F452861

General Info

Members Datasets Scaffolds Average Seq Length
483 319 468 292

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3003665799|3003667362
Length 338
Sequence HDHAHDHDDHGRDHHRQDHHGHDHHGHDHHGHDHHDHAHHGPGHVHAPASFGRAFAIGIALNTGFVLIEGAYGVLTDSVALLADAGHNLSDVLGLVVAWAAATLGQRQPTARFTYGLRASSILAALFNAVFLLVAVGAIAWEAIRRFSEPAPVPGLTVTIVALIGIAVNGITAWLFASGRKGDLNVRGAYLHMLADAAVSAGVVVAGLVIVATGWTWVDPVTSLVIVAVIVAGTWGLLRDSVVLSLDAVPPGIDPAEVRRCLVDRPGVWEVHDLHVWPMSTTETALTAHLVMPDGHPGNAFLADCAGLLRRRFGIAHVTLQVELAGGPACALAPDHVV

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
7 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
8 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
9 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
10 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
11 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
12 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
309 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
310 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
317 641522639 Methylobacterium sp. 4-46 Isolate Nodule
318 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
319 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.41
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 1.86
Rhizoplane 9.73
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10229958 3300005293 Bacteria 1237
2 Ga0070676_10003500 3300005328 Bacteria 8194
3 Ga0070676_10027946 3300005328 Bacteria 3202
4 Ga0070683_100153545 3300005329 Bacteria 2183
5 Ga0070690_100028161 3300005330 Bacteria 3479
6 Ga0068869_100368353 3300005334 Bacteria 1175
7 Ga0070680_100155789 3300005336 Bacteria 1919
8 Ga0068868_100011454 3300005338 Bacteria 6457
9 Ga0070689_100054813 3300005340 Bacteria 3087
10 Ga0070691_10047823 3300005341 Bacteria 2035
11 Ga0070687_100021826 3300005343 Bacteria 3017
12 Ga0070668_100007325 3300005347 Bacteria 8183
13 Ga0070668_100078817 3300005347 Bacteria 2577
14 Ga0070669_100022931 3300005353 Bacteria 4465
15 Ga0070675_100024350 3300005354 Unclassified 4848
16 Ga0070675_100042093 3300005354 Bacteria 3731
17 Ga0070675_100062824 3300005354 Bacteria 3069
18 Ga0070671_100079035 3300005355 Bacteria 2749
19 Ga0070674_100108726 3300005356 Bacteria 2032
20 Ga0070673_100008514 3300005364 Bacteria 6824
21 Ga0070673_100058472 3300005364 Unclassified 3048
22 Ga0070673_100302124 3300005364 Unclassified 1409
23 Ga0070688_100004710 3300005365 Bacteria 7125
24 Ga0070659_100064306 3300005366 Bacteria 2903
25 Ga0070667_100031224 3300005367 Bacteria 4442
26 Ga0070709_10045979 3300005434 Bacteria 2712
27 Ga0070714_100050211 3300005435 Bacteria 3552
28 Ga0070714_100105572 3300005435 Bacteria 2487
29 Ga0070713_100003980 3300005436 Bacteria 9831
30 Ga0070713_100168536 3300005436 Bacteria 1960
31 Ga0070710_10059484 3300005437 Bacteria 2170
32 Ga0070710_10070786 3300005437 Bacteria 2009
33 Ga0070711_100050780 3300005439 Bacteria 2845
34 Ga0070705_100249781 3300005440 Bacteria 1244
35 Ga0070708_100037522 3300005445 Bacteria 4228
36 Ga0070662_100018341 3300005457 Bacteria 4733
37 Ga0070681_10039100 3300005458 Bacteria 4756
38 Ga0070681_10122131 3300005458 Bacteria 2538
39 Ga0068867_100021193 3300005459 Bacteria 4635
40 Ga0070685_10001171 3300005466 Bacteria 14029
41 Ga0070685_10304865 3300005466 Unclassified 1074
42 Ga0070706_100077372 3300005467 Bacteria 3079
43 Ga0070706_100081629 3300005467 Bacteria 2994
44 Ga0070707_100095535 3300005468 Bacteria 2878
45 Ga0070698_100085313 3300005471 Bacteria 3145
46 Ga0070699_100104622 3300005518 Bacteria 2482
47 Ga0070679_100029030 3300005530 Bacteria 5456
48 Ga0068853_100016433 3300005539 Bacteria 6090
49 Ga0068853_100042692 3300005539 Bacteria 3878
50 Ga0070672_100029922 3300005543 Bacteria 4087
51 Ga0070672_100037830 3300005543 Bacteria 3683
52 Ga0070686_100011380 3300005544 Bacteria 5045
53 Ga0070693_100109815 3300005547 Bacteria 1695
54 Ga0070693_100112683 3300005547 Bacteria 1676
55 Ga0070665_100000480 3300005548 Bacteria 57573
56 Ga0070665_100030885 3300005548 Bacteria 5391
57 Ga0070665_100189278 3300005548 Bacteria 2059
58 Ga0068855_100307625 3300005563 Bacteria 1754
59 Ga0068857_100084989 3300005577 Bacteria 2828
60 Ga0068854_100040631 3300005578 Bacteria 3283
61 Ga0068854_100065890 3300005578 Bacteria 2634
62 Ga0068856_100081796 3300005614 Bacteria 3205
63 Ga0070702_100004612 3300005615 Bacteria 6314
64 Ga0070702_100085456 3300005615 Bacteria 1900
65 Ga0068852_100007804 3300005616 Bacteria 7836
66 Ga0068859_100392298 3300005617 Bacteria 1484
67 Ga0068859_100565548 3300005617 Bacteria 1231
68 Ga0068858_100015491 3300005842 Bacteria 7170
69 Ga0068860_100147599 3300005843 Bacteria 2263
70 Ga0068862_100064653 3300005844 Bacteria 3149
71 Ga0081455_10004299 3300005937 Bacteria 16034
72 Ga0081455_10006696 3300005937 Bacteria 12314
73 Ga0081538_10045198 3300005981 Bacteria 2733
74 Ga0070717_10039624 3300006028 Bacteria 3834
75 Ga0075365_10008953 3300006038 Bacteria 5721
76 Ga0075365_10042747 3300006038 Bacteria 2964
77 Ga0075363_100012028 3300006048 Bacteria 4160
78 Ga0075363_100026617 3300006048 Bacteria 2960
79 Ga0070716_100006047 3300006173 Bacteria 5898
80 Ga0070716_100016230 3300006173 Bacteria 3839
81 Ga0070712_100080586 3300006175 Bacteria 2356
82 Ga0070712_100199875 3300006175 Bacteria 1569
83 Ga0075362_10000064 3300006177 Bacteria 30699
84 Ga0075369_10000970 3300006186 Bacteria 9559
85 Ga0075366_10000133 3300006195 Bacteria 31068
86 Ga0075366_10127229 3300006195 Bacteria 1537
87 Ga0097621_100079555 3300006237 Bacteria 2725
88 Ga0075370_10000015 3300006353 Bacteria 62164
89 Ga0075428_100010090 3300006844 Bacteria 10492
90 Ga0075428_100012540 3300006844 Bacteria 9424
91 Ga0075431_100000539 3300006847 Bacteria 31835
92 Ga0075433_10189602 3300006852 Bacteria 1829
93 Ga0075434_100059274 3300006871 Bacteria 3805
94 Ga0075434_100108078 3300006871 Bacteria 2792
95 Ga0075429_100012060 3300006880 Bacteria 7490
96 Ga0068865_100081970 3300006881 Bacteria 2318
97 Ga0097620_100392279 3300006931 Bacteria 1484
98 Ga0097620_100565534 3300006931 Bacteria 1231
99 Ga0105240_10037276 3300009093 Bacteria 6250
100 Ga0105240_10303746 3300009093 Bacteria 1825
101 Ga0111539_10002861 3300009094 Bacteria 22927
102 Ga0111539_10024707 3300009094 Bacteria 7370
103 Ga0111539_10143292 3300009094 Bacteria 2797
104 Ga0105245_10015600 3300009098 Bacteria 6626
105 Ga0105245_10045784 3300009098 Bacteria 3908
106 Ga0105245_10225589 3300009098 Bacteria 1810
107 Ga0105247_10133073 3300009101 Bacteria 1622
108 Ga0114129_10000022 3300009147 Bacteria 119291
109 Ga0114129_10004925 3300009147 Bacteria 18843
110 Ga0114129_10033614 3300009147 Bacteria 7245
111 Ga0105243_10113459 3300009148 Bacteria 2273
112 Ga0105241_10335299 3300009174 Bacteria 1308
113 Ga0105248_10075373 3300009177 Unclassified 3792
114 Ga0105237_10007152 3300009545 Bacteria 12265
115 Ga0105238_10022052 3300009551 Bacteria 6491
