F452861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 483 | 319 | 468 | 292 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3003665799|3003667362 |
| Length | 338 |
| Sequence | HDHAHDHDDHGRDHHRQDHHGHDHHGHDHHGHDHHDHAHHGPGHVHAPASFGRAFAIGIALNTGFVLIEGAYGVLTDSVALLADAGHNLSDVLGLVVAWAAATLGQRQPTARFTYGLRASSILAALFNAVFLLVAVGAIAWEAIRRFSEPAPVPGLTVTIVALIGIAVNGITAWLFASGRKGDLNVRGAYLHMLADAAVSAGVVVAGLVIVATGWTWVDPVTSLVIVAVIVAGTWGLLRDSVVLSLDAVPPGIDPAEVRRCLVDRPGVWEVHDLHVWPMSTTETALTAHLVMPDGHPGNAFLADCAGLLRRRFGIAHVTLQVELAGGPACALAPDHVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 2 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 3 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 4 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 5 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 6 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 7 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 8 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 9 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 10 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 11 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 12 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 105 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 106 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 171 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 294 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 309 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 317 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 318 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 319 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.48 |
| Metatranscriptomes | 0.41 |
| Isolates | 3.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.25 |
| Nodule | 1.86 |
| Rhizoplane | 9.73 |
| Rhizosphere | 75.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10229958 | 3300005293 | Bacteria | 1237 |
| 2 | Ga0070676_10003500 | 3300005328 | Bacteria | 8194 |
| 3 | Ga0070676_10027946 | 3300005328 | Bacteria | 3202 |
| 4 | Ga0070683_100153545 | 3300005329 | Bacteria | 2183 |
| 5 | Ga0070690_100028161 | 3300005330 | Bacteria | 3479 |
| 6 | Ga0068869_100368353 | 3300005334 | Bacteria | 1175 |
| 7 | Ga0070680_100155789 | 3300005336 | Bacteria | 1919 |
| 8 | Ga0068868_100011454 | 3300005338 | Bacteria | 6457 |
| 9 | Ga0070689_100054813 | 3300005340 | Bacteria | 3087 |
| 10 | Ga0070691_10047823 | 3300005341 | Bacteria | 2035 |
| 11 | Ga0070687_100021826 | 3300005343 | Bacteria | 3017 |
| 12 | Ga0070668_100007325 | 3300005347 | Bacteria | 8183 |
| 13 | Ga0070668_100078817 | 3300005347 | Bacteria | 2577 |
| 14 | Ga0070669_100022931 | 3300005353 | Bacteria | 4465 |
| 15 | Ga0070675_100024350 | 3300005354 | Unclassified | 4848 |
| 16 | Ga0070675_100042093 | 3300005354 | Bacteria | 3731 |
| 17 | Ga0070675_100062824 | 3300005354 | Bacteria | 3069 |
| 18 | Ga0070671_100079035 | 3300005355 | Bacteria | 2749 |
| 19 | Ga0070674_100108726 | 3300005356 | Bacteria | 2032 |
| 20 | Ga0070673_100008514 | 3300005364 | Bacteria | 6824 |
| 21 | Ga0070673_100058472 | 3300005364 | Unclassified | 3048 |
| 22 | Ga0070673_100302124 | 3300005364 | Unclassified | 1409 |
| 23 | Ga0070688_100004710 | 3300005365 | Bacteria | 7125 |
| 24 | Ga0070659_100064306 | 3300005366 | Bacteria | 2903 |
| 25 | Ga0070667_100031224 | 3300005367 | Bacteria | 4442 |
| 26 | Ga0070709_10045979 | 3300005434 | Bacteria | 2712 |
| 27 | Ga0070714_100050211 | 3300005435 | Bacteria | 3552 |
| 28 | Ga0070714_100105572 | 3300005435 | Bacteria | 2487 |
| 29 | Ga0070713_100003980 | 3300005436 | Bacteria | 9831 |
| 30 | Ga0070713_100168536 | 3300005436 | Bacteria | 1960 |
| 31 | Ga0070710_10059484 | 3300005437 | Bacteria | 2170 |
| 32 | Ga0070710_10070786 | 3300005437 | Bacteria | 2009 |
| 33 | Ga0070711_100050780 | 3300005439 | Bacteria | 2845 |
| 34 | Ga0070705_100249781 | 3300005440 | Bacteria | 1244 |
| 35 | Ga0070708_100037522 | 3300005445 | Bacteria | 4228 |
| 36 | Ga0070662_100018341 | 3300005457 | Bacteria | 4733 |
| 37 | Ga0070681_10039100 | 3300005458 | Bacteria | 4756 |
| 38 | Ga0070681_10122131 | 3300005458 | Bacteria | 2538 |
| 39 | Ga0068867_100021193 | 3300005459 | Bacteria | 4635 |
| 40 | Ga0070685_10001171 | 3300005466 | Bacteria | 14029 |
| 41 | Ga0070685_10304865 | 3300005466 | Unclassified | 1074 |
| 42 | Ga0070706_100077372 | 3300005467 | Bacteria | 3079 |
| 43 | Ga0070706_100081629 | 3300005467 | Bacteria | 2994 |
| 44 | Ga0070707_100095535 | 3300005468 | Bacteria | 2878 |
| 45 | Ga0070698_100085313 | 3300005471 | Bacteria | 3145 |
| 46 | Ga0070699_100104622 | 3300005518 | Bacteria | 2482 |
| 47 | Ga0070679_100029030 | 3300005530 | Bacteria | 5456 |
| 48 | Ga0068853_100016433 | 3300005539 | Bacteria | 6090 |
| 49 | Ga0068853_100042692 | 3300005539 | Bacteria | 3878 |
| 50 | Ga0070672_100029922 | 3300005543 | Bacteria | 4087 |
| 51 | Ga0070672_100037830 | 3300005543 | Bacteria | 3683 |
| 52 | Ga0070686_100011380 | 3300005544 | Bacteria | 5045 |
| 53 | Ga0070693_100109815 | 3300005547 | Bacteria | 1695 |
| 54 | Ga0070693_100112683 | 3300005547 | Bacteria | 1676 |
| 55 | Ga0070665_100000480 | 3300005548 | Bacteria | 57573 |
| 56 | Ga0070665_100030885 | 3300005548 | Bacteria | 5391 |
| 57 | Ga0070665_100189278 | 3300005548 | Bacteria | 2059 |
| 58 | Ga0068855_100307625 | 3300005563 | Bacteria | 1754 |
| 59 | Ga0068857_100084989 | 3300005577 | Bacteria | 2828 |
| 60 | Ga0068854_100040631 | 3300005578 | Bacteria | 3283 |
| 61 | Ga0068854_100065890 | 3300005578 | Bacteria | 2634 |
| 62 | Ga0068856_100081796 | 3300005614 | Bacteria | 3205 |
| 63 | Ga0070702_100004612 | 3300005615 | Bacteria | 6314 |
| 64 | Ga0070702_100085456 | 3300005615 | Bacteria | 1900 |
| 65 | Ga0068852_100007804 | 3300005616 | Bacteria | 7836 |
| 66 | Ga0068859_100392298 | 3300005617 | Bacteria | 1484 |
| 67 | Ga0068859_100565548 | 3300005617 | Bacteria | 1231 |
| 68 | Ga0068858_100015491 | 3300005842 | Bacteria | 7170 |
| 69 | Ga0068860_100147599 | 3300005843 | Bacteria | 2263 |
| 70 | Ga0068862_100064653 | 3300005844 | Bacteria | 3149 |
| 71 | Ga0081455_10004299 | 3300005937 | Bacteria | 16034 |
| 72 | Ga0081455_10006696 | 3300005937 | Bacteria | 12314 |
| 73 | Ga0081538_10045198 | 3300005981 | Bacteria | 2733 |
| 74 | Ga0070717_10039624 | 3300006028 | Bacteria | 3834 |
| 75 | Ga0075365_10008953 | 3300006038 | Bacteria | 5721 |
| 76 | Ga0075365_10042747 | 3300006038 | Bacteria | 2964 |
| 77 | Ga0075363_100012028 | 3300006048 | Bacteria | 4160 |
| 78 | Ga0075363_100026617 | 3300006048 | Bacteria | 2960 |
| 79 | Ga0070716_100006047 | 3300006173 | Bacteria | 5898 |
| 80 | Ga0070716_100016230 | 3300006173 | Bacteria | 3839 |
| 81 | Ga0070712_100080586 | 3300006175 | Bacteria | 2356 |
| 82 | Ga0070712_100199875 | 3300006175 | Bacteria | 1569 |
| 83 | Ga0075362_10000064 | 3300006177 | Bacteria | 30699 |
| 84 | Ga0075369_10000970 | 3300006186 | Bacteria | 9559 |
| 85 | Ga0075366_10000133 | 3300006195 | Bacteria | 31068 |
| 86 | Ga0075366_10127229 | 3300006195 | Bacteria | 1537 |
| 87 | Ga0097621_100079555 | 3300006237 | Bacteria | 2725 |
| 88 | Ga0075370_10000015 | 3300006353 | Bacteria | 62164 |
| 89 | Ga0075428_100010090 | 3300006844 | Bacteria | 10492 |
| 90 | Ga0075428_100012540 | 3300006844 | Bacteria | 9424 |
| 91 | Ga0075431_100000539 | 3300006847 | Bacteria | 31835 |
| 92 | Ga0075433_10189602 | 3300006852 | Bacteria | 1829 |
| 93 | Ga0075434_100059274 | 3300006871 | Bacteria | 3805 |
| 94 | Ga0075434_100108078 | 3300006871 | Bacteria | 2792 |
| 95 | Ga0075429_100012060 | 3300006880 | Bacteria | 7490 |
| 96 | Ga0068865_100081970 | 3300006881 | Bacteria | 2318 |
| 97 | Ga0097620_100392279 | 3300006931 | Bacteria | 1484 |
| 98 | Ga0097620_100565534 | 3300006931 | Bacteria | 1231 |
| 99 | Ga0105240_10037276 | 3300009093 | Bacteria | 6250 |
| 100 | Ga0105240_10303746 | 3300009093 | Bacteria | 1825 |
| 101 | Ga0111539_10002861 | 3300009094 | Bacteria | 22927 |
| 102 | Ga0111539_10024707 | 3300009094 | Bacteria | 7370 |
| 103 | Ga0111539_10143292 | 3300009094 | Bacteria | 2797 |
| 104 | Ga0105245_10015600 | 3300009098 | Bacteria | 6626 |
| 105 | Ga0105245_10045784 | 3300009098 | Bacteria | 3908 |
| 106 | Ga0105245_10225589 | 3300009098 | Bacteria | 1810 |
| 107 | Ga0105247_10133073 | 3300009101 | Bacteria | 1622 |
| 108 | Ga0114129_10000022 | 3300009147 | Bacteria | 119291 |
| 109 | Ga0114129_10004925 | 3300009147 | Bacteria | 18843 |
