Ga0207700_10184222
783 Ga0207700_10485342
784 Ga0207690_10034421
785 Ga0207690_10411490
786 Ga0207706_10000134
787 Ga0207686_10002747
788 Ga0207709_10025896
789 Ga0207670_10033441
790 Ga0207669_10001813
791 Ga0207704_10000768
792 Ga0207665_10721208
793 Ga0207691_10000066
794 Ga0207691_10072704
795 Ga0207691_10334716
796 Ga0207689_10001426
797 Ga0207661_10149424
798 Ga0207661_10171428
799 Ga0207661_10264494
800 Ga0207661_10607667
801 Ga0207679_10000771
802 Ga0207679_10002206
803 Ga0207667_10000834
804 Ga0207651_10147421
805 Ga0207712_10086166
806 Ga0207712_10098978
807 Ga0207668_10074564
808 Ga0207640_10079992
809 Ga0207658_10070914
810 Ga0207677_10069988
811 Ga0207677_10432656
812 Ga0207703_10044516
813 Ga0207639_10000002
814 Ga0207678_10012787
815 Ga0207708_10000212
816 Ga0207708_10061950
817 Ga0207648_10000049
818 Ga0207676_10238879
819 Ga0207676_10260242
820 Ga0207674_10021053
821 Ga0207675_100062462
822 Ga0207675_100173472
823 Ga0207675_100517180
824 Ga0207683_10000023
825 Ga0207698_10052334
826 Ga0209973_1001137
827 Ga0209969_1000002
828 Ga0209967_1000034
829 Ga0209967_1003882
830 Ga0209996_1000024
831 Ga0209984_1000007
832 Ga0210000_1000014
833 Ga0209968_1000059
834 Ga0209999_1000040
835 Ga0209982_1000114
836 Ga0209982_1008683
837 Ga0209970_1000255
838 Ga0209970_1003009
839 Ga0210002_1000004
840 Ga0209983_1000028
841 Ga0209983_1022869
842 Ga0209971_1000211
843 Ga0209966_1000028
844 Ga0209998_10000144
845 Ga0209974_10001164
846 Ga0209974_10061181
847 Ga0207428_10005567
848 Ga0268266_10070930
849 Ga0268266_10221763
850 Ga0268266_10698849
851 Ga0268265_10089640
852 Ga0268265_10365749
853 Ga0268264_10000659
854 Ga0268264_10070573
855 Ga0268264_10404449
856 Ga0307508_10070459
857 Ga0307416_100140676
858 Ga0307414_10114060
859 Ga0373938_0044283
860 Ga0373944_0051187
861 Ga0373945_0013417
862 Ga0373953_0132661
863 Ga0373960_0020967
864 Ga0373943_0045743
865 Ga0373943_0107579
866 Ga0373946_0054687
867 Ga0373942_0041855
868 Ga0373935_0014437
869 Ga0373935_0171824
870 Ga0373933_0131067
871 Ga0373937_0152637
872 Ga0373937_0350916
873 Ga0373925_0084228
874 Ga0395900_0013816
875 Ga0395900_0335380
876 Ga0395898_0438276
877 Ga0395905_0165959
878 Ga0395901_0002600
879 Ga0395901_0123091
880 Ga0436365_0080702
881 Ga0436362_0690459
882 Ga0451853_1907896
883 Ga0450889_001934
884 Ga0439464_0052405
885 Ga0451577_0031714
886 Ga0466964_0113855
887 Ga0453684_0021154
888 Ga0453684_0034151
889 Ga0453684_0187067
890 Ga0453684_1095221
891 Ga0451576_0004548
892 Ga0451576_0068637
893 Ga0451576_0082422
894 Ga0451576_0786897
895 Ga0466967_0082308
896 Ga0495603_0072957
897 Ga0495628_0026278
898 Ga0495628_0282231
899 Ga0495630_0100126
900 Ga0495652_0021508
901 Ga0495640_0248048
902 Ga0495586_0014095
903 Ga0495587_0030836
904 Ga0495645_0010794
905 Ga0495634_0106269
906 Ga0495635_0078253
907 Ga0495599_0000841
908 Ga0495623_0040430
909 Ga0495646_0021937
910 Ga0495669_0065493
911 Ga0495613_0119828
912 Ga0495613_0187592
913 Ga0495604_0026674
914 Ga0495604_0181939
915 Ga0495636_0007672
916 Ga0495674_0081818
917 Ga0495680_0146568
918 Ga0495675_0163568
919 Ga0495684_0001106
920 Ga0495602_0068558
921 Ga0496102_0078925
922 Ga0496104_0030916
923 Ga0496104_0368880
924 Ga0496105_0005524
925 Ga0496106_0168379
926 Ga0496106_0412191
927 Ga0496108_0009507
928 Ga0496108_0292158
929 Ga0496108_0697830
930 Ga0496109_0002718
931 Ga0496109_0073328
932 Ga0496109_0887720
933 Ga0496111_0268777
934 Ga0496112_0029609
935 Ga0496112_0131979
936 Ga0496112_0197704
937 Ga0496112_0965563
938 Ga0496113_0010195
939 Ga0496114_0071650
940 Ga0496114_0400599
941 Ga0501040_0158983
942 Ga0501046_0108516
943 Ga0501071_0482198
944 Ga0501077_0038826
945 Ga0501080_0472538
946 Ga0501262_000544
947 nmdc:mga05p37_134406_c1
948 nmdc:mga05p37_248175_c1
949 nmdc:mga05p37_326812_c1
950 nmdc:mga05p37_50693_c1
951 nmdc:mga05p37_55882_c1
952 nmdc:mga05p37_87149_c1
953 nmdc:mga09592_15993_c1
954 nmdc:mga0qj67_116974_c1
955 nmdc:mga0qj67_20331_c1
956 nmdc:mga06r32_4749_c1
957 nmdc:mga08y16_148735_c1
958 nmdc:mga0n895_1078063_c1
959 nmdc:mga0n895_767703_c1
960 nmdc:mga0rr50_115092_c1
961 nmdc:mga0a205_16722_c1
962 nmdc:mga0a205_52226_c1
963 nmdc:mga0a205_709792_c1
964 Ga0495601_0035027
965 Ga0495595_0072046
966 Ga0500645_040117
967 2852675411
968 2928514139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

60

243

0.98

PF01479

S4

S4 domain

4

51

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9696 32 215
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9555 35 216
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.8509 32 215
3hp7-assembly1.cif.gz_A putative hemolysin from streptococcus thermophilus. 0.8504 1 215
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.8428 35 216
ID Description Score Start End Superfamily
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9659 32 215 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9555 35 216 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9517 40 216 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8869 40 216 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8461 32 215 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q3A0S0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9955 134 215 GO:0008168
GO:0032259
AF-A0A4Q2ZBZ9-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.987 72 215 GO:0008168
GO:0032259
AF-A0A453HFZ1-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9861 37 131 GO:0008168
GO:0032259
AF-A0A4V3M298-F1-model_v4 deleted 0.9855 33 116
AF-A0A2V6AJY6-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9844 59 217 GO:0008168
GO:0032259

Map