116 Ga0105239_10001812 3300010375 Bacteria 28030
117 Ga0105239_10299087 3300010375 Bacteria 1812
118 Ga0157370_10056148 3300013104 Bacteria 3748
119 Ga0157369_10003746 3300013105 Bacteria 18062
120 Ga0157369_10089151 3300013105 Bacteria 3293
121 Ga0157374_10012484 3300013296 Bacteria 7394
122 Ga0157378_10037715 3300013297 Bacteria 4283
123 Ga0163162_10023573 3300013306 Bacteria 6075
124 Ga0163162_10036076 3300013306 Bacteria 4927
125 Ga0163162_10078319 3300013306 Bacteria 3370
126 Ga0163162_10141185 3300013306 Bacteria 2522
127 Ga0157372_10004426 3300013307 Bacteria 14985
128 Ga0157375_10025302 3300013308 Bacteria 5512
129 Ga0157375_10025462 3300013308 Bacteria 5498
130 Ga0157375_10100937 3300013308 Unclassified 2967
131 Ga0157380_10011968 3300014326 Bacteria 6277
132 Ga0157379_10076556 3300014968 Bacteria 2996
133 Ga0157379_10089475 3300014968 Bacteria 2762
134 Ga0163161_10041130 3300017792 Bacteria 3321
135 Ga0206356_10237658 3300020070 Bacteria 1959
136 Ga0214544_1000010 3300021320 Bacteria 270164
137 Ga0214542_1000023 3300021321 Bacteria 191557
138 Ga0214543_1000019 3300021327 Bacteria 267908
139 Ga0213872_10000009 3300021361 Bacteria 221470
140 Ga0213875_10000441 3300021388 Bacteria 36344
141 Ga0209148_1001585 3300025254 Bacteria 10738
142 Ga0207666_1004907 3300025271 Bacteria 1693
143 Ga0209455_1001650 3300025272 Bacteria 9682
144 Ga0207697_10002652 3300025315 Bacteria 9157
145 Ga0207682_10092479 3300025893 Bacteria 1313
146 Ga0207642_10000663 3300025899 Bacteria 10572
147 Ga0207680_10119224 3300025903 Bacteria 1723
148 Ga0207685_10027317 3300025905 Bacteria 1996
149 Ga0207699_10016879 3300025906 Bacteria 3829
150 Ga0207699_10067590 3300025906 Bacteria 2173
151 Ga0207699_10135913 3300025906 Bacteria 1610
152 Ga0207645_10003279 3300025907 Bacteria 12343
153 Ga0207645_10031750 3300025907 Bacteria 3396
154 Ga0207643_10001981 3300025908 Bacteria 11312
155 Ga0207705_10073107 3300025909 Bacteria 2487
156 Ga0207684_10039078 3300025910 Bacteria 4026
157 Ga0207684_10117954 3300025910 Bacteria 2274
158 Ga0207671_10007477 3300025914 Bacteria 9477
159 Ga0207693_10013375 3300025915 Bacteria 6617
160 Ga0207693_10016106 3300025915 Bacteria 5983
161 Ga0207663_10219767 3300025916 Bacteria 1382
162 Ga0207660_10086773 3300025917 Bacteria 2311
163 Ga0207662_10033230 3300025918 Bacteria 3005
164 Ga0207657_10115614 3300025919 Bacteria 2211
165 Ga0207652_10038399 3300025921 Bacteria 4059
166 Ga0207681_10022059 3300025923 Unclassified 4056
167 Ga0207694_10073396 3300025924 Bacteria 2677
168 Ga0207694_10325427 3300025924 Bacteria 1269
169 Ga0207650_10034931 3300025925 Unclassified 3648
170 Ga0207650_10197172 3300025925 Bacteria 1611
171 Ga0207659_10009790 3300025926 Bacteria 5996
172 Ga0207700_10021925 3300025928 Bacteria 4373
173 Ga0207700_10074989 3300025928 Bacteria 2619
174 Ga0207644_10037021 3300025931 Unclassified 3429
175 Ga0207644_10199627 3300025931 Bacteria 1577
176 Ga0207690_10122662 3300025932 Bacteria 1890
177 Ga0207706_10022590 3300025933 Bacteria 5646
178 Ga0207706_10050869 3300025933 Bacteria 3660
179 Ga0207706_10054668 3300025933 Bacteria 3523
180 Ga0207704_10018307 3300025938 Bacteria 3653
181 Ga0207665_10005228 3300025939 Bacteria 8669
182 Ga0207665_10008286 3300025939 Bacteria 6862
183 Ga0207691_10010912 3300025940 Bacteria 8721
184 Ga0207691_10016004 3300025940 Bacteria 7123
185 Ga0207691_10024234 3300025940 Bacteria 5707
186 Ga0207711_10132223 3300025941 Bacteria 2238
187 Ga0207661_10164492 3300025944 Bacteria 1927
188 Ga0207679_10053057 3300025945 Bacteria 2977
189 Ga0207651_10046925 3300025960 Bacteria 2909
190 Ga0207651_10075649 3300025960 Bacteria 2403
191 Ga0207712_10016384 3300025961 Bacteria 4798
192 Ga0207668_10006102 3300025972 Bacteria 7107
193 Ga0207668_10125580 3300025972 Bacteria 1950
194 Ga0207677_10017382 3300026023 Bacteria 4286
195 Ga0207703_10025445 3300026035 Bacteria 4655
196 Ga0207678_10014386 3300026067 Bacteria 6957
197 Ga0207708_10004345 3300026075 Bacteria 10438
198 Ga0207702_10092706 3300026078 Bacteria 2648
199 Ga0207641_10011439 3300026088 Bacteria 7284
200 Ga0207648_10026529 3300026089 Bacteria 5147
201 Ga0207676_10039419 3300026095 Bacteria 3613
202 Ga0207674_10104069 3300026116 Bacteria 2818
203 Ga0207675_100008646 3300026118 Bacteria 9572
204 Ga0207683_10008830 3300026121 Bacteria 8595
205 Ga0207683_10014227 3300026121 Bacteria 6778
206 Ga0207698_10016507 3300026142 Bacteria 4979
207 Ga0209983_1016162 3300027665 Bacteria 1540
208 Ga0209974_10005807 3300027876 Bacteria 4328
209 Ga0207428_10019476 3300027907 Bacteria 5786
210 Ga0207428_10046797 3300027907 Bacteria 3477
211 Ga0268266_10000337 3300028379 Bacteria 73510
212 Ga0268266_10000606 3300028379 Bacteria 48985
213 Ga0268266_10148940 3300028379 Bacteria 2107
214 Ga0265319_1026431 3300028563 Bacteria 2068
215 Ga0265318_10000416 3300028577 Bacteria 32874
216 Ga0265338_10057527 3300028800 Bacteria 3439
217 Ga0265338_10112798 3300028800 Bacteria 2185
218 Ga0265770_1009849 3300030878 Bacteria 1382
219 Ga0265330_10000017 3300031235 Bacteria 166302
220 Ga0265332_10000377 3300031238 Bacteria 32863
221 Ga0265328_10004344 3300031239 Bacteria 6163
222 Ga0265328_10077757 3300031239 Bacteria 1222
223 Ga0265320_10000005 3300031240 Bacteria 354422
224 Ga0265320_10010637 3300031240 Bacteria 5461
225 Ga0265320_10125895 3300031240 Bacteria 1166
226 Ga0265325_10011890 3300031241 Bacteria 4991
227 Ga0265325_10078422 3300031241 Bacteria 1645
228 Ga0265329_10007200 3300031242 Bacteria 4326
229 Ga0265329_10020640 3300031242 Bacteria 2222
230 Ga0265340_10001786 3300031247 Bacteria 12273
231 Ga0265339_10000503 3300031249 Bacteria 30482
232 Ga0265339_10004692 3300031249 Bacteria 9274
233 Ga0265331_10000013 3300031250 Bacteria 296011
234 Ga0265316_10004173 3300031344 Bacteria 14441
235 Ga0265316_10021355 3300031344 Bacteria 5484
236 Ga0265316_10049102 3300031344 Bacteria 3325
237 Ga0265316_10228012 3300031344 Bacteria 1373
238 Ga0265313_10000097 3300031595 Bacteria 89295
239 Ga0265313_10000099 3300031595 Bacteria 88958
240 Ga0265313_10005975 3300031595 Bacteria 8796
241 Ga0265313_10059424 3300031595 Bacteria 1798
242 Ga0265314_10000024 3300031711 Bacteria 295216
243 Ga0265314_10003766 3300031711 Bacteria 14503
244 Ga0265314_10005117 3300031711 Bacteria 11938
245 Ga0265342_10002370 3300031712 Bacteria 16323
246 Ga0265342_10005024 3300031712 Bacteria 10203
247 Ga0265342_10019371 3300031712 Bacteria 4387
248 Ga0316576_10073460 3300031727 Bacteria 2527
249 Ga0307516_10121407 3300031730 Bacteria 2403
250 Ga0307412_10014108 3300031911 Bacteria 4705
251 Ga0307409_100544042 3300031995 Bacteria 1139
252 Ga0373948_0017063 3300034817 Bacteria 1349
253 Ga0373934_0004110 3300035086 Bacteria 5365
254 Ga0373944_0115538 3300035089 Bacteria 920
255 Ga0373956_0000012 3300035119 Bacteria 57485
256 Ga0373957_0025878 3300035120 Bacteria 2118
257 Ga0373946_0195961 3300035171 Bacteria 965
258 Ga0316574_0052919 3300035398 Bacteria 2533