| 110 | Ga0114129_10033614 | 3300009147 | Bacteria | 7245 |
| 111 | Ga0105243_10113459 | 3300009148 | Bacteria | 2273 |
| 112 | Ga0105241_10335299 | 3300009174 | Bacteria | 1308 |
| 113 | Ga0105248_10075373 | 3300009177 | Unclassified | 3792 |
| 114 | Ga0105237_10007152 | 3300009545 | Bacteria | 12265 |
| 115 | Ga0105238_10022052 | 3300009551 | Bacteria | 6491 |
| 116 | Ga0105239_10001812 | 3300010375 | Bacteria | 28030 |
| 117 | Ga0105239_10299087 | 3300010375 | Bacteria | 1812 |
| 118 | Ga0157370_10056148 | 3300013104 | Bacteria | 3748 |
| 119 | Ga0157369_10003746 | 3300013105 | Bacteria | 18062 |
| 120 | Ga0157369_10089151 | 3300013105 | Bacteria | 3293 |
| 121 | Ga0157374_10012484 | 3300013296 | Bacteria | 7394 |
| 122 | Ga0157378_10037715 | 3300013297 | Bacteria | 4283 |
| 123 | Ga0163162_10023573 | 3300013306 | Bacteria | 6075 |
| 124 | Ga0163162_10036076 | 3300013306 | Bacteria | 4927 |
| 125 | Ga0163162_10078319 | 3300013306 | Bacteria | 3370 |
| 126 | Ga0163162_10141185 | 3300013306 | Bacteria | 2522 |
| 127 | Ga0157372_10004426 | 3300013307 | Bacteria | 14985 |
| 128 | Ga0157375_10025302 | 3300013308 | Bacteria | 5512 |
| 129 | Ga0157375_10025462 | 3300013308 | Bacteria | 5498 |
| 130 | Ga0157375_10100937 | 3300013308 | Unclassified | 2967 |
| 131 | Ga0157380_10011968 | 3300014326 | Bacteria | 6277 |
| 132 | Ga0157379_10076556 | 3300014968 | Bacteria | 2996 |
| 133 | Ga0157379_10089475 | 3300014968 | Bacteria | 2762 |
| 134 | Ga0163161_10041130 | 3300017792 | Bacteria | 3321 |
| 135 | Ga0206356_10237658 | 3300020070 | Bacteria | 1959 |
| 136 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 137 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 138 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 139 | Ga0213872_10000009 | 3300021361 | Bacteria | 221470 |
| 140 | Ga0213875_10000441 | 3300021388 | Bacteria | 36344 |
| 141 | Ga0209148_1001585 | 3300025254 | Bacteria | 10738 |
| 142 | Ga0207666_1004907 | 3300025271 | Bacteria | 1693 |
| 143 | Ga0209455_1001650 | 3300025272 | Bacteria | 9682 |
| 144 | Ga0207697_10002652 | 3300025315 | Bacteria | 9157 |
| 145 | Ga0207682_10092479 | 3300025893 | Bacteria | 1313 |
| 146 | Ga0207642_10000663 | 3300025899 | Bacteria | 10572 |
| 147 | Ga0207680_10119224 | 3300025903 | Bacteria | 1723 |
| 148 | Ga0207685_10027317 | 3300025905 | Bacteria | 1996 |
| 149 | Ga0207699_10016879 | 3300025906 | Bacteria | 3829 |
| 150 | Ga0207699_10067590 | 3300025906 | Bacteria | 2173 |
| 151 | Ga0207699_10135913 | 3300025906 | Bacteria | 1610 |
| 152 | Ga0207645_10003279 | 3300025907 | Bacteria | 12343 |
| 153 | Ga0207645_10031750 | 3300025907 | Bacteria | 3396 |
| 154 | Ga0207643_10001981 | 3300025908 | Bacteria | 11312 |
| 155 | Ga0207705_10073107 | 3300025909 | Bacteria | 2487 |
| 156 | Ga0207684_10039078 | 3300025910 | Bacteria | 4026 |
| 157 | Ga0207684_10117954 | 3300025910 | Bacteria | 2274 |
| 158 | Ga0207671_10007477 | 3300025914 | Bacteria | 9477 |
| 159 | Ga0207693_10013375 | 3300025915 | Bacteria | 6617 |
| 160 | Ga0207693_10016106 | 3300025915 | Bacteria | 5983 |
| 161 | Ga0207663_10219767 | 3300025916 | Bacteria | 1382 |
| 162 | Ga0207660_10086773 | 3300025917 | Bacteria | 2311 |
| 163 | Ga0207662_10033230 | 3300025918 | Bacteria | 3005 |
| 164 | Ga0207657_10115614 | 3300025919 | Bacteria | 2211 |
| 165 | Ga0207652_10038399 | 3300025921 | Bacteria | 4059 |
| 166 | Ga0207681_10022059 | 3300025923 | Unclassified | 4056 |
| 167 | Ga0207694_10073396 | 3300025924 | Bacteria | 2677 |
| 168 | Ga0207694_10325427 | 3300025924 | Bacteria | 1269 |
| 169 | Ga0207650_10034931 | 3300025925 | Unclassified | 3648 |
| 170 | Ga0207650_10197172 | 3300025925 | Bacteria | 1611 |
| 171 | Ga0207659_10009790 | 3300025926 | Bacteria | 5996 |
| 172 | Ga0207700_10021925 | 3300025928 | Bacteria | 4373 |
| 173 | Ga0207700_10074989 | 3300025928 | Bacteria | 2619 |
| 174 | Ga0207644_10037021 | 3300025931 | Unclassified | 3429 |
| 175 | Ga0207644_10199627 | 3300025931 | Bacteria | 1577 |
| 176 | Ga0207690_10122662 | 3300025932 | Bacteria | 1890 |
| 177 | Ga0207706_10022590 | 3300025933 | Bacteria | 5646 |
| 178 | Ga0207706_10050869 | 3300025933 | Bacteria | 3660 |
| 179 | Ga0207706_10054668 | 3300025933 | Bacteria | 3523 |
| 180 | Ga0207704_10018307 | 3300025938 | Bacteria | 3653 |
| 181 | Ga0207665_10005228 | 3300025939 | Bacteria | 8669 |
| 182 | Ga0207665_10008286 | 3300025939 | Bacteria | 6862 |
| 183 | Ga0207691_10010912 | 3300025940 | Bacteria | 8721 |
| 184 | Ga0207691_10016004 | 3300025940 | Bacteria | 7123 |
| 185 | Ga0207691_10024234 | 3300025940 | Bacteria | 5707 |
| 186 | Ga0207711_10132223 | 3300025941 | Bacteria | 2238 |
| 187 | Ga0207661_10164492 | 3300025944 | Bacteria | 1927 |
| 188 | Ga0207679_10053057 | 3300025945 | Bacteria | 2977 |
| 189 | Ga0207651_10046925 | 3300025960 | Bacteria | 2909 |
| 190 | Ga0207651_10075649 | 3300025960 | Bacteria | 2403 |
| 191 | Ga0207712_10016384 | 3300025961 | Bacteria | 4798 |
| 192 | Ga0207668_10006102 | 3300025972 | Bacteria | 7107 |
| 193 | Ga0207668_10125580 | 3300025972 | Bacteria | 1950 |
| 194 | Ga0207677_10017382 | 3300026023 | Bacteria | 4286 |
| 195 | Ga0207703_10025445 | 3300026035 | Bacteria | 4655 |
| 196 | Ga0207678_10014386 | 3300026067 | Bacteria | 6957 |
| 197 | Ga0207708_10004345 | 3300026075 | Bacteria | 10438 |
| 198 | Ga0207702_10092706 | 3300026078 | Bacteria | 2648 |
| 199 | Ga0207641_10011439 | 3300026088 | Bacteria | 7284 |
| 200 | Ga0207648_10026529 | 3300026089 | Bacteria | 5147 |
| 201 | Ga0207676_10039419 | 3300026095 | Bacteria | 3613 |
| 202 | Ga0207674_10104069 | 3300026116 | Bacteria | 2818 |
| 203 | Ga0207675_100008646 | 3300026118 | Bacteria | 9572 |
| 204 | Ga0207683_10008830 | 3300026121 | Bacteria | 8595 |
| 205 | Ga0207683_10014227 | 3300026121 | Bacteria | 6778 |
| 206 | Ga0207698_10016507 | 3300026142 | Bacteria | 4979 |
| 207 | Ga0209983_1016162 | 3300027665 | Bacteria | 1540 |
| 208 | Ga0209974_10005807 | 3300027876 | Bacteria | 4328 |
| 209 | Ga0207428_10019476 | 3300027907 | Bacteria | 5786 |
| 210 | Ga0207428_10046797 | 3300027907 | Bacteria | 3477 |
| 211 | Ga0268266_10000337 | 3300028379 | Bacteria | 73510 |
| 212 | Ga0268266_10000606 | 3300028379 | Bacteria | 48985 |
| 213 | Ga0268266_10148940 | 3300028379 | Bacteria | 2107 |
| 214 | Ga0265319_1026431 | 3300028563 | Bacteria | 2068 |
| 215 | Ga0265318_10000416 | 3300028577 | Bacteria | 32874 |
| 216 | Ga0265338_10057527 | 3300028800 | Bacteria | 3439 |
| 217 | Ga0265338_10112798 | 3300028800 | Bacteria | 2185 |
| 218 | Ga0265770_1009849 | 3300030878 | Bacteria | 1382 |
| 219 | Ga0265330_10000017 | 3300031235 | Bacteria | 166302 |
| 220 | Ga0265332_10000377 | 3300031238 | Bacteria | 32863 |
| 221 | Ga0265328_10004344 | 3300031239 | Bacteria | 6163 |
| 222 | Ga0265328_10077757 | 3300031239 | Bacteria | 1222 |
| 223 | Ga0265320_10000005 | 3300031240 | Bacteria | 354422 |
| 224 | Ga0265320_10010637 | 3300031240 | Bacteria | 5461 |
| 225 | Ga0265320_10125895 | 3300031240 | Bacteria | 1166 |
| 226 | Ga0265325_10011890 | 3300031241 | Bacteria | 4991 |
| 227 | Ga0265325_10078422 | 3300031241 | Bacteria | 1645 |
| 228 | Ga0265329_10007200 | 3300031242 | Bacteria | 4326 |
| 229 | Ga0265329_10020640 | 3300031242 | Bacteria | 2222 |
| 230 | Ga0265340_10001786 | 3300031247 | Bacteria | 12273 |
| 231 | Ga0265339_10000503 | 3300031249 | Bacteria | 30482 |
| 232 | Ga0265339_10004692 | 3300031249 | Bacteria | 9274 |
| 233 | Ga0265331_10000013 | 3300031250 | Bacteria | 296011 |
| 234 | Ga0265316_10004173 | 3300031344 | Bacteria | 14441 |
| 235 | Ga0265316_10021355 | 3300031344 | Bacteria | 5484 |
| 236 | Ga0265316_10049102 | 3300031344 | Bacteria | 3325 |
| 237 | Ga0265316_10228012 | 3300031344 | Bacteria | 1373 |
| 238 | Ga0265313_10000097 | 3300031595 | Bacteria | 89295 |
| 239 | Ga0265313_10000099 | 3300031595 | Bacteria | 88958 |
| 240 | Ga0265313_10005975 | 3300031595 | Bacteria | 8796 |
| 241 | Ga0265313_10059424 | 3300031595 | Bacteria | 1798 |
| 242 | Ga0265314_10000024 | 3300031711 | Bacteria | 295216 |
| 243 | Ga0265314_10003766 | 3300031711 | Bacteria | 14503 |
| 244 | Ga0265314_10005117 | 3300031711 | Bacteria | 11938 |
| 245 | Ga0265342_10002370 | 3300031712 | Bacteria | 16323 |
| 246 | Ga0265342_10005024 | 3300031712 | Bacteria | 10203 |
| 247 | Ga0265342_10019371 | 3300031712 | Bacteria | 4387 |
| 248 | Ga0316576_10073460 | 3300031727 | Bacteria | 2527 |