259 Ga0373931_0043465 3300035691 Bacteria 2366
260 Ga0373931_0175442 3300035691 Bacteria 1266
261 Ga0373927_0037992 3300035695 Bacteria 3128
262 Ga0373927_0040134 3300035695 Bacteria 3037
263 Ga0373927_0135580 3300035695 Unclassified 1609
264 Ga0373933_0000864 3300035724 Bacteria 18577
265 Ga0373933_0041406 3300035724 Bacteria 2719
266 Ga0373933_0145253 3300035724 Unclassified 1500
267 Ga0373937_0000290 3300036401 Bacteria 47834
268 Ga0373937_0002217 3300036401 Bacteria 16235
269 Ga0373937_0025248 3300036401 Bacteria 5365
270 Ga0373925_0043361 3300037068 Bacteria 3338
271 Ga0373925_0118084 3300037068 Bacteria 2056
272 Ga0395905_0007584 3300037471 Bacteria 10776
273 Ga0436364_1503727 3300037853 Bacteria 47109
274 Ga0395901_0254266 3300038443 Bacteria 1830
275 Ga0436361_0572581 3300039447 Bacteria 116104
276 Ga0436363_1182562 3300039450 Bacteria 2377
277 Ga0439449_0018286 3300042007 Bacteria 2631
278 Ga0466965_0006986 3300044683 Bacteria 5165
279 Ga0495603_0032014 3300046455 Bacteria 3165
280 Ga0495638_0067742 3300046460 Bacteria 2191
281 Ga0495641_0015404 3300046461 Bacteria 4084
282 Ga0495641_0036545 3300046461 Bacteria 2308
283 Ga0495651_0000027 3300046462 Bacteria 107496
284 Ga0495580_0138910 3300046472 Bacteria 1685
285 Ga0495582_0009777 3300046473 Bacteria 5283
286 Ga0495639_0063149 3300046475 Bacteria 1700
287 Ga0495639_0237832 3300046475 Bacteria 898
288 Ga0495584_0027065 3300046491 Bacteria 2906
289 Ga0495584_0081992 3300046491 Bacteria 1624
290 Ga0495585_0054470 3300046492 Bacteria 2211
291 Ga0495594_0062425 3300046499 Bacteria 2063
292 Ga0495607_0051103 3300046501 Bacteria 2402
293 Ga0495607_0053690 3300046501 Bacteria 2326
294 Ga0495583_0000004 3300046506 Bacteria 655287
295 Ga0495608_0136129 3300046511 Bacteria 1570
296 Ga0495610_0040331 3300046512 Bacteria 2354
297 Ga0495616_0077163 3300046513 Bacteria 1599
298 Ga0495644_0003141 3300046523 Bacteria 6533
299 Ga0495644_0010467 3300046523 Bacteria 3574
300 Ga0495644_0018121 3300046523 Bacteria 2689
301 Ga0495648_0000666 3300046524 Bacteria 36662
302 Ga0495648_0010028 3300046524 Bacteria 7263
303 Ga0495663_0019555 3300046525 Bacteria 1940
304 Ga0495666_0008724 3300046526 Bacteria 5078
305 Ga0495640_0238025 3300046533 Bacteria 1143
306 Ga0495586_0010466 3300046535 Unclassified 4931
307 Ga0495598_0003016 3300046537 Bacteria 3534
308 Ga0495645_0021304 3300046543 Bacteria 4684
309 Ga0495622_0017161 3300046557 Bacteria 3370
310 Ga0495633_0007501 3300046558 Bacteria 6270
311 Ga0495633_0007691 3300046558 Bacteria 6167
312 Ga0495633_0065546 3300046558 Bacteria 1697
313 Ga0495656_0009452 3300046615 Bacteria 3505
314 Ga0495656_0018819 3300046615 Bacteria 2658
315 Ga0495656_0021900 3300046615 Bacteria 2494
316 Ga0495656_0043228 3300046615 Bacteria 1891
317 Ga0495611_0007280 3300046648 Bacteria 4701
318 Ga0495611_0011620 3300046648 Bacteria 3734
319 Ga0495625_0017425 3300046660 Bacteria 5624
320 Ga0495659_0000707 3300046664 Bacteria 11994
321 Ga0495588_0128568 3300046674 Bacteria 1336
322 Ga0495647_0027688 3300046681 Bacteria 2084
323 Ga0495658_0012575 3300046683 Bacteria 4292
324 Ga0495658_0052782 3300046683 Bacteria 2307
325 Ga0495624_0021988 3300046690 Bacteria 4223
326 Ga0495670_0036849 3300046691 Bacteria 2437
327 Ga0495670_0059418 3300046691 Bacteria 1919
328 Ga0495671_0014428 3300046692 Bacteria 4252
329 Ga0495671_0083344 3300046692 Bacteria 1567
330 Ga0495649_0155776 3300046694 Bacteria 1199
331 Ga0495589_0082895 3300046794 Bacteria 1559
332 Ga0495581_0102720 3300047315 Bacteria 1661
333 Ga0495636_0001462 3300047318 Bacteria 8953
334 Ga0495672_0056246 3300047320 Bacteria 2290
335 Ga0495672_0082994 3300047320 Bacteria 1781
336 Ga0495676_0069896 3300047321 Bacteria 2707
337 Ga0495676_0130280 3300047321 Bacteria 1817
338 Ga0495683_0009603 3300047323 Bacteria 5151
339 Ga0495687_000186 3300047443 Bacteria 90747
340 Ga0495677_0002963 3300047445 Bacteria 6600
341 Ga0495677_0104713 3300047445 Bacteria 1073
342 Ga0495685_000004 3300047447 Bacteria 115775
343 Ga0495673_0003193 3300047469 Bacteria 10954
344 Ga0495684_0186389 3300047471 Bacteria 1536
345 Ga0495686_0001559 3300047472 Bacteria 24441
346 Ga0495593_0080589 3300047673 Bacteria 1684
347 Ga0495615_0019121 3300048090 Bacteria 1517
348 Ga0496100_0000926 3300048903 Bacteria 14006
349 Ga0496100_0017908 3300048903 Unclassified 4191
350 Ga0496101_0004982 3300048904 Bacteria 8431
351 Ga0496101_0025741 3300048904 Bacteria 4084
352 Ga0496102_0011303 3300048905 Bacteria 7690
353 Ga0496102_0017840 3300048905 Bacteria 6223
354 Ga0496102_0046048 3300048905 Bacteria 3961
355 Ga0496102_0227294 3300048905 Bacteria 1759
356 Ga0496103_0009246 3300048906 Bacteria 5838
357 Ga0496103_0050706 3300048906 Bacteria 2567
358 Ga0496104_0004884 3300048907 Bacteria 11686
359 Ga0496104_0013227 3300048907 Bacteria 7439
360 Ga0496104_0051729 3300048907 Bacteria 3878
361 Ga0496104_0194138 3300048907 Bacteria 1942
362 Ga0496105_0011257 3300048908 Bacteria 7060
363 Ga0496105_0017989 3300048908 Bacteria 5672
364 Ga0496105_0071516 3300048908 Bacteria 2867
365 Ga0496105_0124675 3300048908 Bacteria 2123
366 Ga0496106_0002648 3300048909 Bacteria 13321
367 Ga0496106_0077588 3300048909 Bacteria 2547
368 Ga0496106_0089326 3300048909 Bacteria 2376
369 Ga0496107_0006507 3300048910 Bacteria 8033
370 Ga0496107_0061237 3300048910 Bacteria 2724
371 Ga0496108_0048658 3300048911 Bacteria 3544
372 Ga0496108_0056126 3300048911 Bacteria 3308
373 Ga0496108_0115429 3300048911 Bacteria 2299
374 Ga0496109_0003628 3300048912 Bacteria 12895
375 Ga0496109_0569181 3300048912 Bacteria 1068
376 Ga0496110_0001389 3300048913 Bacteria 17461
377 Ga0496110_0036172 3300048913 Bacteria 4287
378 Ga0496110_0078212 3300048913 Bacteria 2944
379 Ga0496110_0154569 3300048913 Bacteria 2078
380 Ga0496111_0001694 3300048914 Bacteria 12851
381 Ga0496111_0009894 3300048914 Bacteria 6372
382 Ga0496112_0002700 3300048915 Bacteria 14347
383 Ga0496112_0179265 3300048915 Bacteria 2082
384 Ga0496112_0615672 3300048915 Bacteria 1017
385 Ga0496113_0010454 3300048916 Bacteria 6136
386 Ga0496113_0087067 3300048916 Bacteria 2401
387 Ga0496113_0091530 3300048916 Bacteria 2344
388 Ga0496114_0009376 3300048917 Bacteria 7771
389 Ga0496114_0119166 3300048917 Bacteria 2268
390 Ga0496115_0011961 3300048918 Bacteria 6519
391 Ga0496115_0012246 3300048918 Bacteria 6451
392 Ga0496115_0120309 3300048918 Bacteria 2160
393 Ga0496115_0223088 3300048918 Bacteria 1555
394 Ga0496117_0030523 3300048920 Bacteria 4134
395 Ga0496118_0081976 3300048921 Bacteria 2262
396 Ga0496120_0178889 3300048923 Bacteria 1043
397 Ga0496121_0002757 3300048924 Bacteria 26099
398 Ga0496121_0025130 3300048924 Bacteria 5666
399 Ga0496121_0034562 3300048924 Bacteria 4549
400 Ga0496121_0108796 3300048924 Bacteria 2120
401 Ga0496122_0100886 3300048925 Bacteria 1930
402 Ga0496125_0000516 3300048928 Bacteria 67232
403 Ga0496125_0004324 3300048928 Bacteria 16489