| 249 | Ga0307516_10121407 | 3300031730 | Bacteria | 2403 |
| 250 | Ga0307412_10014108 | 3300031911 | Bacteria | 4705 |
| 251 | Ga0307409_100544042 | 3300031995 | Bacteria | 1139 |
| 252 | Ga0373948_0017063 | 3300034817 | Bacteria | 1349 |
| 253 | Ga0373934_0004110 | 3300035086 | Bacteria | 5365 |
| 254 | Ga0373944_0115538 | 3300035089 | Bacteria | 920 |
| 255 | Ga0373956_0000012 | 3300035119 | Bacteria | 57485 |
| 256 | Ga0373957_0025878 | 3300035120 | Bacteria | 2118 |
| 257 | Ga0373946_0195961 | 3300035171 | Bacteria | 965 |
| 258 | Ga0316574_0052919 | 3300035398 | Bacteria | 2533 |
| 259 | Ga0373931_0043465 | 3300035691 | Bacteria | 2366 |
| 260 | Ga0373931_0175442 | 3300035691 | Bacteria | 1266 |
| 261 | Ga0373927_0037992 | 3300035695 | Bacteria | 3128 |
| 262 | Ga0373927_0040134 | 3300035695 | Bacteria | 3037 |
| 263 | Ga0373927_0135580 | 3300035695 | Unclassified | 1609 |
| 264 | Ga0373933_0000864 | 3300035724 | Bacteria | 18577 |
| 265 | Ga0373933_0041406 | 3300035724 | Bacteria | 2719 |
| 266 | Ga0373933_0145253 | 3300035724 | Unclassified | 1500 |
| 267 | Ga0373937_0000290 | 3300036401 | Bacteria | 47834 |
| 268 | Ga0373937_0002217 | 3300036401 | Bacteria | 16235 |
| 269 | Ga0373937_0025248 | 3300036401 | Bacteria | 5365 |
| 270 | Ga0373925_0043361 | 3300037068 | Bacteria | 3338 |
| 271 | Ga0373925_0118084 | 3300037068 | Bacteria | 2056 |
| 272 | Ga0395905_0007584 | 3300037471 | Bacteria | 10776 |
| 273 | Ga0436364_1503727 | 3300037853 | Bacteria | 47109 |
| 274 | Ga0395901_0254266 | 3300038443 | Bacteria | 1830 |
| 275 | Ga0436361_0572581 | 3300039447 | Bacteria | 116104 |
| 276 | Ga0436363_1182562 | 3300039450 | Bacteria | 2377 |
| 277 | Ga0439449_0018286 | 3300042007 | Bacteria | 2631 |
| 278 | Ga0466965_0006986 | 3300044683 | Bacteria | 5165 |
| 279 | Ga0495603_0032014 | 3300046455 | Bacteria | 3165 |
| 280 | Ga0495638_0067742 | 3300046460 | Bacteria | 2191 |
| 281 | Ga0495641_0015404 | 3300046461 | Bacteria | 4084 |
| 282 | Ga0495641_0036545 | 3300046461 | Bacteria | 2308 |
| 283 | Ga0495651_0000027 | 3300046462 | Bacteria | 107496 |
| 284 | Ga0495580_0138910 | 3300046472 | Bacteria | 1685 |
| 285 | Ga0495582_0009777 | 3300046473 | Bacteria | 5283 |
| 286 | Ga0495639_0063149 | 3300046475 | Bacteria | 1700 |
| 287 | Ga0495639_0237832 | 3300046475 | Bacteria | 898 |
| 288 | Ga0495584_0027065 | 3300046491 | Bacteria | 2906 |
| 289 | Ga0495584_0081992 | 3300046491 | Bacteria | 1624 |
| 290 | Ga0495585_0054470 | 3300046492 | Bacteria | 2211 |
| 291 | Ga0495594_0062425 | 3300046499 | Bacteria | 2063 |
| 292 | Ga0495607_0051103 | 3300046501 | Bacteria | 2402 |
| 293 | Ga0495607_0053690 | 3300046501 | Bacteria | 2326 |
| 294 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 295 | Ga0495608_0136129 | 3300046511 | Bacteria | 1570 |
| 296 | Ga0495610_0040331 | 3300046512 | Bacteria | 2354 |
| 297 | Ga0495616_0077163 | 3300046513 | Bacteria | 1599 |
| 298 | Ga0495644_0003141 | 3300046523 | Bacteria | 6533 |
| 299 | Ga0495644_0010467 | 3300046523 | Bacteria | 3574 |
| 300 | Ga0495644_0018121 | 3300046523 | Bacteria | 2689 |
| 301 | Ga0495648_0000666 | 3300046524 | Bacteria | 36662 |
| 302 | Ga0495648_0010028 | 3300046524 | Bacteria | 7263 |
| 303 | Ga0495663_0019555 | 3300046525 | Bacteria | 1940 |
| 304 | Ga0495666_0008724 | 3300046526 | Bacteria | 5078 |
| 305 | Ga0495640_0238025 | 3300046533 | Bacteria | 1143 |
| 306 | Ga0495586_0010466 | 3300046535 | Unclassified | 4931 |
| 307 | Ga0495598_0003016 | 3300046537 | Bacteria | 3534 |
| 308 | Ga0495645_0021304 | 3300046543 | Bacteria | 4684 |
| 309 | Ga0495622_0017161 | 3300046557 | Bacteria | 3370 |
| 310 | Ga0495633_0007501 | 3300046558 | Bacteria | 6270 |
| 311 | Ga0495633_0007691 | 3300046558 | Bacteria | 6167 |
| 312 | Ga0495633_0065546 | 3300046558 | Bacteria | 1697 |
| 313 | Ga0495656_0009452 | 3300046615 | Bacteria | 3505 |
| 314 | Ga0495656_0018819 | 3300046615 | Bacteria | 2658 |
| 315 | Ga0495656_0021900 | 3300046615 | Bacteria | 2494 |
| 316 | Ga0495656_0043228 | 3300046615 | Bacteria | 1891 |
| 317 | Ga0495611_0007280 | 3300046648 | Bacteria | 4701 |
| 318 | Ga0495611_0011620 | 3300046648 | Bacteria | 3734 |
| 319 | Ga0495625_0017425 | 3300046660 | Bacteria | 5624 |
| 320 | Ga0495659_0000707 | 3300046664 | Bacteria | 11994 |
| 321 | Ga0495588_0128568 | 3300046674 | Bacteria | 1336 |
| 322 | Ga0495647_0027688 | 3300046681 | Bacteria | 2084 |
| 323 | Ga0495658_0012575 | 3300046683 | Bacteria | 4292 |
| 324 | Ga0495658_0052782 | 3300046683 | Bacteria | 2307 |
| 325 | Ga0495624_0021988 | 3300046690 | Bacteria | 4223 |
| 326 | Ga0495670_0036849 | 3300046691 | Bacteria | 2437 |
| 327 | Ga0495670_0059418 | 3300046691 | Bacteria | 1919 |
| 328 | Ga0495671_0014428 | 3300046692 | Bacteria | 4252 |
| 329 | Ga0495671_0083344 | 3300046692 | Bacteria | 1567 |
| 330 | Ga0495649_0155776 | 3300046694 | Bacteria | 1199 |
| 331 | Ga0495589_0082895 | 3300046794 | Bacteria | 1559 |
| 332 | Ga0495581_0102720 | 3300047315 | Bacteria | 1661 |
| 333 | Ga0495636_0001462 | 3300047318 | Bacteria | 8953 |
| 334 | Ga0495672_0056246 | 3300047320 | Bacteria | 2290 |
| 335 | Ga0495672_0082994 | 3300047320 | Bacteria | 1781 |
| 336 | Ga0495676_0069896 | 3300047321 | Bacteria | 2707 |
| 337 | Ga0495676_0130280 | 3300047321 | Bacteria | 1817 |
| 338 | Ga0495683_0009603 | 3300047323 | Bacteria | 5151 |
| 339 | Ga0495687_000186 | 3300047443 | Bacteria | 90747 |
| 340 | Ga0495677_0002963 | 3300047445 | Bacteria | 6600 |
| 341 | Ga0495677_0104713 | 3300047445 | Bacteria | 1073 |
| 342 | Ga0495685_000004 | 3300047447 | Bacteria | 115775 |
| 343 | Ga0495673_0003193 | 3300047469 | Bacteria | 10954 |
| 344 | Ga0495684_0186389 | 3300047471 | Bacteria | 1536 |
| 345 | Ga0495686_0001559 | 3300047472 | Bacteria | 24441 |
| 346 | Ga0495593_0080589 | 3300047673 | Bacteria | 1684 |
| 347 | Ga0495615_0019121 | 3300048090 | Bacteria | 1517 |
| 348 | Ga0496100_0000926 | 3300048903 | Bacteria | 14006 |
| 349 | Ga0496100_0017908 | 3300048903 | Unclassified | 4191 |
| 350 | Ga0496101_0004982 | 3300048904 | Bacteria | 8431 |
| 351 | Ga0496101_0025741 | 3300048904 | Bacteria | 4084 |
| 352 | Ga0496102_0011303 | 3300048905 | Bacteria | 7690 |
| 353 | Ga0496102_0017840 | 3300048905 | Bacteria | 6223 |
| 354 | Ga0496102_0046048 | 3300048905 | Bacteria | 3961 |
| 355 | Ga0496102_0227294 | 3300048905 | Bacteria | 1759 |
| 356 | Ga0496103_0009246 | 3300048906 | Bacteria | 5838 |
| 357 | Ga0496103_0050706 | 3300048906 | Bacteria | 2567 |
| 358 | Ga0496104_0004884 | 3300048907 | Bacteria | 11686 |
| 359 | Ga0496104_0013227 | 3300048907 | Bacteria | 7439 |
| 360 | Ga0496104_0051729 | 3300048907 | Bacteria | 3878 |
| 361 | Ga0496104_0194138 | 3300048907 | Bacteria | 1942 |
| 362 | Ga0496105_0011257 | 3300048908 | Bacteria | 7060 |
| 363 | Ga0496105_0017989 | 3300048908 | Bacteria | 5672 |
| 364 | Ga0496105_0071516 | 3300048908 | Bacteria | 2867 |
| 365 | Ga0496105_0124675 | 3300048908 | Bacteria | 2123 |
| 366 | Ga0496106_0002648 | 3300048909 | Bacteria | 13321 |
| 367 | Ga0496106_0077588 | 3300048909 | Bacteria | 2547 |
| 368 | Ga0496106_0089326 | 3300048909 | Bacteria | 2376 |
| 369 | Ga0496107_0006507 | 3300048910 | Bacteria | 8033 |
| 370 | Ga0496107_0061237 | 3300048910 | Bacteria | 2724 |
| 371 | Ga0496108_0048658 | 3300048911 | Bacteria | 3544 |
| 372 | Ga0496108_0056126 | 3300048911 | Bacteria | 3308 |
| 373 | Ga0496108_0115429 | 3300048911 | Bacteria | 2299 |
| 374 | Ga0496109_0003628 | 3300048912 | Bacteria | 12895 |
| 375 | Ga0496109_0569181 | 3300048912 | Bacteria | 1068 |
| 376 | Ga0496110_0001389 | 3300048913 | Bacteria | 17461 |
| 377 | Ga0496110_0036172 | 3300048913 | Bacteria | 4287 |
| 378 | Ga0496110_0078212 | 3300048913 | Bacteria | 2944 |
| 379 | Ga0496110_0154569 | 3300048913 | Bacteria | 2078 |
| 380 | Ga0496111_0001694 | 3300048914 | Bacteria | 12851 |
| 381 | Ga0496111_0009894 | 3300048914 | Bacteria | 6372 |
| 382 | Ga0496112_0002700 | 3300048915 | Bacteria | 14347 |
| 383 | Ga0496112_0179265 | 3300048915 | Bacteria | 2082 |
| 384 | Ga0496112_0615672 | 3300048915 | Bacteria | 1017 |
| 385 | Ga0496113_0010454 | 3300048916 | Bacteria | 6136 |
| 386 | Ga0496113_0087067 | 3300048916 | Bacteria | 2401 |
| 387 | Ga0496113_0091530 | 3300048916 | Bacteria | 2344 |
| 388 | Ga0496114_0009376 | 3300048917 | Bacteria | 7771 |
| 389 | Ga0496114_0119166 | 3300048917 | Bacteria | 2268 |
| 390 | Ga0496115_0011961 | 3300048918 | Bacteria | 6519 |
| 391 | Ga0496115_0012246 | 3300048918 | Bacteria | 6451 |
| 392 | Ga0496115_0120309 | 3300048918 | Bacteria | 2160 |
| 393 | Ga0496115_0223088 | 3300048918 | Bacteria | 1555 |
| 394 | Ga0496117_0030523 | 3300048920 | Bacteria | 4134 |
| 395 | Ga0496118_0081976 | 3300048921 | Bacteria | 2262 |
| 396 | Ga0496120_0178889 | 3300048923 | Bacteria | 1043 |
| 397 | Ga0496121_0002757 | 3300048924 | Bacteria | 26099 |
| 398 | Ga0496121_0025130 | 3300048924 | Bacteria | 5666 |
| 399 | Ga0496121_0034562 | 3300048924 | Bacteria | 4549 |
| 400 | Ga0496121_0108796 | 3300048924 | Bacteria | 2120 |
| 401 | Ga0496122_0100886 | 3300048925 | Bacteria | 1930 |
| 402 | Ga0496125_0000516 | 3300048928 | Bacteria | 67232 |
| 403 | Ga0496125_0004324 | 3300048928 | Bacteria | 16489 |
| 404 | Ga0496125_0099189 | 3300048928 | Bacteria | 2152 |
| 405 | Ga0496126_0169495 | 3300048929 | Bacteria | 1861 |
| 406 | Ga0496126_0209135 | 3300048929 | Bacteria | 1643 |
| 407 | Ga0496126_0351183 | 3300048929 | Bacteria | 1206 |
| 408 | Ga0496126_0398322 | 3300048929 | Bacteria | 1117 |
| 409 | Ga0495682_0009039 | 3300049460 | Bacteria | 3909 |
| 410 | Ga0495682_0022741 | 3300049460 | Bacteria | 2343 |
| 411 | Ga0501032_0134647 | 3300049569 | Bacteria | 1629 |
| 412 | Ga0501034_0211599 | 3300049571 | Bacteria | 1894 |
| 413 | Ga0501034_0362266 | 3300049571 | Bacteria | 1377 |
| 414 | Ga0501037_0031800 | 3300049573 | Bacteria | 3896 |
| 415 | Ga0501046_0172835 | 3300049580 | Bacteria | 1620 |
| 416 | Ga0501047_0213390 | 3300049581 | Bacteria | 1788 |
| 417 | Ga0501069_0081533 | 3300049585 | Bacteria | 1822 |
| 418 | Ga0501070_0108420 | 3300049586 | Bacteria | 2294 |
| 419 | Ga0501070_0301693 | 3300049586 | Bacteria | 1305 |
| 420 | Ga0501072_0094232 | 3300049588 | Bacteria | 2379 |
| 421 | Ga0501076_0059236 | 3300049592 | Bacteria | 3046 |
| 422 | Ga0501207_010301 | 3300049654 | Bacteria | 1377 |
| 423 | Ga0501080_0107042 | 3300049742 | Bacteria | 2592 |
| 424 | Ga0501083_0094674 | 3300049744 | Bacteria | 1971 |
| 425 | Ga0501035_0212053 | 3300049822 | Bacteria | 1657 |
| 426 | Ga0501044_0027091 | 3300049823 | Bacteria | 6063 |
| 427 | nmdc:mga03683_113_c1 | 3300050489 | Bacteria | 27805 |
| 428 | nmdc:mga03n38_105637_c1 | 3300050490 | Bacteria | 1364 |
| 429 | nmdc:mga03n38_5448_c1 | 3300050490 | Bacteria | 4336 |
| 430 | nmdc:mga0yw44_17650_c1 | 3300050492 | Bacteria | 3889 |
| 431 | nmdc:mga0yw44_330905_c1 | 3300050492 | Bacteria | 1024 |
| 432 | nmdc:mga0yw44_580_c1 | 3300050492 | Bacteria | 13256 |
| 433 | nmdc:mga0yw44_9528_c1 | 3300050492 | Bacteria | 4918 |
| 434 | nmdc:mga0k408_9_c2 | 3300050493 | Bacteria | 64937 |
| 435 | nmdc:mga06z11_47831_c1 | 3300050494 | Bacteria | 2174 |
| 436 | nmdc:mga07m45_13_c1 | 3300050496 | Bacteria | 65600 |
| 437 | nmdc:mga05p37_11744_c1 | 3300050507 | Bacteria | 10440 |
| 438 | nmdc:mga05p37_48_c1 | 3300050507 | Bacteria | 104863 |
| 439 | nmdc:mga05p37_747_c1 | 3300050507 | Bacteria | 36024 |
| 440 | nmdc:mga09592_429128_c1 | 3300050508 | Bacteria | 1141 |
| 441 | nmdc:mga09592_723_c2 | 3300050508 | Bacteria | 15482 |
| 442 | nmdc:mga06r32_685_c1 | 3300050510 | Bacteria | 29517 |
| 443 | nmdc:mga08y16_147624_c1 | 3300050511 | Bacteria | 2444 |
| 444 | nmdc:mga08y16_151483_c1 | 3300050511 | Bacteria | 2410 |
| 445 | nmdc:mga08y16_2123_c1 | 3300050511 | Bacteria | 20323 |
| 446 | nmdc:mga08y16_232933_c1 | 3300050511 | Bacteria | 1905 |
| 447 | nmdc:mga08y16_67417_c1 | 3300050511 | Bacteria | 3733 |
| 448 | nmdc:mga0n895_474364_c1 | 3300050512 | Bacteria | 1262 |
| 449 | nmdc:mga0n895_504226_c1 | 3300050512 | Bacteria | 1219 |
| 450 | nmdc:mga0n895_96147_c1 | 3300050512 | Bacteria | 2967 |
| 451 | nmdc:mga08x19_236822_c1 | 3300050514 | Bacteria | 1257 |
| 452 | nmdc:mga0a205_252094_c1 | 3300050515 | Bacteria | 1644 |
| 453 | nmdc:mga0sz30_532_c1 | 3300050516 | Bacteria | 14177 |
| 454 | Ga0500646_0004337 | 3300053090 | Bacteria | 3592 |
| 455 | Ga0500651_0004411 | 3300053093 | Bacteria | 7873 |
| 456 | Ga0500566_0017693 | 3300053094 | Bacteria | 4186 |
| 457 | Ga0500650_0075241 | 3300053098 | Bacteria | 1579 |
| 458 | Ga0500554_077012 | 3300053102 | Bacteria | 1093 |
| 459 | Ga0500595_000393 | 3300053119 | Bacteria | 28109 |
| 460 | Ga0500608_000445 | 3300053122 | Bacteria | 15578 |
| 461 | Ga0500642_0009734 | 3300053130 | Bacteria | 3354 |
| 462 | Ga0500652_000932 | 3300053131 | Bacteria | 9668 |
| 463 | Ga0500652_049479 | 3300053131 | Bacteria | 1713 |
| 464 | Ga0500559_0000857 | 3300053136 | Bacteria | 19581 |
| 465 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 466 | Ga0500636_0003120 | 3300053177 | Bacteria | 9284 |
| 467 | Ga0530510_0037283 | 3300061734 | Bacteria | 3505 |
| 468 | Ga0530510_0192447 | 3300061734 | Bacteria | 1514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0041406 | Ga0373933_0041406_767_1786 | 253 |
| 2 | 3300036401 | Ga0373937_0002217 | Ga0373937_0002217_3417_4436 | 253 |
| 3 | 3300047673 | Ga0495593_0080589 | Ga0495593_0080589_854_1669 | 253 |
| 4 | 3300048907 | Ga0496104_0194138 | Ga0496104_0194138_1116_1931 | 253 |
| 5 | 3300031242 | Ga0265329_10020640 | Ga0265329_100206402 | 254 |
| 6 | 3300047315 | Ga0495581_0102720 | Ga0495581_0102720_722_1648 | 255 |
| 7 | 3300049586 | Ga0501070_0301693 | Ga0501070_0301693_233_1195 | 255 |
| 8 | 3300049742 | Ga0501080_0107042 | Ga0501080_0107042_1064_1885 | 255 |
| 9 | 3300005457 | Ga0070662_100018341 | Ga0070662_1000183411 | 256 |
| 10 | 3300025933 | Ga0207706_10050869 | Ga0207706_100508692 | 256 |
| 11 | 3300025945 | Ga0207679_10053057 | Ga0207679_100530573 | 256 |
| 12 | 3300035086 | Ga0373934_0004110 | Ga0373934_0004110_1933_2850 | 256 |
| 13 | 3300035119 | Ga0373956_0000012 | Ga0373956_0000012_25043_25960 | 256 |
| 14 | 3300035120 | Ga0373957_0025878 | Ga0373957_0025878_766_1683 | 256 |
| 15 | 3300035724 | Ga0373933_0000864 | Ga0373933_0000864_14198_15115 | 256 |
| 16 | 3300036401 | Ga0373937_0000290 | Ga0373937_0000290_4644_5561 | 256 |
| 17 | 3300037471 | Ga0395905_0007584 | Ga0395905_0007584_5459_6406 | 256 |
| 18 | 3300046462 | Ga0495651_0000027 | Ga0495651_0000027_102649_103566 | 256 |
| 19 | 3300046511 | Ga0495608_0136129 | Ga0495608_0136129_640_1557 | 256 |
| 20 | 3300049592 | Ga0501076_0059236 | Ga0501076_0059236_1195_2142 | 256 |
| 21 | 3300050512 | nmdc:mga0n895_96147_c1 | nmdc:mga0n895_96147_c1_1628_2596 | 256 |
| 22 | 3300061734 | Ga0530510_0037283 | Ga0530510_0037283_1208_2155 | 256 |
| 23 | 3300031240 | Ga0265320_10125895 | Ga0265320_101258952 | 257 |
| 24 | 3300031344 | Ga0265316_10228012 | Ga0265316_102280121 | 257 |
| 25 | 3300009101 | Ga0105247_10133073 | Ga0105247_101330731 | 258 |
| 26 | 3300009147 | Ga0114129_10033614 | Ga0114129_100336147 | 258 |
| 27 | 3300027907 | Ga0207428_10046797 | Ga0207428_100467971 | 258 |
| 28 | 3300038443 | Ga0395901_0254266 | Ga0395901_0254266_290_1210 | 258 |
| 29 | 3300050507 | nmdc:mga05p37_11744_c1 | nmdc:mga05p37_11744_c1_615_1565 | 258 |
| 30 | 3300050511 | nmdc:mga08y16_67417_c1 | nmdc:mga08y16_67417_c1_2247_3197 | 258 |
| 31 | 3300053177 | Ga0500636_0003120 | Ga0500636_0003120_7095_7955 | 258 |
| 32 | 3300005436 | Ga0070713_100168536 | Ga0070713_1001685362 | 259 |
| 33 | 3300005445 | Ga0070708_100037522 | Ga0070708_1000375223 | 259 |
| 34 | 3300005467 | Ga0070706_100081629 | Ga0070706_1000816294 | 259 |
| 35 | 3300005468 | Ga0070707_100095535 | Ga0070707_1000955352 | 259 |
| 36 | 3300005471 | Ga0070698_100085313 | Ga0070698_1000853132 | 259 |
| 37 | 3300005518 | Ga0070699_100104622 | Ga0070699_1001046221 | 259 |
| 38 | 3300025910 | Ga0207684_10039078 | Ga0207684_100390783 | 259 |
| 39 | 3300028563 | Ga0265319_1026431 | Ga0265319_10264312 | 259 |
| 40 | 3300028800 | Ga0265338_10112798 | Ga0265338_101127982 | 259 |
| 41 | 3300031240 | Ga0265320_10010637 | Ga0265320_100106371 | 259 |
| 42 | 3300031241 | Ga0265325_10078422 | Ga0265325_100784221 | 259 |
| 43 | 3300031595 | Ga0265313_10059424 | Ga0265313_100594241 | 259 |
| 44 | 3300031727 | Ga0316576_10073460 | Ga0316576_100734603 | 259 |
| 45 | 3300046524 | Ga0495648_0010028 | Ga0495648_0010028_1632_2651 | 259 |
| 46 | 3300046615 | Ga0495656_0018819 | Ga0495656_0018819_121_1101 | 259 |
| 47 | 3300047471 | Ga0495684_0186389 | Ga0495684_0186389_30_980 | 259 |
| 48 | 3300048090 | Ga0495615_0019121 | Ga0495615_0019121_166_1146 | 259 |
| 49 | 3300048913 | Ga0496110_0036172 | Ga0496110_0036172_1911_2846 | 259 |