404 Ga0496125_0099189 3300048928 Bacteria 2152
405 Ga0496126_0169495 3300048929 Bacteria 1861
406 Ga0496126_0209135 3300048929 Bacteria 1643
407 Ga0496126_0351183 3300048929 Bacteria 1206
408 Ga0496126_0398322 3300048929 Bacteria 1117
409 Ga0495682_0009039 3300049460 Bacteria 3909
410 Ga0495682_0022741 3300049460 Bacteria 2343
411 Ga0501032_0134647 3300049569 Bacteria 1629
412 Ga0501034_0211599 3300049571 Bacteria 1894
413 Ga0501034_0362266 3300049571 Bacteria 1377
414 Ga0501037_0031800 3300049573 Bacteria 3896
415 Ga0501046_0172835 3300049580 Bacteria 1620
416 Ga0501047_0213390 3300049581 Bacteria 1788
417 Ga0501069_0081533 3300049585 Bacteria 1822
418 Ga0501070_0108420 3300049586 Bacteria 2294
419 Ga0501070_0301693 3300049586 Bacteria 1305
420 Ga0501072_0094232 3300049588 Bacteria 2379
421 Ga0501076_0059236 3300049592 Bacteria 3046
422 Ga0501207_010301 3300049654 Bacteria 1377
423 Ga0501080_0107042 3300049742 Bacteria 2592
424 Ga0501083_0094674 3300049744 Bacteria 1971
425 Ga0501035_0212053 3300049822 Bacteria 1657
426 Ga0501044_0027091 3300049823 Bacteria 6063
427 nmdc:mga03683_113_c1 3300050489 Bacteria 27805
428 nmdc:mga03n38_105637_c1 3300050490 Bacteria 1364
429 nmdc:mga03n38_5448_c1 3300050490 Bacteria 4336
430 nmdc:mga0yw44_17650_c1 3300050492 Bacteria 3889
431 nmdc:mga0yw44_330905_c1 3300050492 Bacteria 1024
432 nmdc:mga0yw44_580_c1 3300050492 Bacteria 13256
433 nmdc:mga0yw44_9528_c1 3300050492 Bacteria 4918
434 nmdc:mga0k408_9_c2 3300050493 Bacteria 64937
435 nmdc:mga06z11_47831_c1 3300050494 Bacteria 2174
436 nmdc:mga07m45_13_c1 3300050496 Bacteria 65600
437 nmdc:mga05p37_11744_c1 3300050507 Bacteria 10440
438 nmdc:mga05p37_48_c1 3300050507 Bacteria 104863
439 nmdc:mga05p37_747_c1 3300050507 Bacteria 36024
440 nmdc:mga09592_429128_c1 3300050508 Bacteria 1141
441 nmdc:mga09592_723_c2 3300050508 Bacteria 15482
442 nmdc:mga06r32_685_c1 3300050510 Bacteria 29517
443 nmdc:mga08y16_147624_c1 3300050511 Bacteria 2444
444 nmdc:mga08y16_151483_c1 3300050511 Bacteria 2410
445 nmdc:mga08y16_2123_c1 3300050511 Bacteria 20323
446 nmdc:mga08y16_232933_c1 3300050511 Bacteria 1905
447 nmdc:mga08y16_67417_c1 3300050511 Bacteria 3733
448 nmdc:mga0n895_474364_c1 3300050512 Bacteria 1262
449 nmdc:mga0n895_504226_c1 3300050512 Bacteria 1219
450 nmdc:mga0n895_96147_c1 3300050512 Bacteria 2967
451 nmdc:mga08x19_236822_c1 3300050514 Bacteria 1257
452 nmdc:mga0a205_252094_c1 3300050515 Bacteria 1644
453 nmdc:mga0sz30_532_c1 3300050516 Bacteria 14177
454 Ga0500646_0004337 3300053090 Bacteria 3592
455 Ga0500651_0004411 3300053093 Bacteria 7873
456 Ga0500566_0017693 3300053094 Bacteria 4186
457 Ga0500650_0075241 3300053098 Bacteria 1579
458 Ga0500554_077012 3300053102 Bacteria 1093
459 Ga0500595_000393 3300053119 Bacteria 28109
460 Ga0500608_000445 3300053122 Bacteria 15578
461 Ga0500642_0009734 3300053130 Bacteria 3354
462 Ga0500652_000932 3300053131 Bacteria 9668
463 Ga0500652_049479 3300053131 Bacteria 1713
464 Ga0500559_0000857 3300053136 Bacteria 19581
465 Ga0500616_0000006 3300053153 Bacteria 944738
466 Ga0500636_0003120 3300053177 Bacteria 9284
467 Ga0530510_0037283 3300061734 Bacteria 3505
468 Ga0530510_0192447 3300061734 Bacteria 1514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0041406 Ga0373933_0041406_767_1786 253
2 3300036401 Ga0373937_0002217 Ga0373937_0002217_3417_4436 253
3 3300047673 Ga0495593_0080589 Ga0495593_0080589_854_1669 253
4 3300048907 Ga0496104_0194138 Ga0496104_0194138_1116_1931 253
5 3300031242 Ga0265329_10020640 Ga0265329_100206402 254
6 3300047315 Ga0495581_0102720 Ga0495581_0102720_722_1648 255
7 3300049586 Ga0501070_0301693 Ga0501070_0301693_233_1195 255
8 3300049742 Ga0501080_0107042 Ga0501080_0107042_1064_1885 255
9 3300005457 Ga0070662_100018341 Ga0070662_1000183411 256
10 3300025933 Ga0207706_10050869 Ga0207706_100508692 256
11 3300025945 Ga0207679_10053057 Ga0207679_100530573 256
12 3300035086 Ga0373934_0004110 Ga0373934_0004110_1933_2850 256
13 3300035119 Ga0373956_0000012 Ga0373956_0000012_25043_25960 256
14 3300035120 Ga0373957_0025878 Ga0373957_0025878_766_1683 256
15 3300035724 Ga0373933_0000864 Ga0373933_0000864_14198_15115 256
16 3300036401 Ga0373937_0000290 Ga0373937_0000290_4644_5561 256
17 3300037471 Ga0395905_0007584 Ga0395905_0007584_5459_6406 256
18 3300046462 Ga0495651_0000027 Ga0495651_0000027_102649_103566 256
19 3300046511 Ga0495608_0136129 Ga0495608_0136129_640_1557 256
20 3300049592 Ga0501076_0059236 Ga0501076_0059236_1195_2142 256
21 3300050512 nmdc:mga0n895_96147_c1 nmdc:mga0n895_96147_c1_1628_2596 256
22 3300061734 Ga0530510_0037283 Ga0530510_0037283_1208_2155 256
23 3300031240 Ga0265320_10125895 Ga0265320_101258952 257
24 3300031344 Ga0265316_10228012 Ga0265316_102280121 257
25 3300009101 Ga0105247_10133073 Ga0105247_101330731 258
26 3300009147 Ga0114129_10033614 Ga0114129_100336147 258
27 3300027907 Ga0207428_10046797 Ga0207428_100467971 258
28 3300038443 Ga0395901_0254266 Ga0395901_0254266_290_1210 258
29 3300050507 nmdc:mga05p37_11744_c1 nmdc:mga05p37_11744_c1_615_1565 258
30 3300050511 nmdc:mga08y16_67417_c1 nmdc:mga08y16_67417_c1_2247_3197 258
31 3300053177 Ga0500636_0003120 Ga0500636_0003120_7095_7955 258
32 3300005436 Ga0070713_100168536 Ga0070713_1001685362 259
33 3300005445 Ga0070708_100037522 Ga0070708_1000375223 259
34 3300005467 Ga0070706_100081629 Ga0070706_1000816294 259
35 3300005468 Ga0070707_100095535 Ga0070707_1000955352 259
36 3300005471 Ga0070698_100085313 Ga0070698_1000853132 259
37 3300005518 Ga0070699_100104622 Ga0070699_1001046221 259
38 3300025910 Ga0207684_10039078 Ga0207684_100390783 259
39 3300028563 Ga0265319_1026431 Ga0265319_10264312 259
40 3300028800 Ga0265338_10112798 Ga0265338_101127982 259
41 3300031240 Ga0265320_10010637 Ga0265320_100106371 259
42 3300031241 Ga0265325_10078422 Ga0265325_100784221 259
43 3300031595 Ga0265313_10059424 Ga0265313_100594241 259
44 3300031727 Ga0316576_10073460 Ga0316576_100734603 259
45 3300046524 Ga0495648_0010028 Ga0495648_0010028_1632_2651 259
46 3300046615 Ga0495656_0018819 Ga0495656_0018819_121_1101 259
47 3300047471 Ga0495684_0186389 Ga0495684_0186389_30_980 259
48 3300048090 Ga0495615_0019121 Ga0495615_0019121_166_1146 259
49 3300048913 Ga0496110_0036172 Ga0496110_0036172_1911_2846 259
50 3300049569 Ga0501032_0134647 Ga0501032_0134647_535_1497 259
51 3300049654 Ga0501207_010301 Ga0501207_010301_350_1348 259
52 3300031911 Ga0307412_10014108 Ga0307412_100141083 260
53 3300035695 Ga0373927_0037992 Ga0373927_0037992_1093_2064 260
54 3300046475 Ga0495639_0063149 Ga0495639_0063149_228_1199 260
55 3300046526 Ga0495666_0008724 Ga0495666_0008724_2890_3861 260
56 3300046557 Ga0495622_0017161 Ga0495622_0017161_949_1911 260
57 3300053094 Ga0500566_0017693 Ga0500566_0017693_1432_2394 260
58 3300053102 Ga0500554_077012 Ga0500554_077012_53_1015 260
59 3300053131 Ga0500652_049479 Ga0500652_049479_400_1236 260