| 50 | 3300049569 | Ga0501032_0134647 | Ga0501032_0134647_535_1497 | 259 |
| 51 | 3300049654 | Ga0501207_010301 | Ga0501207_010301_350_1348 | 259 |
| 52 | 3300031911 | Ga0307412_10014108 | Ga0307412_100141083 | 260 |
| 53 | 3300035695 | Ga0373927_0037992 | Ga0373927_0037992_1093_2064 | 260 |
| 54 | 3300046475 | Ga0495639_0063149 | Ga0495639_0063149_228_1199 | 260 |
| 55 | 3300046526 | Ga0495666_0008724 | Ga0495666_0008724_2890_3861 | 260 |
| 56 | 3300046557 | Ga0495622_0017161 | Ga0495622_0017161_949_1911 | 260 |
| 57 | 3300053094 | Ga0500566_0017693 | Ga0500566_0017693_1432_2394 | 260 |
| 58 | 3300053102 | Ga0500554_077012 | Ga0500554_077012_53_1015 | 260 |
| 59 | 3300053131 | Ga0500652_049479 | Ga0500652_049479_400_1236 | 260 |
| 60 | 3300006048 | Ga0075363_100026617 | Ga0075363_1000266173 | 261 |
| 61 | 3300006871 | Ga0075434_100108078 | Ga0075434_1001080781 | 261 |
| 62 | 3300009094 | Ga0111539_10024707 | Ga0111539_100247072 | 261 |
| 63 | 3300013306 | Ga0163162_10141185 | Ga0163162_101411852 | 261 |
| 64 | 3300035691 | Ga0373931_0175442 | Ga0373931_0175442_102_1052 | 261 |
| 65 | 3300048905 | Ga0496102_0227294 | Ga0496102_0227294_611_1561 | 261 |
| 66 | 3300048906 | Ga0496103_0009246 | Ga0496103_0009246_2840_3790 | 261 |
| 67 | 3300048907 | Ga0496104_0013227 | Ga0496104_0013227_4074_5024 | 261 |
| 68 | 3300048908 | Ga0496105_0011257 | Ga0496105_0011257_3492_4442 | 261 |
| 69 | 3300048909 | Ga0496106_0077588 | Ga0496106_0077588_477_1427 | 261 |
| 70 | 3300048910 | Ga0496107_0061237 | Ga0496107_0061237_232_1182 | 261 |
| 71 | 3300048911 | Ga0496108_0048658 | Ga0496108_0048658_2557_3507 | 261 |
| 72 | 3300048912 | Ga0496109_0003628 | Ga0496109_0003628_7926_8876 | 261 |
| 73 | 3300048913 | Ga0496110_0078212 | Ga0496110_0078212_1303_2253 | 261 |
| 74 | 3300048914 | Ga0496111_0001694 | Ga0496111_0001694_11252_12202 | 261 |
| 75 | 3300048915 | Ga0496112_0002700 | Ga0496112_0002700_7432_8382 | 261 |
| 76 | 3300048916 | Ga0496113_0010454 | Ga0496113_0010454_4146_5096 | 261 |
| 77 | 3300048918 | Ga0496115_0120309 | Ga0496115_0120309_275_1225 | 261 |
| 78 | 3300048929 | Ga0496126_0169495 | Ga0496126_0169495_831_1784 | 261 |
| 79 | 3300048929 | Ga0496126_0351183 | Ga0496126_0351183_250_1185 | 261 |
| 80 | 3300050490 | nmdc:mga03n38_105637_c1 | nmdc:mga03n38_105637_c1_58_1029 | 261 |
| 81 | 3300050512 | nmdc:mga0n895_474364_c1 | nmdc:mga0n895_474364_c1_285_1220 | 261 |
| 82 | 3300005334 | Ga0068869_100368353 | Ga0068869_1003683531 | 262 |
| 83 | 3300005467 | Ga0070706_100077372 | Ga0070706_1000773724 | 262 |
| 84 | 3300025910 | Ga0207684_10117954 | Ga0207684_101179542 | 262 |
| 85 | 3300028577 | Ga0265318_10000416 | Ga0265318_1000041611 | 262 |
| 86 | 3300031235 | Ga0265330_10000017 | Ga0265330_1000001738 | 262 |
| 87 | 3300031238 | Ga0265332_10000377 | Ga0265332_1000037724 | 262 |
| 88 | 3300031239 | Ga0265328_10004344 | Ga0265328_100043442 | 262 |
| 89 | 3300031240 | Ga0265320_10000005 | Ga0265320_1000000569 | 262 |
| 90 | 3300031250 | Ga0265331_10000013 | Ga0265331_10000013190 | 262 |
| 91 | 3300031344 | Ga0265316_10004173 | Ga0265316_1000417310 | 262 |
| 92 | 3300031595 | Ga0265313_10000097 | Ga0265313_1000009775 | 262 |
| 93 | 3300031711 | Ga0265314_10000024 | Ga0265314_1000002470 | 262 |
| 94 | 3300031712 | Ga0265342_10005024 | Ga0265342_1000502412 | 262 |
| 95 | 3300046472 | Ga0495580_0138910 | Ga0495580_0138910_170_1141 | 262 |
| 96 | 3300046475 | Ga0495639_0237832 | Ga0495639_0237832_14_859 | 262 |
| 97 | 3300048920 | Ga0496117_0030523 | Ga0496117_0030523_910_1863 | 262 |
| 98 | 3300048921 | Ga0496118_0081976 | Ga0496118_0081976_825_1778 | 262 |
| 99 | 3300048923 | Ga0496120_0178889 | Ga0496120_0178889_57_1010 | 262 |
| 100 | 3300048924 | Ga0496121_0002757 | Ga0496121_0002757_9758_10711 | 262 |
| 101 | 3300049571 | Ga0501034_0211599 | Ga0501034_0211599_781_1707 | 262 |
| 102 | 3300050492 | nmdc:mga0yw44_9528_c1 | nmdc:mga0yw44_9528_c1_3680_4651 | 262 |
| 103 | 3300050494 | nmdc:mga06z11_47831_c1 | nmdc:mga06z11_47831_c1_1191_2162 | 262 |
| 104 | 3300053119 | Ga0500595_000393 | Ga0500595_000393_25736_26704 | 262 |
| 105 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_234859_235806 | 262 |
| 106 | 3300005981 | Ga0081538_10045198 | Ga0081538_100451984 | 263 |
| 107 | 3300035695 | Ga0373927_0135580 | Ga0373927_0135580_231_1322 | 263 |
| 108 | 3300046501 | Ga0495607_0051103 | Ga0495607_0051103_922_1953 | 263 |
| 109 | 3300046501 | Ga0495607_0053690 | Ga0495607_0053690_737_1756 | 263 |
| 110 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_317384_318415 | 263 |
| 111 | 3300046512 | Ga0495610_0040331 | Ga0495610_0040331_942_1964 | 263 |
| 112 | 3300046513 | Ga0495616_0077163 | Ga0495616_0077163_453_1469 | 263 |
| 113 | 3300046523 | Ga0495644_0003141 | Ga0495644_0003141_2468_3499 | 263 |
| 114 | 3300046523 | Ga0495644_0010467 | Ga0495644_0010467_2306_3325 | 263 |
| 115 | 3300046524 | Ga0495648_0000666 | Ga0495648_0000666_16571_17602 | 263 |
| 116 | 3300046558 | Ga0495633_0007501 | Ga0495633_0007501_4599_5621 | 263 |
| 117 | 3300046558 | Ga0495633_0007691 | Ga0495633_0007691_587_1606 | 263 |
| 118 | 3300046615 | Ga0495656_0021900 | Ga0495656_0021900_863_1894 | 263 |
| 119 | 3300046648 | Ga0495611_0007280 | Ga0495611_0007280_2306_3325 | 263 |
| 120 | 3300046648 | Ga0495611_0011620 | Ga0495611_0011620_2468_3499 | 263 |
| 121 | 3300046660 | Ga0495625_0017425 | Ga0495625_0017425_4135_5166 | 263 |
| 122 | 3300046664 | Ga0495659_0000707 | Ga0495659_0000707_7710_8741 | 263 |
| 123 | 3300046691 | Ga0495670_0036849 | Ga0495670_0036849_579_1610 | 263 |
| 124 | 3300046691 | Ga0495670_0059418 | Ga0495670_0059418_271_1293 | 263 |
| 125 | 3300046794 | Ga0495589_0082895 | Ga0495589_0082895_509_1528 | 263 |
| 126 | 3300047318 | Ga0495636_0001462 | Ga0495636_0001462_3255_4286 | 263 |
| 127 | 3300047320 | Ga0495672_0056246 | Ga0495672_0056246_901_1932 | 263 |
| 128 | 3300047321 | Ga0495676_0130280 | Ga0495676_0130280_490_1581 | 263 |
| 129 | 3300047323 | Ga0495683_0009603 | Ga0495683_0009603_823_1839 | 263 |
| 130 | 3300047443 | Ga0495687_000186 | Ga0495687_000186_33237_34268 | 263 |
| 131 | 3300047445 | Ga0495677_0002963 | Ga0495677_0002963_1564_2595 | 263 |
| 132 | 3300047447 | Ga0495685_000004 | Ga0495685_000004_6329_7360 | 263 |
| 133 | 3300047469 | Ga0495673_0003193 | Ga0495673_0003193_4616_5632 | 263 |
| 134 | 3300049460 | Ga0495682_0009039 | Ga0495682_0009039_2715_3734 | 263 |
| 135 | 3300049460 | Ga0495682_0022741 | Ga0495682_0022741_418_1449 | 263 |
| 136 | 3300006048 | Ga0075363_100012028 | Ga0075363_1000120282 | 264 |
| 137 | 3300006177 | Ga0075362_10000064 | Ga0075362_1000006419 | 264 |
| 138 | 3300006186 | Ga0075369_10000970 | Ga0075369_100009708 | 264 |
| 139 | 3300006195 | Ga0075366_10000133 | Ga0075366_1000013324 | 264 |
| 140 | 3300009098 | Ga0105245_10015600 | Ga0105245_100156004 | 264 |
| 141 | 3300025933 | Ga0207706_10054668 | Ga0207706_100546684 | 264 |
| 142 | 3300046491 | Ga0495584_0081992 | Ga0495584_0081992_25_996 | 264 |
| 143 | 3300046615 | Ga0495656_0043228 | Ga0495656_0043228_244_1215 | 264 |
| 144 | 3300046694 | Ga0495649_0155776 | Ga0495649_0155776_10_981 | 264 |
| 145 | 3300047472 | Ga0495686_0001559 | Ga0495686_0001559_13527_14564 | 264 |
| 146 | 3300048925 | Ga0496122_0100886 | Ga0496122_0100886_508_1464 | 264 |
| 147 | 3300048928 | Ga0496125_0000516 | Ga0496125_0000516_52775_53773 | 264 |
| 148 | 3300048928 | Ga0496125_0004324 | Ga0496125_0004324_9535_10491 | 264 |
| 149 | 3300050489 | nmdc:mga03683_113_c1 | nmdc:mga03683_113_c1_5553_6533 | 264 |
| 150 | 3300050490 | nmdc:mga03n38_5448_c1 | nmdc:mga03n38_5448_c1_2738_3718 | 264 |
| 151 | 3300050493 | nmdc:mga0k408_9_c2 | nmdc:mga0k408_9_c2_34222_35196 | 264 |
| 152 | 3300050516 | nmdc:mga0sz30_532_c1 | nmdc:mga0sz30_532_c1_1682_2662 | 264 |
| 153 | 3300005328 | Ga0070676_10027946 | Ga0070676_100279463 | 265 |
| 154 | 3300005340 | Ga0070689_100054813 | Ga0070689_1000548133 | 265 |
| 155 | 3300005341 | Ga0070691_10047823 | Ga0070691_100478232 | 265 |
| 156 | 3300005343 | Ga0070687_100021826 | Ga0070687_1000218263 | 265 |
| 157 | 3300005347 | Ga0070668_100078817 | Ga0070668_1000788172 | 265 |
| 158 | 3300005354 | Ga0070675_100042093 | Ga0070675_1000420932 | 265 |
| 159 | 3300005355 | Ga0070671_100079035 | Ga0070671_1000790352 | 265 |
| 160 | 3300005364 | Ga0070673_100008514 | Ga0070673_1000085146 | 265 |
| 161 | 3300005365 | Ga0070688_100004710 | Ga0070688_1000047106 | 265 |
| 162 | 3300005458 | Ga0070681_10122131 | Ga0070681_101221313 | 265 |
| 163 | 3300005459 | Ga0068867_100021193 | Ga0068867_1000211933 | 265 |
| 164 | 3300005466 | Ga0070685_10001171 | Ga0070685_100011713 | 265 |
| 165 | 3300005543 | Ga0070672_100037830 | Ga0070672_1000378303 | 265 |
| 166 | 3300005544 | Ga0070686_100011380 | Ga0070686_1000113802 | 265 |
| 167 | 3300005547 | Ga0070693_100109815 | Ga0070693_1001098152 | 265 |
| 168 | 3300005548 | Ga0070665_100030885 | Ga0070665_1000308852 | 265 |
| 169 | 3300005577 | Ga0068857_100084989 | Ga0068857_1000849893 | 265 |
| 170 | 3300005578 | Ga0068854_100065890 | Ga0068854_1000658902 | 265 |
| 171 | 3300005615 | Ga0070702_100004612 | Ga0070702_1000046126 | 265 |
| 172 | 3300005617 | Ga0068859_100392298 | Ga0068859_1003922981 | 265 |
| 173 | 3300005842 | Ga0068858_100015491 | Ga0068858_1000154914 | 265 |
| 174 | 3300005843 | Ga0068860_100147599 | Ga0068860_1001475993 | 265 |
| 175 | 3300005844 | Ga0068862_100064653 | Ga0068862_1000646532 | 265 |
| 176 | 3300006038 | Ga0075365_10008953 | Ga0075365_100089533 | 265 |
| 177 | 3300006237 | Ga0097621_100079555 | Ga0097621_1000795552 | 265 |
| 178 | 3300006931 | Ga0097620_100392279 | Ga0097620_1003922791 | 265 |
| 179 | 3300009094 | Ga0111539_10143292 | Ga0111539_101432922 | 265 |
| 180 | 3300009148 | Ga0105243_10113459 | Ga0105243_101134593 | 265 |
| 181 | 3300013296 | Ga0157374_10012484 | Ga0157374_100124841 | 265 |
| 182 | 3300013306 | Ga0163162_10078319 | Ga0163162_100783193 | 265 |
| 183 | 3300013308 | Ga0157375_10025302 | Ga0157375_100253023 | 265 |
| 184 | 3300014326 | Ga0157380_10011968 | Ga0157380_100119686 | 265 |
| 185 | 3300014968 | Ga0157379_10076556 | Ga0157379_100765561 | 265 |
| 186 | 3300021388 | Ga0213875_10000441 | Ga0213875_100004417 | 265 |
| 187 | 3300025899 | Ga0207642_10000663 | Ga0207642_1000066311 | 265 |
| 188 | 3300025907 | Ga0207645_10031750 | Ga0207645_100317502 | 265 |
| 189 | 3300025908 | Ga0207643_10001981 | Ga0207643_100019819 | 265 |
| 190 | 3300025918 | Ga0207662_10033230 | Ga0207662_100332302 | 265 |
| 191 | 3300025919 | Ga0207657_10115614 | Ga0207657_101156141 | 265 |
| 192 | 3300025925 | Ga0207650_10197172 | Ga0207650_101971722 | 265 |
| 193 | 3300025931 | Ga0207644_10199627 | Ga0207644_101996273 | 265 |
| 194 | 3300025938 | Ga0207704_10018307 | Ga0207704_100183072 | 265 |
| 195 | 3300025940 | Ga0207691_10024234 | Ga0207691_100242347 | 265 |
| 196 | 3300025941 | Ga0207711_10132223 | Ga0207711_101322232 | 265 |
| 197 | 3300025960 | Ga0207651_10046925 | Ga0207651_100469253 | 265 |
| 198 | 3300025961 | Ga0207712_10016384 | Ga0207712_100163845 | 265 |
| 199 | 3300025972 | Ga0207668_10125580 | Ga0207668_101255802 | 265 |
| 200 | 3300026035 | Ga0207703_10025445 | Ga0207703_100254454 | 265 |
| 201 | 3300026067 | Ga0207678_10014386 | Ga0207678_100143866 | 265 |
| 202 | 3300026075 | Ga0207708_10004345 | Ga0207708_100043459 | 265 |
| 203 | 3300026078 | Ga0207702_10092706 | Ga0207702_100927062 | 265 |
| 204 | 3300026088 | Ga0207641_10011439 | Ga0207641_100114397 | 265 |
| 205 | 3300026089 | Ga0207648_10026529 | Ga0207648_100265293 | 265 |
| 206 | 3300026095 | Ga0207676_10039419 | Ga0207676_100394192 | 265 |
| 207 | 3300026116 | Ga0207674_10104069 | Ga0207674_101040692 | 265 |
| 208 | 3300026118 | Ga0207675_100008646 | Ga0207675_1000086468 | 265 |
| 209 | 3300026121 | Ga0207683_10014227 | Ga0207683_100142276 | 265 |
| 210 | 3300027665 | Ga0209983_1016162 | Ga0209983_10161622 | 265 |
| 211 | 3300027876 | Ga0209974_10005807 | Ga0209974_100058073 | 265 |
| 212 | 3300028800 | Ga0265338_10057527 | Ga0265338_100575272 | 265 |
| 213 | 3300048903 | Ga0496100_0000926 | Ga0496100_0000926_11768_12739 | 265 |
| 214 | 3300048904 | Ga0496101_0025741 | Ga0496101_0025741_403_1374 | 265 |
| 215 | 3300048905 | Ga0496102_0011303 | Ga0496102_0011303_3192_4163 | 265 |
| 216 | 3300048906 | Ga0496103_0050706 | Ga0496103_0050706_770_1741 | 265 |
| 217 | 3300048908 | Ga0496105_0124675 | Ga0496105_0124675_141_1112 | 265 |
| 218 | 3300048910 | Ga0496107_0006507 | Ga0496107_0006507_2206_3177 | 265 |
| 219 | 3300048911 | Ga0496108_0115429 | Ga0496108_0115429_444_1415 | 265 |
| 220 | 3300048913 | Ga0496110_0001389 | Ga0496110_0001389_2527_3498 | 265 |
| 221 | 3300048914 | Ga0496111_0009894 | Ga0496111_0009894_514_1485 | 265 |
| 222 | 3300048915 | Ga0496112_0179265 | Ga0496112_0179265_624_1595 | 265 |
| 223 | 3300048916 | Ga0496113_0091530 | Ga0496113_0091530_609_1580 | 265 |
| 224 | 3300048917 | Ga0496114_0009376 | Ga0496114_0009376_6024_6995 | 265 |
| 225 | 3300048918 | Ga0496115_0011961 | Ga0496115_0011961_1533_2504 | 265 |
| 226 | 3300050492 | nmdc:mga0yw44_580_c1 | nmdc:mga0yw44_580_c1_3659_4630 | 265 |
| 227 | 3300050511 | nmdc:mga08y16_151483_c1 | nmdc:mga08y16_151483_c1_108_1079 | 265 |
| 228 | 3300050511 | nmdc:mga08y16_232933_c1 | nmdc:mga08y16_232933_c1_46_990 | 265 |
| 229 | 3300005614 | Ga0068856_100081796 | Ga0068856_1000817965 | 266 |
| 230 | 3300025906 | Ga0207699_10135913 | Ga0207699_101359131 | 266 |
| 231 | 3300025940 | Ga0207691_10016004 | Ga0207691_100160044 | 266 |
| 232 | 3300030878 | Ga0265770_1009849 | Ga0265770_10098491 | 266 |
| 233 | 3300006844 | Ga0075428_100010090 | Ga0075428_1000100902 | 267 |
| 234 | 3300009147 | Ga0114129_10000022 | Ga0114129_1000002279 | 267 |
| 235 | 3300035089 | Ga0373944_0115538 | Ga0373944_0115538_10_870 | 267 |
| 236 | 3300035171 | Ga0373946_0195961 | Ga0373946_0195961_26_886 | 267 |
| 237 | 3300035695 | Ga0373927_0040134 | Ga0373927_0040134_277_1137 | 267 |
| 238 | 3300037068 | Ga0373925_0043361 | Ga0373925_0043361_127_987 | 267 |
| 239 | 3300046455 | Ga0495603_0032014 | Ga0495603_0032014_865_1725 | 267 |
| 240 | 3300046461 | Ga0495641_0015404 | Ga0495641_0015404_1283_2143 | 267 |
| 241 | 3300046473 | Ga0495582_0009777 | Ga0495582_0009777_168_1028 | 267 |
| 242 | 3300046491 | Ga0495584_0027065 | Ga0495584_0027065_1274_2134 | 267 |
| 243 | 3300046492 | Ga0495585_0054470 | Ga0495585_0054470_1143_2003 | 267 |
| 244 | 3300046499 | Ga0495594_0062425 | Ga0495594_0062425_543_1403 | 267 |
| 245 | 3300046523 | Ga0495644_0018121 | Ga0495644_0018121_140_1000 | 267 |
| 246 | 3300046525 | Ga0495663_0019555 | Ga0495663_0019555_68_928 | 267 |
| 247 | 3300046537 | Ga0495598_0003016 | Ga0495598_0003016_821_1681 | 267 |
| 248 | 3300046558 | Ga0495633_0065546 | Ga0495633_0065546_821_1681 | 267 |
| 249 | 3300046615 | Ga0495656_0009452 | Ga0495656_0009452_2183_3043 | 267 |
| 250 | 3300046674 | Ga0495588_0128568 | Ga0495588_0128568_43_903 | 267 |
| 251 | 3300046683 | Ga0495658_0052782 | Ga0495658_0052782_791_1651 | 267 |
| 252 | 3300046690 | Ga0495624_0021988 | Ga0495624_0021988_689_1549 | 267 |
| 253 | 3300046692 | Ga0495671_0083344 | Ga0495671_0083344_247_1107 | 267 |
| 254 | 3300047321 | Ga0495676_0069896 | Ga0495676_0069896_1784_2644 | 267 |
| 255 | 3300047445 | Ga0495677_0104713 | Ga0495677_0104713_13_873 | 267 |
| 256 | 3300050507 | nmdc:mga05p37_48_c1 | nmdc:mga05p37_48_c1_92704_93645 | 267 |
| 257 | 3300005434 | Ga0070709_10045979 | Ga0070709_100459793 | 268 |
| 258 | 3300005435 | Ga0070714_100050211 | Ga0070714_1000502115 | 268 |
| 259 | 3300005435 | Ga0070714_100105572 | Ga0070714_1001055723 | 268 |
| 260 | 3300005436 | Ga0070713_100003980 | Ga0070713_1000039806 | 268 |
| 261 | 3300006028 | Ga0070717_10039624 | Ga0070717_100396244 | 268 |
| 262 | 3300006173 | Ga0070716_100016230 | Ga0070716_1000162304 | 268 |
| 263 | 3300006871 | Ga0075434_100059274 | Ga0075434_1000592742 | 268 |
| 264 | 3300025906 | Ga0207699_10067590 | Ga0207699_100675901 | 268 |
| 265 | 3300025915 | Ga0207693_10013375 | Ga0207693_100133752 | 268 |
| 266 | 3300025916 | Ga0207663_10219767 | Ga0207663_102197671 | 268 |
| 267 | 3300025928 | Ga0207700_10021925 | Ga0207700_100219255 | 268 |
| 268 | 3300025939 | Ga0207665_10005228 | Ga0207665_100052285 | 268 |
| 269 | 3300031995 | Ga0307409_100544042 | Ga0307409_1005440421 | 268 |
| 270 | 3300048928 | Ga0496125_0099189 | Ga0496125_0099189_1176_2036 | 268 |
| 271 | 3300050512 | nmdc:mga0n895_504226_c1 | nmdc:mga0n895_504226_c1_275_1135 | 268 |
| 272 | 3300053122 | Ga0500608_000445 | Ga0500608_000445_2404_3264 | 268 |
| 273 | 3300053131 | Ga0500652_000932 | Ga0500652_000932_4089_4949 | 268 |
| 274 | 3300053136 | Ga0500559_0000857 | Ga0500559_0000857_17400_18260 | 268 |
| 275 | iso_pu_bacteria | 2513237087 | 2513593896 | 268 |