60 3300006048 Ga0075363_100026617 Ga0075363_1000266173 261
61 3300006871 Ga0075434_100108078 Ga0075434_1001080781 261
62 3300009094 Ga0111539_10024707 Ga0111539_100247072 261
63 3300013306 Ga0163162_10141185 Ga0163162_101411852 261
64 3300035691 Ga0373931_0175442 Ga0373931_0175442_102_1052 261
65 3300048905 Ga0496102_0227294 Ga0496102_0227294_611_1561 261
66 3300048906 Ga0496103_0009246 Ga0496103_0009246_2840_3790 261
67 3300048907 Ga0496104_0013227 Ga0496104_0013227_4074_5024 261
68 3300048908 Ga0496105_0011257 Ga0496105_0011257_3492_4442 261
69 3300048909 Ga0496106_0077588 Ga0496106_0077588_477_1427 261
70 3300048910 Ga0496107_0061237 Ga0496107_0061237_232_1182 261
71 3300048911 Ga0496108_0048658 Ga0496108_0048658_2557_3507 261
72 3300048912 Ga0496109_0003628 Ga0496109_0003628_7926_8876 261
73 3300048913 Ga0496110_0078212 Ga0496110_0078212_1303_2253 261
74 3300048914 Ga0496111_0001694 Ga0496111_0001694_11252_12202 261
75 3300048915 Ga0496112_0002700 Ga0496112_0002700_7432_8382 261
76 3300048916 Ga0496113_0010454 Ga0496113_0010454_4146_5096 261
77 3300048918 Ga0496115_0120309 Ga0496115_0120309_275_1225 261
78 3300048929 Ga0496126_0169495 Ga0496126_0169495_831_1784 261
79 3300048929 Ga0496126_0351183 Ga0496126_0351183_250_1185 261
80 3300050490 nmdc:mga03n38_105637_c1 nmdc:mga03n38_105637_c1_58_1029 261
81 3300050512 nmdc:mga0n895_474364_c1 nmdc:mga0n895_474364_c1_285_1220 261
82 3300005334 Ga0068869_100368353 Ga0068869_1003683531 262
83 3300005467 Ga0070706_100077372 Ga0070706_1000773724 262
84 3300025910 Ga0207684_10117954 Ga0207684_101179542 262
85 3300028577 Ga0265318_10000416 Ga0265318_1000041611 262
86 3300031235 Ga0265330_10000017 Ga0265330_1000001738 262
87 3300031238 Ga0265332_10000377 Ga0265332_1000037724 262
88 3300031239 Ga0265328_10004344 Ga0265328_100043442 262
89 3300031240 Ga0265320_10000005 Ga0265320_1000000569 262
90 3300031250 Ga0265331_10000013 Ga0265331_10000013190 262
91 3300031344 Ga0265316_10004173 Ga0265316_1000417310 262
92 3300031595 Ga0265313_10000097 Ga0265313_1000009775 262
93 3300031711 Ga0265314_10000024 Ga0265314_1000002470 262
94 3300031712 Ga0265342_10005024 Ga0265342_1000502412 262
95 3300046472 Ga0495580_0138910 Ga0495580_0138910_170_1141 262
96 3300046475 Ga0495639_0237832 Ga0495639_0237832_14_859 262
97 3300048920 Ga0496117_0030523 Ga0496117_0030523_910_1863 262
98 3300048921 Ga0496118_0081976 Ga0496118_0081976_825_1778 262
99 3300048923 Ga0496120_0178889 Ga0496120_0178889_57_1010 262
100 3300048924 Ga0496121_0002757 Ga0496121_0002757_9758_10711 262
101 3300049571 Ga0501034_0211599 Ga0501034_0211599_781_1707 262
102 3300050492 nmdc:mga0yw44_9528_c1 nmdc:mga0yw44_9528_c1_3680_4651 262
103 3300050494 nmdc:mga06z11_47831_c1 nmdc:mga06z11_47831_c1_1191_2162 262
104 3300053119 Ga0500595_000393 Ga0500595_000393_25736_26704 262
105 3300053153 Ga0500616_0000006 Ga0500616_0000006_234859_235806 262
106 3300005981 Ga0081538_10045198 Ga0081538_100451984 263
107 3300035695 Ga0373927_0135580 Ga0373927_0135580_231_1322 263
108 3300046501 Ga0495607_0051103 Ga0495607_0051103_922_1953 263
109 3300046501 Ga0495607_0053690 Ga0495607_0053690_737_1756 263
110 3300046506 Ga0495583_0000004 Ga0495583_0000004_317384_318415 263
111 3300046512 Ga0495610_0040331 Ga0495610_0040331_942_1964 263
112 3300046513 Ga0495616_0077163 Ga0495616_0077163_453_1469 263
113 3300046523 Ga0495644_0003141 Ga0495644_0003141_2468_3499 263
114 3300046523 Ga0495644_0010467 Ga0495644_0010467_2306_3325 263
115 3300046524 Ga0495648_0000666 Ga0495648_0000666_16571_17602 263
116 3300046558 Ga0495633_0007501 Ga0495633_0007501_4599_5621 263
117 3300046558 Ga0495633_0007691 Ga0495633_0007691_587_1606 263
118 3300046615 Ga0495656_0021900 Ga0495656_0021900_863_1894 263
119 3300046648 Ga0495611_0007280 Ga0495611_0007280_2306_3325 263
120 3300046648 Ga0495611_0011620 Ga0495611_0011620_2468_3499 263
121 3300046660 Ga0495625_0017425 Ga0495625_0017425_4135_5166 263
122 3300046664 Ga0495659_0000707 Ga0495659_0000707_7710_8741 263
123 3300046691 Ga0495670_0036849 Ga0495670_0036849_579_1610 263
124 3300046691 Ga0495670_0059418 Ga0495670_0059418_271_1293 263
125 3300046794 Ga0495589_0082895 Ga0495589_0082895_509_1528 263
126 3300047318 Ga0495636_0001462 Ga0495636_0001462_3255_4286 263
127 3300047320 Ga0495672_0056246 Ga0495672_0056246_901_1932 263
128 3300047321 Ga0495676_0130280 Ga0495676_0130280_490_1581 263
129 3300047323 Ga0495683_0009603 Ga0495683_0009603_823_1839 263
130 3300047443 Ga0495687_000186 Ga0495687_000186_33237_34268 263
131 3300047445 Ga0495677_0002963 Ga0495677_0002963_1564_2595 263
132 3300047447 Ga0495685_000004 Ga0495685_000004_6329_7360 263
133 3300047469 Ga0495673_0003193 Ga0495673_0003193_4616_5632 263
134 3300049460 Ga0495682_0009039 Ga0495682_0009039_2715_3734 263
135 3300049460 Ga0495682_0022741 Ga0495682_0022741_418_1449 263
136 3300006048 Ga0075363_100012028 Ga0075363_1000120282 264
137 3300006177 Ga0075362_10000064 Ga0075362_1000006419 264
138 3300006186 Ga0075369_10000970 Ga0075369_100009708 264
139 3300006195 Ga0075366_10000133 Ga0075366_1000013324 264
140 3300009098 Ga0105245_10015600 Ga0105245_100156004 264
141 3300025933 Ga0207706_10054668 Ga0207706_100546684 264
142 3300046491 Ga0495584_0081992 Ga0495584_0081992_25_996 264
143 3300046615 Ga0495656_0043228 Ga0495656_0043228_244_1215 264
144 3300046694 Ga0495649_0155776 Ga0495649_0155776_10_981 264
145 3300047472 Ga0495686_0001559 Ga0495686_0001559_13527_14564 264
146 3300048925 Ga0496122_0100886 Ga0496122_0100886_508_1464 264
147 3300048928 Ga0496125_0000516 Ga0496125_0000516_52775_53773 264
148 3300048928 Ga0496125_0004324 Ga0496125_0004324_9535_10491 264
149 3300050489 nmdc:mga03683_113_c1 nmdc:mga03683_113_c1_5553_6533 264
150 3300050490 nmdc:mga03n38_5448_c1 nmdc:mga03n38_5448_c1_2738_3718 264
151 3300050493 nmdc:mga0k408_9_c2 nmdc:mga0k408_9_c2_34222_35196 264
152 3300050516 nmdc:mga0sz30_532_c1 nmdc:mga0sz30_532_c1_1682_2662 264
153 3300005328 Ga0070676_10027946 Ga0070676_100279463 265
154 3300005340 Ga0070689_100054813 Ga0070689_1000548133 265
155 3300005341 Ga0070691_10047823 Ga0070691_100478232 265
156 3300005343 Ga0070687_100021826 Ga0070687_1000218263 265
157 3300005347 Ga0070668_100078817 Ga0070668_1000788172 265
158 3300005354 Ga0070675_100042093 Ga0070675_1000420932 265
159 3300005355 Ga0070671_100079035 Ga0070671_1000790352 265
160 3300005364 Ga0070673_100008514 Ga0070673_1000085146 265
161 3300005365 Ga0070688_100004710 Ga0070688_1000047106 265
162 3300005458 Ga0070681_10122131 Ga0070681_101221313 265
163 3300005459 Ga0068867_100021193 Ga0068867_1000211933 265
164 3300005466 Ga0070685_10001171 Ga0070685_100011713 265
165 3300005543 Ga0070672_100037830 Ga0070672_1000378303 265
166 3300005544 Ga0070686_100011380 Ga0070686_1000113802 265
167 3300005547 Ga0070693_100109815 Ga0070693_1001098152 265
168 3300005548 Ga0070665_100030885 Ga0070665_1000308852 265