| 276 | 3300005937 | Ga0081455_10004299 | Ga0081455_1000429913 | 270 |
| 277 | 3300021361 | Ga0213872_10000009 | Ga0213872_10000009166 | 270 |
| 278 | 3300039447 | Ga0436361_0572581 | Ga0436361_0572581_21868_22890 | 270 |
| 279 | 3300049571 | Ga0501034_0362266 | Ga0501034_0362266_225_1142 | 270 |
| 280 | 3300049586 | Ga0501070_0108420 | Ga0501070_0108420_1207_2124 | 270 |
| 281 | 3300049588 | Ga0501072_0094232 | Ga0501072_0094232_730_1647 | 270 |
| 282 | 3300049744 | Ga0501083_0094674 | Ga0501083_0094674_490_1407 | 270 |
| 283 | 3300005336 | Ga0070680_100155789 | Ga0070680_1001557892 | 272 |
| 284 | 3300005458 | Ga0070681_10039100 | Ga0070681_100391002 | 272 |
| 285 | 3300005530 | Ga0070679_100029030 | Ga0070679_1000290304 | 272 |
| 286 | 3300005548 | Ga0070665_100189278 | Ga0070665_1001892782 | 272 |
| 287 | 3300013104 | Ga0157370_10056148 | Ga0157370_100561483 | 272 |
| 288 | 3300013306 | Ga0163162_10036076 | Ga0163162_100360764 | 272 |
| 289 | 3300025917 | Ga0207660_10086773 | Ga0207660_100867732 | 272 |
| 290 | 3300025921 | Ga0207652_10038399 | Ga0207652_100383993 | 272 |
| 291 | 3300028379 | Ga0268266_10148940 | Ga0268266_101489402 | 272 |
| 292 | 3300031711 | Ga0265314_10003766 | Ga0265314_1000376615 | 272 |
| 293 | 3300031730 | Ga0307516_10121407 | Ga0307516_101214072 | 272 |
| 294 | 3300049573 | Ga0501037_0031800 | Ga0501037_0031800_2450_3322 | 272 |
| 295 | 3300009098 | Ga0105245_10045784 | Ga0105245_100457843 | 273 |
| 296 | 3300046460 | Ga0495638_0067742 | Ga0495638_0067742_326_1246 | 273 |
| 297 | 3300005539 | Ga0068853_100042692 | Ga0068853_1000426921 | 274 |
| 298 | 3300009174 | Ga0105241_10335299 | Ga0105241_103352991 | 274 |
| 299 | 3300009545 | Ga0105237_10007152 | Ga0105237_100071528 | 274 |
| 300 | 3300010375 | Ga0105239_10001812 | Ga0105239_1000181218 | 274 |
| 301 | 3300025914 | Ga0207671_10007477 | Ga0207671_100074772 | 274 |
| 302 | 3300028379 | Ga0268266_10000606 | Ga0268266_1000060615 | 274 |
| 303 | 3300035398 | Ga0316574_0052919 | Ga0316574_0052919_1547_2461 | 274 |
| 304 | 3300049823 | Ga0501044_0027091 | Ga0501044_0027091_1264_2286 | 274 |
| 305 | 3300050514 | nmdc:mga08x19_236822_c1 | nmdc:mga08x19_236822_c1_111_1058 | 274 |
| 306 | 3300048907 | Ga0496104_0051729 | Ga0496104_0051729_1879_2820 | 275 |
| 307 | 3300048908 | Ga0496105_0071516 | Ga0496105_0071516_608_1549 | 275 |
| 308 | 3300048918 | Ga0496115_0223088 | Ga0496115_0223088_247_1188 | 275 |
| 309 | 3300005937 | Ga0081455_10006696 | Ga0081455_100066963 | 276 |
| 310 | 3300006038 | Ga0075365_10042747 | Ga0075365_100427473 | 276 |
| 311 | 3300026142 | Ga0207698_10016507 | Ga0207698_100165072 | 276 |
| 312 | 3300031239 | Ga0265328_10077757 | Ga0265328_100777572 | 276 |
| 313 | 3300031241 | Ga0265325_10011890 | Ga0265325_100118904 | 276 |
| 314 | 3300031249 | Ga0265339_10004692 | Ga0265339_100046923 | 276 |
| 315 | 3300031595 | Ga0265313_10005975 | Ga0265313_100059753 | 276 |
| 316 | 3300031712 | Ga0265342_10002370 | Ga0265342_1000237013 | 276 |
| 317 | 3300048905 | Ga0496102_0046048 | Ga0496102_0046048_2487_3416 | 276 |
| 318 | 3300048907 | Ga0496104_0004884 | Ga0496104_0004884_10648_11577 | 276 |
| 319 | 3300048908 | Ga0496105_0017989 | Ga0496105_0017989_3706_4635 | 276 |
| 320 | 3300048909 | Ga0496106_0089326 | Ga0496106_0089326_353_1237 | 276 |
| 321 | 3300048911 | Ga0496108_0056126 | Ga0496108_0056126_2074_3003 | 276 |
| 322 | 3300048913 | Ga0496110_0154569 | Ga0496110_0154569_862_1791 | 276 |
| 323 | 3300048917 | Ga0496114_0119166 | Ga0496114_0119166_741_1670 | 276 |
| 324 | 3300005547 | Ga0070693_100112683 | Ga0070693_1001126832 | 277 |
| 325 | 3300005563 | Ga0068855_100307625 | Ga0068855_1003076252 | 277 |
| 326 | 3300005578 | Ga0068854_100040631 | Ga0068854_1000406312 | 277 |
| 327 | 3300005616 | Ga0068852_100007804 | Ga0068852_1000078049 | 277 |
| 328 | 3300009098 | Ga0105245_10225589 | Ga0105245_102255891 | 277 |
| 329 | 3300013105 | Ga0157369_10003746 | Ga0157369_1000374616 | 277 |
| 330 | 3300031247 | Ga0265340_10001786 | Ga0265340_100017863 | 277 |
| 331 | 3300031344 | Ga0265316_10049102 | Ga0265316_100491023 | 277 |
| 332 | 3300046543 | Ga0495645_0021304 | Ga0495645_0021304_3381_4397 | 277 |
| 333 | 3300048924 | Ga0496121_0025130 | Ga0496121_0025130_996_1991 | 277 |
| 334 | 3300048924 | Ga0496121_0034562 | Ga0496121_0034562_3004_3960 | 277 |
| 335 | 3300048929 | Ga0496126_0209135 | Ga0496126_0209135_545_1543 | 277 |
| 336 | 3300048929 | Ga0496126_0398322 | Ga0496126_0398322_45_998 | 277 |
| 337 | 3300049581 | Ga0501047_0213390 | Ga0501047_0213390_697_1722 | 277 |
| 338 | 3300050492 | nmdc:mga0yw44_330905_c1 | nmdc:mga0yw44_330905_c1_13_984 | 277 |
| 339 | 3300053093 | Ga0500651_0004411 | Ga0500651_0004411_4413_5366 | 277 |
| 340 | 3300053098 | Ga0500650_0075241 | Ga0500650_0075241_452_1405 | 277 |
| 341 | 3300053130 | Ga0500642_0009734 | Ga0500642_0009734_463_1416 | 277 |
| 342 | 3300037068 | Ga0373925_0118084 | Ga0373925_0118084_387_1322 | 278 |
| 343 | 3300044683 | Ga0466965_0006986 | Ga0466965_0006986_3568_4500 | 278 |
| 344 | 3300046461 | Ga0495641_0036545 | Ga0495641_0036545_788_1747 | 278 |
| 345 | 3300046533 | Ga0495640_0238025 | Ga0495640_0238025_138_1097 | 278 |
| 346 | 3300046535 | Ga0495586_0010466 | Ga0495586_0010466_105_1064 | 278 |
| 347 | 3300046681 | Ga0495647_0027688 | Ga0495647_0027688_918_1877 | 278 |
| 348 | 3300046683 | Ga0495658_0012575 | Ga0495658_0012575_2233_3192 | 278 |
| 349 | 3300049580 | Ga0501046_0172835 | Ga0501046_0172835_196_1134 | 278 |
| 350 | 3300005329 | Ga0070683_100153545 | Ga0070683_1001535451 | 279 |
| 351 | 3300005366 | Ga0070659_100064306 | Ga0070659_1000643061 | 279 |
| 352 | 3300005437 | Ga0070710_10070786 | Ga0070710_100707863 | 279 |
| 353 | 3300005539 | Ga0068853_100016433 | Ga0068853_1000164336 | 279 |
| 354 | 3300009093 | Ga0105240_10037276 | Ga0105240_100372766 | 279 |
| 355 | 3300009551 | Ga0105238_10022052 | Ga0105238_100220523 | 279 |
| 356 | 3300013307 | Ga0157372_10004426 | Ga0157372_100044262 | 279 |
| 357 | 3300025924 | Ga0207694_10073396 | Ga0207694_100733963 | 279 |
| 358 | 3300025928 | Ga0207700_10074989 | Ga0207700_100749893 | 279 |
| 359 | 3300025932 | Ga0207690_10122662 | Ga0207690_101226622 | 279 |
| 360 | 3300025944 | Ga0207661_10164492 | Ga0207661_101644922 | 279 |
| 361 | 3300039450 | Ga0436363_1182562 | Ga0436363_1182562_290_1240 | 279 |
| 362 | 3300048924 | Ga0496121_0108796 | Ga0496121_0108796_866_1816 | 279 |
| 363 | 3300006175 | Ga0070712_100080586 | Ga0070712_1000805862 | 280 |
| 364 | 3300006195 | Ga0075366_10127229 | Ga0075366_101272291 | 280 |
| 365 | 3300006353 | Ga0075370_10000015 | Ga0075370_1000001538 | 280 |
| 366 | 3300009093 | Ga0105240_10303746 | Ga0105240_103037462 | 280 |
| 367 | 3300009177 | Ga0105248_10075373 | Ga0105248_100753733 | 280 |
| 368 | 3300014968 | Ga0157379_10089475 | Ga0157379_100894756 | 280 |
| 369 | 3300025254 | Ga0209148_1001585 | Ga0209148_10015858 | 280 |
| 370 | 3300025272 | Ga0209455_1001650 | Ga0209455_10016505 | 280 |
| 371 | 3300025893 | Ga0207682_10092479 | Ga0207682_100924791 | 280 |
| 372 | 3300025924 | Ga0207694_10325427 | Ga0207694_103254272 | 280 |
| 373 | 3300034817 | Ga0373948_0017063 | Ga0373948_0017063_117_1079 | 280 |
| 374 | 3300035691 | Ga0373931_0043465 | Ga0373931_0043465_792_1754 | 280 |
| 375 | 3300046692 | Ga0495671_0014428 | Ga0495671_0014428_3078_4034 | 280 |
| 376 | 3300048915 | Ga0496112_0615672 | Ga0496112_0615672_20_976 | 280 |
| 377 | 3300050496 | nmdc:mga07m45_13_c1 | nmdc:mga07m45_13_c1_29908_30870 | 280 |
| 378 | iso_pu_bacteria | 2599185354 | 2600203477 | 280 |
| 379 | iso_pu_bacteria | 2885429604 | 2885430809 | 280 |
| 380 | 3300035724 | Ga0373933_0145253 | Ga0373933_0145253_214_1161 | 281 |
| 381 | 3300036401 | Ga0373937_0025248 | Ga0373937_0025248_3759_4706 | 281 |
| 382 | 3300042007 | Ga0439449_0018286 | Ga0439449_0018286_1625_2617 | 281 |
| 383 | 3300047320 | Ga0495672_0082994 | Ga0495672_0082994_219_1121 | 281 |
| 384 | 3300053090 | Ga0500646_0004337 | Ga0500646_0004337_1423_2439 | 281 |
| 385 | iso_pu_bacteria | 2913295892 | 2913299167 | 281 |
| 386 | 3300005354 | Ga0070675_100024350 | Ga0070675_1000243503 | 282 |
| 387 | 3300005364 | Ga0070673_100302124 | Ga0070673_1003021241 | 282 |
| 388 | 3300005466 | Ga0070685_10304865 | Ga0070685_103048651 | 282 |
| 389 | 3300006844 | Ga0075428_100012540 | Ga0075428_1000125408 | 282 |
| 390 | 3300006847 | Ga0075431_100000539 | Ga0075431_10000053924 | 282 |