169 3300005577 Ga0068857_100084989 Ga0068857_1000849893 265
170 3300005578 Ga0068854_100065890 Ga0068854_1000658902 265
171 3300005615 Ga0070702_100004612 Ga0070702_1000046126 265
172 3300005617 Ga0068859_100392298 Ga0068859_1003922981 265
173 3300005842 Ga0068858_100015491 Ga0068858_1000154914 265
174 3300005843 Ga0068860_100147599 Ga0068860_1001475993 265
175 3300005844 Ga0068862_100064653 Ga0068862_1000646532 265
176 3300006038 Ga0075365_10008953 Ga0075365_100089533 265
177 3300006237 Ga0097621_100079555 Ga0097621_1000795552 265
178 3300006931 Ga0097620_100392279 Ga0097620_1003922791 265
179 3300009094 Ga0111539_10143292 Ga0111539_101432922 265
180 3300009148 Ga0105243_10113459 Ga0105243_101134593 265
181 3300013296 Ga0157374_10012484 Ga0157374_100124841 265
182 3300013306 Ga0163162_10078319 Ga0163162_100783193 265
183 3300013308 Ga0157375_10025302 Ga0157375_100253023 265
184 3300014326 Ga0157380_10011968 Ga0157380_100119686 265
185 3300014968 Ga0157379_10076556 Ga0157379_100765561 265
186 3300021388 Ga0213875_10000441 Ga0213875_100004417 265
187 3300025899 Ga0207642_10000663 Ga0207642_1000066311 265
188 3300025907 Ga0207645_10031750 Ga0207645_100317502 265
189 3300025908 Ga0207643_10001981 Ga0207643_100019819 265
190 3300025918 Ga0207662_10033230 Ga0207662_100332302 265
191 3300025919 Ga0207657_10115614 Ga0207657_101156141 265
192 3300025925 Ga0207650_10197172 Ga0207650_101971722 265
193 3300025931 Ga0207644_10199627 Ga0207644_101996273 265
194 3300025938 Ga0207704_10018307 Ga0207704_100183072 265
195 3300025940 Ga0207691_10024234 Ga0207691_100242347 265
196 3300025941 Ga0207711_10132223 Ga0207711_101322232 265
197 3300025960 Ga0207651_10046925 Ga0207651_100469253 265
198 3300025961 Ga0207712_10016384 Ga0207712_100163845 265
199 3300025972 Ga0207668_10125580 Ga0207668_101255802 265
200 3300026035 Ga0207703_10025445 Ga0207703_100254454 265
201 3300026067 Ga0207678_10014386 Ga0207678_100143866 265
202 3300026075 Ga0207708_10004345 Ga0207708_100043459 265
203 3300026078 Ga0207702_10092706 Ga0207702_100927062 265
204 3300026088 Ga0207641_10011439 Ga0207641_100114397 265
205 3300026089 Ga0207648_10026529 Ga0207648_100265293 265
206 3300026095 Ga0207676_10039419 Ga0207676_100394192 265
207 3300026116 Ga0207674_10104069 Ga0207674_101040692 265
208 3300026118 Ga0207675_100008646 Ga0207675_1000086468 265
209 3300026121 Ga0207683_10014227 Ga0207683_100142276 265
210 3300027665 Ga0209983_1016162 Ga0209983_10161622 265
211 3300027876 Ga0209974_10005807 Ga0209974_100058073 265
212 3300028800 Ga0265338_10057527 Ga0265338_100575272 265
213 3300048903 Ga0496100_0000926 Ga0496100_0000926_11768_12739 265
214 3300048904 Ga0496101_0025741 Ga0496101_0025741_403_1374 265
215 3300048905 Ga0496102_0011303 Ga0496102_0011303_3192_4163 265
216 3300048906 Ga0496103_0050706 Ga0496103_0050706_770_1741 265
217 3300048908 Ga0496105_0124675 Ga0496105_0124675_141_1112 265
218 3300048910 Ga0496107_0006507 Ga0496107_0006507_2206_3177 265
219 3300048911 Ga0496108_0115429 Ga0496108_0115429_444_1415 265
220 3300048913 Ga0496110_0001389 Ga0496110_0001389_2527_3498 265
221 3300048914 Ga0496111_0009894 Ga0496111_0009894_514_1485 265
222 3300048915 Ga0496112_0179265 Ga0496112_0179265_624_1595 265
223 3300048916 Ga0496113_0091530 Ga0496113_0091530_609_1580 265
224 3300048917 Ga0496114_0009376 Ga0496114_0009376_6024_6995 265
225 3300048918 Ga0496115_0011961 Ga0496115_0011961_1533_2504 265
226 3300050492 nmdc:mga0yw44_580_c1 nmdc:mga0yw44_580_c1_3659_4630 265
227 3300050511 nmdc:mga08y16_151483_c1 nmdc:mga08y16_151483_c1_108_1079 265
228 3300050511 nmdc:mga08y16_232933_c1 nmdc:mga08y16_232933_c1_46_990 265
229 3300005614 Ga0068856_100081796 Ga0068856_1000817965 266
230 3300025906 Ga0207699_10135913 Ga0207699_101359131 266
231 3300025940 Ga0207691_10016004 Ga0207691_100160044 266
232 3300030878 Ga0265770_1009849 Ga0265770_10098491 266
233 3300006844 Ga0075428_100010090 Ga0075428_1000100902 267
234 3300009147 Ga0114129_10000022 Ga0114129_1000002279 267
235 3300035089 Ga0373944_0115538 Ga0373944_0115538_10_870 267
236 3300035171 Ga0373946_0195961 Ga0373946_0195961_26_886 267
237 3300035695 Ga0373927_0040134 Ga0373927_0040134_277_1137 267
238 3300037068 Ga0373925_0043361 Ga0373925_0043361_127_987 267
239 3300046455 Ga0495603_0032014 Ga0495603_0032014_865_1725 267
240 3300046461 Ga0495641_0015404 Ga0495641_0015404_1283_2143 267
241 3300046473 Ga0495582_0009777 Ga0495582_0009777_168_1028 267
242 3300046491 Ga0495584_0027065 Ga0495584_0027065_1274_2134 267
243 3300046492 Ga0495585_0054470 Ga0495585_0054470_1143_2003 267
244 3300046499 Ga0495594_0062425 Ga0495594_0062425_543_1403 267
245 3300046523 Ga0495644_0018121 Ga0495644_0018121_140_1000 267
246 3300046525 Ga0495663_0019555 Ga0495663_0019555_68_928 267
247 3300046537 Ga0495598_0003016 Ga0495598_0003016_821_1681 267
248 3300046558 Ga0495633_0065546 Ga0495633_0065546_821_1681 267
249 3300046615 Ga0495656_0009452 Ga0495656_0009452_2183_3043 267
250 3300046674 Ga0495588_0128568 Ga0495588_0128568_43_903 267
251 3300046683 Ga0495658_0052782 Ga0495658_0052782_791_1651 267
252 3300046690 Ga0495624_0021988 Ga0495624_0021988_689_1549 267
253 3300046692 Ga0495671_0083344 Ga0495671_0083344_247_1107 267
254 3300047321 Ga0495676_0069896 Ga0495676_0069896_1784_2644 267
255 3300047445 Ga0495677_0104713 Ga0495677_0104713_13_873 267
256 3300050507 nmdc:mga05p37_48_c1 nmdc:mga05p37_48_c1_92704_93645 267
257 3300005434 Ga0070709_10045979 Ga0070709_100459793 268
258 3300005435 Ga0070714_100050211 Ga0070714_1000502115 268
259 3300005435 Ga0070714_100105572 Ga0070714_1001055723 268
260 3300005436 Ga0070713_100003980 Ga0070713_1000039806 268
261 3300006028 Ga0070717_10039624 Ga0070717_100396244 268
262 3300006173 Ga0070716_100016230 Ga0070716_1000162304 268
263 3300006871 Ga0075434_100059274 Ga0075434_1000592742 268
264 3300025906 Ga0207699_10067590 Ga0207699_100675901 268
265 3300025915 Ga0207693_10013375 Ga0207693_100133752 268
266 3300025916 Ga0207663_10219767 Ga0207663_102197671 268
267 3300025928 Ga0207700_10021925 Ga0207700_100219255 268
268 3300025939 Ga0207665_10005228 Ga0207665_100052285 268
269 3300031995 Ga0307409_100544042 Ga0307409_1005440421 268
270 3300048928 Ga0496125_0099189 Ga0496125_0099189_1176_2036 268
271 3300050512 nmdc:mga0n895_504226_c1 nmdc:mga0n895_504226_c1_275_1135 268
272 3300053122 Ga0500608_000445 Ga0500608_000445_2404_3264 268
273 3300053131 Ga0500652_000932 Ga0500652_000932_4089_4949 268
274 3300053136 Ga0500559_0000857 Ga0500559_0000857_17400_18260 268
275 iso_pu_bacteria 2513237087 2513593896 268
276 3300005937 Ga0081455_10004299 Ga0081455_1000429913 270
277 3300021361 Ga0213872_10000009 Ga0213872_10000009166 270
278 3300039447 Ga0436361_0572581 Ga0436361_0572581_21868_22890 270
279 3300049571 Ga0501034_0362266 Ga0501034_0362266_225_1142 270
280 3300049586 Ga0501070_0108420 Ga0501070_0108420_1207_2124 270
281 3300049588 Ga0501072_0094232 Ga0501072_0094232_730_1647 270
282 3300049744 Ga0501083_0094674 Ga0501083_0094674_490_1407 270
283 3300005336 Ga0070680_100155789 Ga0070680_1001557892 272
284 3300005458 Ga0070681_10039100 Ga0070681_100391002 272
285 3300005530 Ga0070679_100029030 Ga0070679_1000290304 272
286 3300005548 Ga0070665_100189278 Ga0070665_1001892782 272
287 3300013104 Ga0157370_10056148 Ga0157370_100561483 272
288 3300013306 Ga0163162_10036076 Ga0163162_100360764 272
289 3300025917 Ga0207660_10086773 Ga0207660_100867732 272
290 3300025921 Ga0207652_10038399 Ga0207652_100383993 272
291 3300028379 Ga0268266_10148940 Ga0268266_101489402 272
292 3300031711 Ga0265314_10003766 Ga0265314_1000376615 272
293 3300031730 Ga0307516_10121407 Ga0307516_101214072 272
294 3300049573 Ga0501037_0031800 Ga0501037_0031800_2450_3322 272
295 3300009098 Ga0105245_10045784 Ga0105245_100457843 273
296 3300046460 Ga0495638_0067742 Ga0495638_0067742_326_1246 273
297 3300005539 Ga0068853_100042692 Ga0068853_1000426921 274
298 3300009174 Ga0105241_10335299 Ga0105241_103352991 274
299 3300009545 Ga0105237_10007152 Ga0105237_100071528 274
300 3300010375 Ga0105239_10001812 Ga0105239_1000181218 274
301 3300025914 Ga0207671_10007477 Ga0207671_100074772 274
302 3300028379 Ga0268266_10000606 Ga0268266_1000060615 274
303 3300035398 Ga0316574_0052919 Ga0316574_0052919_1547_2461 274
304 3300049823 Ga0501044_0027091 Ga0501044_0027091_1264_2286 274
305 3300050514 nmdc:mga08x19_236822_c1 nmdc:mga08x19_236822_c1_111_1058 274
306 3300048907 Ga0496104_0051729 Ga0496104_0051729_1879_2820 275
307 3300048908 Ga0496105_0071516 Ga0496105_0071516_608_1549 275
308 3300048918 Ga0496115_0223088 Ga0496115_0223088_247_1188 275
309 3300005937 Ga0081455_10006696 Ga0081455_100066963 276
310 3300006038 Ga0075365_10042747 Ga0075365_100427473 276
311 3300026142 Ga0207698_10016507 Ga0207698_100165072 276
312 3300031239 Ga0265328_10077757 Ga0265328_100777572 276
313 3300031241 Ga0265325_10011890 Ga0265325_100118904 276
314 3300031249 Ga0265339_10004692 Ga0265339_100046923 276
315 3300031595 Ga0265313_10005975 Ga0265313_100059753 276
316 3300031712 Ga0265342_10002370 Ga0265342_1000237013 276
317 3300048905 Ga0496102_0046048 Ga0496102_0046048_2487_3416 276
318 3300048907 Ga0496104_0004884 Ga0496104_0004884_10648_11577 276
319 3300048908 Ga0496105_0017989 Ga0496105_0017989_3706_4635 276
320 3300048909 Ga0496106_0089326 Ga0496106_0089326_353_1237 276
321 3300048911 Ga0496108_0056126 Ga0496108_0056126_2074_3003 276
322 3300048913 Ga0496110_0154569 Ga0496110_0154569_862_1791 276
323 3300048917 Ga0496114_0119166 Ga0496114_0119166_741_1670 276
324 3300005547 Ga0070693_100112683 Ga0070693_1001126832 277
325 3300005563 Ga0068855_100307625 Ga0068855_1003076252 277
326 3300005578 Ga0068854_100040631 Ga0068854_1000406312 277
327 3300005616 Ga0068852_100007804 Ga0068852_1000078049 277
328 3300009098 Ga0105245_10225589 Ga0105245_102255891 277
329 3300013105 Ga0157369_10003746 Ga0157369_1000374616 277
330 3300031247 Ga0265340_10001786 Ga0265340_100017863 277
331 3300031344 Ga0265316_10049102 Ga0265316_100491023 277
332 3300046543 Ga0495645_0021304 Ga0495645_0021304_3381_4397 277
333 3300048924 Ga0496121_0025130 Ga0496121_0025130_996_1991 277
334 3300048924 Ga0496121_0034562 Ga0496121_0034562_3004_3960 277
335 3300048929 Ga0496126_0209135 Ga0496126_0209135_545_1543 277
336 3300048929 Ga0496126_0398322 Ga0496126_0398322_45_998 277
337 3300049581 Ga0501047_0213390 Ga0501047_0213390_697_1722 277
338 3300050492 nmdc:mga0yw44_330905_c1 nmdc:mga0yw44_330905_c1_13_984 277
339 3300053093 Ga0500651_0004411 Ga0500651_0004411_4413_5366 277
340 3300053098 Ga0500650_0075241 Ga0500650_0075241_452_1405 277
341 3300053130 Ga0500642_0009734 Ga0500642_0009734_463_1416 277
342 3300037068 Ga0373925_0118084 Ga0373925_0118084_387_1322 278
343 3300044683 Ga0466965_0006986 Ga0466965_0006986_3568_4500 278
344 3300046461 Ga0495641_0036545 Ga0495641_0036545_788_1747 278
345 3300046533 Ga0495640_0238025 Ga0495640_0238025_138_1097 278
346 3300046535 Ga0495586_0010466 Ga0495586_0010466_105_1064 278
347 3300046681 Ga0495647_0027688 Ga0495647_0027688_918_1877 278
348 3300046683 Ga0495658_0012575 Ga0495658_0012575_2233_3192 278
349 3300049580 Ga0501046_0172835 Ga0501046_0172835_196_1134 278
350 3300005329 Ga0070683_100153545 Ga0070683_1001535451 279
351 3300005366 Ga0070659_100064306 Ga0070659_1000643061 279
352 3300005437 Ga0070710_10070786 Ga0070710_100707863 279
353 3300005539 Ga0068853_100016433 Ga0068853_1000164336 279
354 3300009093 Ga0105240_10037276 Ga0105240_100372766 279
355 3300009551 Ga0105238_10022052 Ga0105238_100220523 279
356 3300013307 Ga0157372_10004426 Ga0157372_100044262 279
357 3300025924 Ga0207694_10073396 Ga0207694_100733963 279
358 3300025928 Ga0207700_10074989 Ga0207700_100749893 279
359 3300025932 Ga0207690_10122662 Ga0207690_101226622 279
360 3300025944 Ga0207661_10164492 Ga0207661_101644922 279
361 3300039450 Ga0436363_1182562 Ga0436363_1182562_290_1240 279
362 3300048924 Ga0496121_0108796 Ga0496121_0108796_866_1816 279
363 3300006175 Ga0070712_100080586 Ga0070712_1000805862 280
364 3300006195 Ga0075366_10127229 Ga0075366_101272291 280
365 3300006353 Ga0075370_10000015 Ga0075370_1000001538 280
366 3300009093 Ga0105240_10303746 Ga0105240_103037462 280
367 3300009177 Ga0105248_10075373 Ga0105248_100753733 280
368 3300014968 Ga0157379_10089475 Ga0157379_100894756 280
369 3300025254 Ga0209148_1001585 Ga0209148_10015858 280
370 3300025272 Ga0209455_1001650 Ga0209455_10016505 280
371 3300025893 Ga0207682_10092479 Ga0207682_100924791 280
372 3300025924 Ga0207694_10325427 Ga0207694_103254272 280
373 3300034817 Ga0373948_0017063 Ga0373948_0017063_117_1079 280
374 3300035691 Ga0373931_0043465 Ga0373931_0043465_792_1754 280
375 3300046692 Ga0495671_0014428 Ga0495671_0014428_3078_4034 280
376 3300048915 Ga0496112_0615672 Ga0496112_0615672_20_976 280
377 3300050496 nmdc:mga07m45_13_c1 nmdc:mga07m45_13_c1_29908_30870 280
378 iso_pu_bacteria 2599185354 2600203477 280
379 iso_pu_bacteria 2885429604 2885430809 280
380 3300035724 Ga0373933_0145253 Ga0373933_0145253_214_1161 281
381 3300036401 Ga0373937_0025248 Ga0373937_0025248_3759_4706 281
382 3300042007 Ga0439449_0018286 Ga0439449_0018286_1625_2617 281
383 3300047320 Ga0495672_0082994 Ga0495672_0082994_219_1121 281
384 3300053090 Ga0500646_0004337 Ga0500646_0004337_1423_2439 281
385 iso_pu_bacteria 2913295892 2913299167 281
386 3300005354 Ga0070675_100024350 Ga0070675_1000243503 282
387 3300005364 Ga0070673_100302124 Ga0070673_1003021241 282
388 3300005466 Ga0070685_10304865 Ga0070685_103048651 282
389 3300006844 Ga0075428_100012540 Ga0075428_1000125408 282
390 3300006847 Ga0075431_100000539 Ga0075431_10000053924 282
391 3300006880 Ga0075429_100012060 Ga0075429_1000120604 282
392 3300009094 Ga0111539_10002861 Ga0111539_100028617 282
393 3300009147 Ga0114129_10004925 Ga0114129_1000492515 282
394 3300013105 Ga0157369_10089151 Ga0157369_100891513 282
395 3300013308 Ga0157375_10025462 Ga0157375_100254624 282
396 3300020070 Ga0206356_10237658 Ga0206356_102376582 282
397 3300025909 Ga0207705_10073107 Ga0207705_100731073 282
398 3300025925 Ga0207650_10034931 Ga0207650_100349313 282
399 3300027907 Ga0207428_10019476 Ga0207428_100194762 282
400 3300049585 Ga0501069_0081533 Ga0501069_0081533_690_1607 282
401 3300050492 nmdc:mga0yw44_17650_c1 nmdc:mga0yw44_17650_c1_2151_3092 282
402 3300050507 nmdc:mga05p37_747_c1 nmdc:mga05p37_747_c1_7606_8538 282
403 3300050508 nmdc:mga09592_429128_c1 nmdc:mga09592_429128_c1_31_972 282
404 3300050508 nmdc:mga09592_723_c2 nmdc:mga09592_723_c2_11233_12165 282
405 3300050510 nmdc:mga06r32_685_c1 nmdc:mga06r32_685_c1_25551_26483 282
406 3300050511 nmdc:mga08y16_147624_c1 nmdc:mga08y16_147624_c1_710_1651 282
407 3300050511 nmdc:mga08y16_2123_c1 nmdc:mga08y16_2123_c1_4874_5806 282
408 3300061734 Ga0530510_0192447 Ga0530510_0192447_328_1275 282
409 iso_pu_bacteria 2545555834 2545679473 282
410 iso_pu_bacteria 2595698237 2596374313 282
411 iso_pu_bacteria 2842698319 2842700824 282
412 iso_pu_bacteria 2907202186 2907203663 282
413 iso_pu_bacteria 641522639 641644112 282
414 3300005328 Ga0070676_10003500 Ga0070676_100035009 283
415 3300005330 Ga0070690_100028161 Ga0070690_1000281615 283
416 3300005338 Ga0068868_100011454 Ga0068868_1000114546 283
417 3300005347 Ga0070668_100007325 Ga0070668_1000073256 283
418 3300005353 Ga0070669_100022931 Ga0070669_1000229315 283
419 3300005354 Ga0070675_100062824 Ga0070675_1000628244 283
420 3300005356 Ga0070674_100108726 Ga0070674_1001087262 283
421 3300005364 Ga0070673_100058472 Ga0070673_1000584724 283
422 3300005367 Ga0070667_100031224 Ga0070667_1000312243 283
423 3300005437 Ga0070710_10059484 Ga0070710_100594842 283
424 3300005439 Ga0070711_100050780 Ga0070711_1000507804 283
425 3300005440 Ga0070705_100249781 Ga0070705_1002497812 283
426 3300005543 Ga0070672_100029922 Ga0070672_1000299224 283
427 3300005615 Ga0070702_100085456 Ga0070702_1000854562 283
428 3300006173 Ga0070716_100006047 Ga0070716_1000060476 283
429 3300006175 Ga0070712_100199875 Ga0070712_1001998751 283
430 3300006881 Ga0068865_100081970 Ga0068865_1000819704 283
431 3300010375 Ga0105239_10299087 Ga0105239_102990872 283
432 3300013297 Ga0157378_10037715 Ga0157378_100377155 283
433 3300013306 Ga0163162_10023573 Ga0163162_100235732 283
434 3300013308 Ga0157375_10100937 Ga0157375_101009372 283
435 3300017792 Ga0163161_10041130 Ga0163161_100411305 283
436 3300021320 Ga0214544_1000010 Ga0214544_100001076 283
437 3300021321 Ga0214542_1000023 Ga0214542_1000023176 283
438 3300021327 Ga0214543_1000019 Ga0214543_1000019251 283
439 3300025271 Ga0207666_1004907 Ga0207666_10049072 283
440 3300025315 Ga0207697_10002652 Ga0207697_100026526 283
441 3300025903 Ga0207680_10119224 Ga0207680_101192241 283
442 3300025905 Ga0207685_10027317 Ga0207685_100273172 283
443 3300025906 Ga0207699_10016879 Ga0207699_100168793 283
444 3300025907 Ga0207645_10003279 Ga0207645_100032799 283
445 3300025915 Ga0207693_10016106 Ga0207693_100161066 283
446 3300025923 Ga0207681_10022059 Ga0207681_100220594 283
447 3300025926 Ga0207659_10009790 Ga0207659_100097906 283
448 3300025931 Ga0207644_10037021 Ga0207644_100370212 283
449 3300025933 Ga0207706_10022590 Ga0207706_100225906 283
450 3300025939 Ga0207665_10008286 Ga0207665_100082866 283
451 3300025940 Ga0207691_10010912 Ga0207691_100109126 283
452 3300025960 Ga0207651_10075649 Ga0207651_100756493 283
453 3300025972 Ga0207668_10006102 Ga0207668_100061028 283
454 3300026023 Ga0207677_10017382 Ga0207677_100173827 283
455 3300026121 Ga0207683_10008830 Ga0207683_100088308 283
456 3300031242 Ga0265329_10007200 Ga0265329_100072002 283
457 3300031249 Ga0265339_10000503 Ga0265339_1000050325 283
458 3300031344 Ga0265316_10021355 Ga0265316_100213552 283
459 3300031595 Ga0265313_10000099 Ga0265313_1000009931 283
460 3300031711 Ga0265314_10005117 Ga0265314_100051172 283
461 3300031712 Ga0265342_10019371 Ga0265342_100193712 283
462 3300048903 Ga0496100_0017908 Ga0496100_0017908_2827_3750 283
463 3300048904 Ga0496101_0004982 Ga0496101_0004982_183_1106 283
464 3300048905 Ga0496102_0017840 Ga0496102_0017840_3550_4473 283
465 3300048909 Ga0496106_0002648 Ga0496106_0002648_1138_2061 283
466 3300048916 Ga0496113_0087067 Ga0496113_0087067_380_1303 283
467 3300048918 Ga0496115_0012246 Ga0496115_0012246_2038_2961 283
468 iso_pu_bacteria 2852387548 2852394228 283
469 iso_pu_bacteria 3003665799 3003667362 283
470 iso_pu_bacteria 643348564 643601283 283
471 iso_pu_bacteria 8057575449 8057579668 283
472 3300005548 Ga0070665_100000480 Ga0070665_10000048056 284
473 3300028379 Ga0268266_10000337 Ga0268266_100003372 284
474 3300049822 Ga0501035_0212053 Ga0501035_0212053_31_1017 284
475 iso_pu_bacteria 2643221651 2644290235 284
476 3300037853 Ga0436364_1503727 Ga0436364_1503727_29375_30307 285
477 iso_pu_bacteria 2848297114 2848297656 285
478 3300005293 Ga0065715_10229958 Ga0065715_102299581 291
479 3300005617 Ga0068859_100565548 Ga0068859_1005655482 291
480 3300006852 Ga0075433_10189602 Ga0075433_101896022 291
481 3300006931 Ga0097620_100565534 Ga0097620_1005655341 291
482 3300048912 Ga0496109_0569181 Ga0496109_0569181_56_982 291
483 3300050515 nmdc:mga0a205_252094_c1 nmdc:mga0a205_252094_c1_635_1561 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

55

244

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8715 207 277
6vd8-assembly1.cif.gz_B-2 metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8497 207 282
7y5g-assembly1.cif.gz_A cryo-em structure of a eukaryotic znt8 in the presence of zinc 0.8426 43 286
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8397 207 277
6vd8-assembly1.cif.gz_A metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8252 201 279
ID Description Score Start End Superfamily
af_Q3V5J4_162_375_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9206 47 197 1.20.1510.10
af_Q2FWA9_19_215_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9064 28 196 1.20.1510.10
af_Q4DAP4_369_464_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9048 200 278 3.30.70.1350
af_Q9ZT63_320_398_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8989 200 277 3.30.70.1350
af_D3ZWW5_236_448_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8982 43 196 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A536VYX9-F1-model_v4 Cation transporter 0.9238 219 291 GO:0005385
GO:0005886
AF-A0A536VYX9-F1-model_v4 Cation transporter 0.9117 219 291 GO:0005385
GO:0005886
AF-A0A3L7XB01-F1-model_v4 Cation transporter 0.9025 27 277 GO:0005385
GO:0005886
AF-W6K2D0-F1-model_v4 Cation diffusion facilitator family transporter 0.901 45 278 GO:0005385
GO:0005886
AF-A0A3D5UYM0-F1-model_v4 Cation transporter 0.8942 39 284 GO:0005385
GO:0005886

Feature Viewer

pLDDT pTM Quality
80.36 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map