| 391 | 3300006880 | Ga0075429_100012060 | Ga0075429_1000120604 | 282 |
| 392 | 3300009094 | Ga0111539_10002861 | Ga0111539_100028617 | 282 |
| 393 | 3300009147 | Ga0114129_10004925 | Ga0114129_1000492515 | 282 |
| 394 | 3300013105 | Ga0157369_10089151 | Ga0157369_100891513 | 282 |
| 395 | 3300013308 | Ga0157375_10025462 | Ga0157375_100254624 | 282 |
| 396 | 3300020070 | Ga0206356_10237658 | Ga0206356_102376582 | 282 |
| 397 | 3300025909 | Ga0207705_10073107 | Ga0207705_100731073 | 282 |
| 398 | 3300025925 | Ga0207650_10034931 | Ga0207650_100349313 | 282 |
| 399 | 3300027907 | Ga0207428_10019476 | Ga0207428_100194762 | 282 |
| 400 | 3300049585 | Ga0501069_0081533 | Ga0501069_0081533_690_1607 | 282 |
| 401 | 3300050492 | nmdc:mga0yw44_17650_c1 | nmdc:mga0yw44_17650_c1_2151_3092 | 282 |
| 402 | 3300050507 | nmdc:mga05p37_747_c1 | nmdc:mga05p37_747_c1_7606_8538 | 282 |
| 403 | 3300050508 | nmdc:mga09592_429128_c1 | nmdc:mga09592_429128_c1_31_972 | 282 |
| 404 | 3300050508 | nmdc:mga09592_723_c2 | nmdc:mga09592_723_c2_11233_12165 | 282 |
| 405 | 3300050510 | nmdc:mga06r32_685_c1 | nmdc:mga06r32_685_c1_25551_26483 | 282 |
| 406 | 3300050511 | nmdc:mga08y16_147624_c1 | nmdc:mga08y16_147624_c1_710_1651 | 282 |
| 407 | 3300050511 | nmdc:mga08y16_2123_c1 | nmdc:mga08y16_2123_c1_4874_5806 | 282 |
| 408 | 3300061734 | Ga0530510_0192447 | Ga0530510_0192447_328_1275 | 282 |
| 409 | iso_pu_bacteria | 2545555834 | 2545679473 | 282 |
| 410 | iso_pu_bacteria | 2595698237 | 2596374313 | 282 |
| 411 | iso_pu_bacteria | 2842698319 | 2842700824 | 282 |
| 412 | iso_pu_bacteria | 2907202186 | 2907203663 | 282 |
| 413 | iso_pu_bacteria | 641522639 | 641644112 | 282 |
| 414 | 3300005328 | Ga0070676_10003500 | Ga0070676_100035009 | 283 |
| 415 | 3300005330 | Ga0070690_100028161 | Ga0070690_1000281615 | 283 |
| 416 | 3300005338 | Ga0068868_100011454 | Ga0068868_1000114546 | 283 |
| 417 | 3300005347 | Ga0070668_100007325 | Ga0070668_1000073256 | 283 |
| 418 | 3300005353 | Ga0070669_100022931 | Ga0070669_1000229315 | 283 |
| 419 | 3300005354 | Ga0070675_100062824 | Ga0070675_1000628244 | 283 |
| 420 | 3300005356 | Ga0070674_100108726 | Ga0070674_1001087262 | 283 |
| 421 | 3300005364 | Ga0070673_100058472 | Ga0070673_1000584724 | 283 |
| 422 | 3300005367 | Ga0070667_100031224 | Ga0070667_1000312243 | 283 |
| 423 | 3300005437 | Ga0070710_10059484 | Ga0070710_100594842 | 283 |
| 424 | 3300005439 | Ga0070711_100050780 | Ga0070711_1000507804 | 283 |
| 425 | 3300005440 | Ga0070705_100249781 | Ga0070705_1002497812 | 283 |
| 426 | 3300005543 | Ga0070672_100029922 | Ga0070672_1000299224 | 283 |
| 427 | 3300005615 | Ga0070702_100085456 | Ga0070702_1000854562 | 283 |
| 428 | 3300006173 | Ga0070716_100006047 | Ga0070716_1000060476 | 283 |
| 429 | 3300006175 | Ga0070712_100199875 | Ga0070712_1001998751 | 283 |
| 430 | 3300006881 | Ga0068865_100081970 | Ga0068865_1000819704 | 283 |
| 431 | 3300010375 | Ga0105239_10299087 | Ga0105239_102990872 | 283 |
| 432 | 3300013297 | Ga0157378_10037715 | Ga0157378_100377155 | 283 |
| 433 | 3300013306 | Ga0163162_10023573 | Ga0163162_100235732 | 283 |
| 434 | 3300013308 | Ga0157375_10100937 | Ga0157375_101009372 | 283 |
| 435 | 3300017792 | Ga0163161_10041130 | Ga0163161_100411305 | 283 |
| 436 | 3300021320 | Ga0214544_1000010 | Ga0214544_100001076 | 283 |
| 437 | 3300021321 | Ga0214542_1000023 | Ga0214542_1000023176 | 283 |
| 438 | 3300021327 | Ga0214543_1000019 | Ga0214543_1000019251 | 283 |
| 439 | 3300025271 | Ga0207666_1004907 | Ga0207666_10049072 | 283 |
| 440 | 3300025315 | Ga0207697_10002652 | Ga0207697_100026526 | 283 |
| 441 | 3300025903 | Ga0207680_10119224 | Ga0207680_101192241 | 283 |
| 442 | 3300025905 | Ga0207685_10027317 | Ga0207685_100273172 | 283 |
| 443 | 3300025906 | Ga0207699_10016879 | Ga0207699_100168793 | 283 |
| 444 | 3300025907 | Ga0207645_10003279 | Ga0207645_100032799 | 283 |
| 445 | 3300025915 | Ga0207693_10016106 | Ga0207693_100161066 | 283 |
| 446 | 3300025923 | Ga0207681_10022059 | Ga0207681_100220594 | 283 |
| 447 | 3300025926 | Ga0207659_10009790 | Ga0207659_100097906 | 283 |
| 448 | 3300025931 | Ga0207644_10037021 | Ga0207644_100370212 | 283 |
| 449 | 3300025933 | Ga0207706_10022590 | Ga0207706_100225906 | 283 |
| 450 | 3300025939 | Ga0207665_10008286 | Ga0207665_100082866 | 283 |
| 451 | 3300025940 | Ga0207691_10010912 | Ga0207691_100109126 | 283 |
| 452 | 3300025960 | Ga0207651_10075649 | Ga0207651_100756493 | 283 |
| 453 | 3300025972 | Ga0207668_10006102 | Ga0207668_100061028 | 283 |
| 454 | 3300026023 | Ga0207677_10017382 | Ga0207677_100173827 | 283 |
| 455 | 3300026121 | Ga0207683_10008830 | Ga0207683_100088308 | 283 |
| 456 | 3300031242 | Ga0265329_10007200 | Ga0265329_100072002 | 283 |
| 457 | 3300031249 | Ga0265339_10000503 | Ga0265339_1000050325 | 283 |
| 458 | 3300031344 | Ga0265316_10021355 | Ga0265316_100213552 | 283 |
| 459 | 3300031595 | Ga0265313_10000099 | Ga0265313_1000009931 | 283 |
| 460 | 3300031711 | Ga0265314_10005117 | Ga0265314_100051172 | 283 |
| 461 | 3300031712 | Ga0265342_10019371 | Ga0265342_100193712 | 283 |
| 462 | 3300048903 | Ga0496100_0017908 | Ga0496100_0017908_2827_3750 | 283 |
| 463 | 3300048904 | Ga0496101_0004982 | Ga0496101_0004982_183_1106 | 283 |
| 464 | 3300048905 | Ga0496102_0017840 | Ga0496102_0017840_3550_4473 | 283 |
| 465 | 3300048909 | Ga0496106_0002648 | Ga0496106_0002648_1138_2061 | 283 |
| 466 | 3300048916 | Ga0496113_0087067 | Ga0496113_0087067_380_1303 | 283 |
| 467 | 3300048918 | Ga0496115_0012246 | Ga0496115_0012246_2038_2961 | 283 |
| 468 | iso_pu_bacteria | 2852387548 | 2852394228 | 283 |
| 469 | iso_pu_bacteria | 3003665799 | 3003667362 | 283 |
| 470 | iso_pu_bacteria | 643348564 | 643601283 | 283 |
| 471 | iso_pu_bacteria | 8057575449 | 8057579668 | 283 |
| 472 | 3300005548 | Ga0070665_100000480 | Ga0070665_10000048056 | 284 |
| 473 | 3300028379 | Ga0268266_10000337 | Ga0268266_100003372 | 284 |
| 474 | 3300049822 | Ga0501035_0212053 | Ga0501035_0212053_31_1017 | 284 |
| 475 | iso_pu_bacteria | 2643221651 | 2644290235 | 284 |
| 476 | 3300037853 | Ga0436364_1503727 | Ga0436364_1503727_29375_30307 | 285 |
| 477 | iso_pu_bacteria | 2848297114 | 2848297656 | 285 |
| 478 | 3300005293 | Ga0065715_10229958 | Ga0065715_102299581 | 291 |
| 479 | 3300005617 | Ga0068859_100565548 | Ga0068859_1005655482 | 291 |
| 480 | 3300006852 | Ga0075433_10189602 | Ga0075433_101896022 | 291 |
| 481 | 3300006931 | Ga0097620_100565534 | Ga0097620_1005655341 | 291 |
| 482 | 3300048912 | Ga0496109_0569181 | Ga0496109_0569181_56_982 | 291 |
| 483 | 3300050515 | nmdc:mga0a205_252094_c1 | nmdc:mga0a205_252094_c1_635_1561 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vd9-assembly2.cif.gz_B | metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans | 0.8715 | 207 | 277 |
| 6vd8-assembly1.cif.gz_B-2 | metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa | 0.8497 | 207 | 282 |
| 7y5g-assembly1.cif.gz_A | cryo-em structure of a eukaryotic znt8 in the presence of zinc | 0.8426 | 43 | 286 |
| 6vd9-assembly2.cif.gz_B | metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans | 0.8397 | 207 | 277 |
| 6vd8-assembly1.cif.gz_A | metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa | 0.8252 | 201 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q3V5J4_162_375_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9206 | 47 | 197 | 1.20.1510.10 |
| af_Q2FWA9_19_215_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9064 | 28 | 196 | 1.20.1510.10 |
| af_Q4DAP4_369_464_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.9048 | 200 | 278 | 3.30.70.1350 |
| af_Q9ZT63_320_398_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.8989 | 200 | 277 | 3.30.70.1350 |
| af_D3ZWW5_236_448_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8982 | 43 | 196 | 1.20.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536VYX9-F1-model_v4 | Cation transporter | 0.9238 | 219 | 291 |
GO:0005385
GO:0005886 |
| AF-A0A536VYX9-F1-model_v4 | Cation transporter | 0.9117 | 219 | 291 |
GO:0005385
GO:0005886 |
| AF-A0A3L7XB01-F1-model_v4 | Cation transporter | 0.9025 | 27 | 277 |
GO:0005385
GO:0005886 |
| AF-W6K2D0-F1-model_v4 | Cation diffusion facilitator family transporter | 0.901 | 45 | 278 |
GO:0005385
GO:0005886 |
| AF-A0A3D5UYM0-F1-model_v4 | Cation transporter | 0.8942 | 39 | 284 |
GO:0005385
GO:0005886 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar