F452813

General Info

Members Datasets Scaffolds Average Seq Length
483 245 479 117

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1385713|Ga0451793_1385713_1589_2017
Length 142
Sequence VRKARVIYDPGLSSFTEFPTRHEGREVHDIDAEEFEALVVAELDLLPDDMIDGLDNVVFVVEDRPEDGSLDLLGLYDGVALTERGQYGFGEMPDRIVLYREPLLGLVEDLDELKDQIHVTLVHEIAHFYGIDDSRLHELGWG

Samples

Sample ID Description Type Environment
1 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
2 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
3 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
4 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 2.69
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 20.7
Nodule 0
Rhizoplane 7.25
Rhizosphere 57.35
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10035992 3300001990 Bacteria 1530
2 JGI24735J21928_10017977 3300002067 Bacteria 2184
3 JGI25164J39214_1000526 3300002772 Bacteria 18052
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 Ga0055533_1000001 3300003756 Bacteria 1863437
6 Ga0055525_1000180 3300003759 Bacteria 78601
7 Ga0055527_1000012 3300003760 Bacteria 348744
8 Ga0055542_1000017 3300003762 Bacteria 348744
9 Ga0055529_1000023 3300003763 Bacteria 314383
10 Ga0065714_10080879 3300005288 Bacteria 2410
11 Ga0065714_10259321 3300005288 Bacteria 746
12 Ga0070658_10013790 3300005327 Bacteria 6484
13 Ga0070658_10075565 3300005327 Bacteria 2763
14 Ga0070683_100715303 3300005329 Bacteria 959
15 Ga0070682_100940825 3300005337 Bacteria 713
16 Ga0070660_100096819 3300005339 Bacteria 2334
17 Ga0070660_101802499 3300005339 Bacteria 521
18 Ga0070660_101892618 3300005339 Bacteria 508
19 Ga0070661_100184203 3300005344 Unclassified 1590
20 Ga0070669_100550088 3300005353 Bacteria 962
21 Ga0070674_101101880 3300005356 Bacteria 701
22 Ga0070688_100389240 3300005365 Bacteria 1029
23 Ga0070659_100000890 3300005366 Bacteria 21838
24 Ga0070667_101374799 3300005367 Bacteria 662
25 Ga0070710_10165065 3300005437 Bacteria 1376
26 Ga0070700_100615477 3300005441 Bacteria 853
27 Ga0070694_101931940 3300005444 Bacteria 504
28 Ga0070708_100205547 3300005445 Bacteria 1845
29 Ga0070685_10645427 3300005466 Bacteria 766
30 Ga0070685_11598851 3300005466 Bacteria 504
31 Ga0068853_100043217 3300005539 Bacteria 3855
32 Ga0070672_100490480 3300005543 Bacteria 1062
33 Ga0070665_101143812 3300005548 Bacteria 790
34 Ga0068855_100000948 3300005563 Bacteria 36113
35 Ga0068855_100005621 3300005563 Bacteria 15293
36 Ga0068855_100400810 3300005563 Bacteria 1503
37 Ga0068855_100408663 3300005563 Bacteria 1487
38 Ga0068857_100403684 3300005577 Bacteria 1272
39 Ga0068857_101915301 3300005577 Bacteria 581
40 Ga0068856_100049716 3300005614 Bacteria 4132
41 Ga0068852_100699543 3300005616 Bacteria 1023
42 Ga0068859_100186240 3300005617 Bacteria 2160
43 Ga0068861_100270220 3300005719 Bacteria 1460
44 Ga0068870_10350705 3300005840 Bacteria 947
45 Ga0068858_100000220 3300005842 Bacteria 61714
46 Ga0068862_100052700 3300005844 Bacteria 3482
47 Ga0075365_10024374 3300006038 Bacteria 3816
48 Ga0075365_10063414 3300006038 Bacteria 2474
49 Ga0075365_10158116 3300006038 Bacteria 1578
50 Ga0075365_10158138 3300006038 Bacteria 1578
51 Ga0075368_10027469 3300006042 Bacteria 2196
52 Ga0075363_100040504 3300006048 Bacteria 2456
53 Ga0075364_10033057 3300006051 Bacteria 3327
54 Ga0075364_10287804 3300006051 Bacteria 1118
55 Ga0075364_10558408 3300006051 Bacteria 782
56 Ga0075364_10630562 3300006051 Bacteria 732
57 Ga0075367_10010608 3300006178 Bacteria 4846
58 Ga0075369_10052586 3300006186 Bacteria 1766
59 Ga0075369_10063690 3300006186 Bacteria 1613
60 Ga0075369_10238670 3300006186 Bacteria 843
61 Ga0075369_10653636 3300006186 Bacteria 505
62 Ga0075366_10204527 3300006195 Bacteria 1201
63 Ga0075366_11001398 3300006195 Bacteria 521
64 Ga0075370_10012113 3300006353 Bacteria 4550
65 Ga0075430_100726552 3300006846 Bacteria 819
66 Ga0097620_100186238 3300006931 Bacteria 2160
67 Ga0105240_10261047 3300009093 Bacteria 1998
68 Ga0105240_10261938 3300009093 Bacteria 1994
69 Ga0105240_10772869 3300009093 Bacteria 1042
70 Ga0105240_11750969 3300009093 Bacteria 648
71 Ga0105245_10011384 3300009098 Bacteria 7749
72 Ga0105245_10021376 3300009098 Bacteria 5675
73 Ga0105243_10179661 3300009148 Bacteria 1839
74 Ga0105248_10000373 3300009177 Bacteria 52186
75 Ga0105248_10338711 3300009177 Bacteria 1693
76 Ga0105237_10110997 3300009545 Bacteria 2734
77 Ga0105237_10142051 3300009545 Bacteria 2395
78 Ga0105238_11049484 3300009551 Bacteria 837
79 Ga0105249_10250105 3300009553 Bacteria 1757
80 Ga0105239_11293991 3300010375 Bacteria 841
81 Ga0105239_11462057 3300010375 Bacteria 789
82 Ga0105246_10301117 3300011119 Bacteria 1294
83 Ga0105246_10436166 3300011119 Bacteria 1097
84 Ga0157370_10707231 3300013104 Bacteria 920
85 Ga0157369_10113106 3300013105 Bacteria 2884
86 Ga0157369_10120626 3300013105 Bacteria 2783
87 Ga0157369_10397193 3300013105 Bacteria 1430
88 Ga0163162_11436051 3300013306 Bacteria 785
89 Ga0163162_12583058 3300013306 Bacteria 584
90 Ga0157372_10086978 3300013307 Bacteria 3546
91 Ga0157375_10397105 3300013308 Bacteria 1546
92 Ga0163163_10136910 3300014325 Bacteria 2490
93 Ga0157380_10003895 3300014326 Bacteria 10292
94 Ga0157380_11225926 3300014326 Bacteria 795
95 Ga0157379_10021193 3300014968 Bacteria 5752
96 Ga0163161_11901385 3300017792 Bacteria 530
97 Ga0197907_10281564 3300020069 Bacteria 2687
98 Ga0206356_10587081 3300020070 Bacteria 971
99 Ga0206349_1147578 3300020075 Bacteria 1840
100 Ga0206355_1033871 3300020076 Bacteria 1455
101 Ga0206351_10198365 3300020077 Bacteria 649
102 Ga0206352_10150558 3300020078 Bacteria 1083
103 Ga0206352_10376925 3300020078 Bacteria 1134
104 Ga0206354_11082210 3300020081 Bacteria 4019
105 Ga0206353_11629956 3300020082 Bacteria 3312
106 Ga0224712_10142748 3300022467 Bacteria 1055
107 Ga0224712_10269081 3300022467 Bacteria 791
108 Ga0224712_10311757 3300022467 Bacteria 738
109 Ga0209566_100026 3300025225 Bacteria 367457
110 Ga0209674_100001 3300025226 Bacteria 4013750
111 Ga0209672_100003 3300025228 Bacteria 1560476
112 Ga0209147_100309 3300025229 Bacteria 38478
113 Ga0209563_100001 3300025230 Bacteria 4013775
114 Ga0207427_100089 3300025231 Bacteria 135504
115 Ga0209437_100592 3300025233 Bacteria 22827
116 Ga0209258_113336 3300025242 Bacteria 981
117 Ga0209677_100001 3300025253 Bacteria 4013787
118 Ga0209677_103457 3300025253 Bacteria 5118
119 Ga0209148_1000004 3300025254 Bacteria 1844481
120 Ga0209233_1000001 3300025261 Bacteria 2992747
121 Ga0209233_1016585 3300025261 Bacteria 2027
122 Ga0209455_1000022 3300025272 Bacteria 688910
123 Ga0209455_1001758 3300025272 Bacteria 9182
124 Ga0207692_10046133 3300025898 Bacteria 2184
125 Ga0207643_10050686 3300025908 Bacteria 2354
126 Ga0207705_10047617 3300025909 Bacteria 3083
127 Ga0207705_10085465 3300025909 Bacteria 2305
128 Ga0207705_10172122 3300025909 Bacteria 1631
129 Ga0207695_10001300 3300025913 Bacteria 42392
130 Ga0207695_10194522 3300025913 Bacteria 1944
131 Ga0207695_10564387 3300025913 Bacteria 1020
132 Ga0207695_11522759 3300025913 Bacteria 549
133 Ga0207671_10027275 3300025914 Bacteria 4270
134 Ga0207671_11027296 3300025914 Bacteria 649
135 Ga0207657_10109746 3300025919 Bacteria 2279
136 Ga0207657_10166962 3300025919 Bacteria 1785
137 Ga0207649_10502494 3300025920 Bacteria 922
138 Ga0207659_10126343 3300025926 Bacteria 1967
139 Ga0207687_10008412 3300025927 Bacteria 6746
140 Ga0207687_10045776 3300025927 Bacteria 3026
141 Ga0207644_10919434 3300025931 Bacteria 733
142 Ga0207690_10010448 3300025932 Bacteria 5518
143 Ga0207709_10036857 3300025935 Bacteria 2901
144 Ga0207669_11349021 3300025937 Bacteria 606
145 Ga0207711_10000702 3300025941 Bacteria 33018
146 Ga0207711_10051638 3300025941 Bacteria 3522
147 Ga0207711_11508346 3300025941 Bacteria 615
148 Ga0207661_10860811 3300025944 Bacteria 835
149 Ga0207667_10003840 3300025949 Bacteria 18467
150 Ga0207667_10010319 3300025949 Bacteria 10926
151 Ga0207667_10031662 3300025949 Bacteria 5707
152 Ga0207667_10124311 3300025949 Bacteria 2658
153 Ga0207667_10352329 3300025949 Bacteria 1501
154 Ga0207658_10247936 3300025986 Bacteria 1512
155 Ga0207703_10000031 3300026035 Bacteria 196940
156 Ga0207639_10025505 3300026041 Bacteria 4286
157 Ga0207702_10095013 3300026078 Bacteria 2618
158 Ga0207676_10941692 3300026095 Bacteria 849
159 Ga0207676_11891969 3300026095 Bacteria 595
160 Ga0207674_10208940 3300026116 Bacteria 1901
161 Ga0207675_100225123 3300026118 Bacteria 1808
162 Ga0207698_11772896 3300026142 Bacteria 633
163 Ga0209813_10199055 3300027866 Bacteria 741
164 Ga0268266_10259879 3300028379 Bacteria 1609
165 Ga0268265_10115197 3300028380 Bacteria 2203
166 Ga0307515_10061060 3300028794 Bacteria 5358
167 Ga0307515_10314773 3300028794 Bacteria 1237
168 Ga0307515_10370220 3300028794 Bacteria 1070
169 Ga0307515_10667522 3300028794 Bacteria 653
170 Ga0307515_10807734 3300028794 Bacteria 561
171 Ga0307513_10424858 3300031456 Bacteria 1058
172 Ga0307408_100145897 3300031548 Bacteria 1863
173 Ga0307408_101151230 3300031548 Bacteria 722
174 Ga0307514_10012355 3300031649 Bacteria 7104
175 Ga0307514_10298744 3300031649 Bacteria 904
176 Ga0307413_10897319 3300031824 Bacteria 753
177 Ga0307518_10397046 3300031838 Bacteria 772
178 Ga0307412_10993314 3300031911 Bacteria 741
179 Ga0307409_100427638 3300031995 Bacteria 1272
180 Ga0307409_100947454 3300031995 Bacteria 877
181 Ga0307409_101062048 3300031995 Bacteria 830
182 Ga0307416_100509935 3300032002 Bacteria 1269
183 Ga0307416_101292678 3300032002 Bacteria 835
184 Ga0307416_102780263 3300032002 Bacteria 585
185 Ga0307414_10208078 3300032004 Bacteria 1597
186 Ga0307414_10302763 3300032004 Bacteria 1353
187 Ga0307414_10664618 3300032004 Bacteria 940
188 Ga0307414_10697783 3300032004 Bacteria 919
189 Ga0307414_11350584 3300032004 Bacteria 662
190 Ga0307411_10722188 3300032005 Bacteria 870
191 Ga0307415_101592981 3300032126 Bacteria 627
192 Ga0395899_0003904 3300037312 Bacteria 11753
193 Ga0395900_0008025 3300037418 Bacteria 10865
194 Ga0395900_0079171 3300037418 Bacteria 3377
195 Ga0395900_0680442 3300037418 Bacteria 963
196 Ga0395898_0000473 3300037466 Bacteria 80586
197 Ga0395901_0408110 3300038443 Bacteria 1395
198 Ga0439438_114826 3300041405 Bacteria 649
199 Ga0439465_0140330 3300041413 Bacteria 858
200 Ga0439465_0204109 3300041413 Bacteria 721
201 Ga0451787_399641 3300041441 Bacteria 507
202 Ga0451789_0486937 3300041443 Bacteria 781
203 Ga0451789_0639749 3300041443 Bacteria 670
204 Ga0451791_0733286 3300041451 Bacteria 649
205 Ga0451791_1350956 3300041451 Bacteria 772
206 Ga0451791_1834760 3300041451 Bacteria 587
207 Ga0451793_0380051 3300041452 Bacteria 3024
208 Ga0451793_1005104 3300041452 Bacteria 1057
209 Ga0451793_1385713 3300041452 Bacteria 2976
210 Ga0451793_1524513 3300041452 Bacteria 1063
211 Ga0451797_0862352 3300041453 Bacteria 1567
212 Ga0451802_0496433 3300041460 Bacteria 584
213 Ga0451807_1863057 3300041486 Bacteria 745
214 Ga0451807_2073384 3300041486 Bacteria 1014
215 Ga0451833_0444373 3300041491 Bacteria 744
216 Ga0451839_0017204 3300041496 Bacteria 797
217 Ga0451841_1153759 3300041498 Bacteria 625
218 Ga0451843_1058260 3300041509 Bacteria 724
219 Ga0451855_0076135 3300041511 Bacteria 837
220 Ga0451853_0024538 3300041512 Bacteria 621
221 Ga0451853_3307998 3300041512 Bacteria 788
222 Ga0466972_0089340 3300044658 Bacteria 1462
223 Ga0466972_0135130 3300044658 Bacteria 1161
224 Ga0466972_0209977 3300044658 Bacteria 911
225 Ga0466972_0227188 3300044658 Bacteria 873
226 Ga0466965_0061819 3300044683 Bacteria 1872
227 Ga0466965_0114870 3300044683 Bacteria 1386
228 Ga0466965_0136982 3300044683 Bacteria 1272
229 Ga0466965_0339564 3300044683 Bacteria 821
230 Ga0466966_0353799 3300044684 Bacteria 882
231 Ga0466961_0207674 3300044693 Bacteria 1209
232 Ga0466961_0438168 3300044693 Bacteria 791
233 Ga0466964_0049494 3300044706 Bacteria 1721
234 Ga0466968_0404770 3300044735 Bacteria 669
235 Ga0466970_0002053 3300044765 Bacteria 9741
236 Ga0466970_0066352 3300044765 Bacteria 1937
237 Ga0466970_0096514 3300044765 Bacteria 1607
238 Ga0466970_0107332 3300044765 Bacteria 1523
239 Ga0466970_0227484 3300044765 Bacteria 1042
240 Ga0466957_0207535 3300044842 Bacteria 1289
241 Ga0466957_0252284 3300044842 Bacteria 1173
242 Ga0466960_0062607 3300044901 Bacteria 1829
243 Ga0466960_0286433 3300044901 Bacteria 924
244 Ga0466959_0045733 3300045049 Bacteria 3223
245 Ga0466959_0119089 3300045049 Bacteria 1878
246 Ga0466958_0100371 3300045836 Bacteria 1799
247 Ga0466958_0105392 3300045836 Bacteria 1757
248 Ga0466967_0875142 3300045976 Bacteria 893
249 Ga0495627_001560 3300046453 Bacteria 13028
250 Ga0495590_0000570 3300046457 Bacteria 17483
251 Ga0495638_0062879 3300046460 Bacteria 2290
252 Ga0495650_0003430 3300046471 Bacteria 11566
253 Ga0495644_0301195 3300046523 Bacteria 627
254 Ga0495644_0400680 3300046523 Bacteria 543
255 Ga0495656_0262607 3300046615 Bacteria 875
256 Ga0495656_0381821 3300046615 Bacteria 734
257 Ga0495668_0855207 3300046616 Bacteria 504
258 Ga0495613_0142888 3300046689 Bacteria 1709
259 Ga0495672_0394390 3300047320 Bacteria 634
260 Ga0495686_0224293 3300047472 Bacteria 1067
261 Ga0495626_0186564 3300048091 Bacteria 857
262 Ga0496100_0247462 3300048903 Bacteria 1317
263 Ga0496100_0411761 3300048903 Bacteria 1031
264 Ga0496102_0069953 3300048905 Bacteria 3222
265 Ga0496102_0273423 3300048905 Bacteria 1593
266 Ga0496102_1515436 3300048905 Bacteria 589
267 Ga0496103_0238922 3300048906 Bacteria 1169
268 Ga0496103_0661644 3300048906 Bacteria 663
269 Ga0496104_0077126 3300048907 Bacteria 3175
270 Ga0496105_0097801 3300048908 Bacteria 2424
271 Ga0496105_0099414 3300048908 Bacteria 2403
272 Ga0496105_0162742 3300048908 Bacteria 1832
273 Ga0496105_1308109 3300048908 Bacteria 529
274 Ga0496107_0459095 3300048910 Bacteria 946
275 Ga0496111_0888255 3300048914 Bacteria 642
276 Ga0496113_0508032 3300048916 Bacteria 968
277 Ga0496113_1109915 3300048916 Bacteria 620
278 Ga0496113_1347689 3300048916 Bacteria 554
279 Ga0496114_0150374 3300048917 Bacteria 2020
280 Ga0496115_0063205 3300048918 Bacteria 2986
281 Ga0496115_0147283 3300048918 Bacteria 1943
282 Ga0496115_0199949 3300048918 Bacteria 1651
283 Ga0496116_0035441 3300048919 Bacteria 3504
284 Ga0496117_0000741 3300048920 Bacteria 51359
285 Ga0496117_0012689 3300048920 Bacteria 7402
286 Ga0496117_0016291 3300048920 Bacteria 6280
287 Ga0496117_0018380 3300048920 Bacteria 5790
288 Ga0496117_0103406 3300048920 Bacteria 1795
289 Ga0496117_0218798 3300048920 Bacteria 1061
290 Ga0496118_0031641 3300048921 Bacteria 4380
291 Ga0496118_0055246 3300048921 Bacteria 2999
292 Ga0496118_0084138 3300048921 Bacteria 2221
293 Ga0496118_0108073 3300048921 Bacteria 1856
294 Ga0496118_0121643 3300048921 Bacteria 1700
295 Ga0496118_0161377 3300048921 Bacteria 1386
296 Ga0496119_0005846 3300048922 Bacteria 11623
297 Ga0496119_0006928 3300048922 Bacteria 10338
298 Ga0496119_0027472 3300048922 Bacteria 3909
299 Ga0496119_0091631 3300048922 Bacteria 1726
300 Ga0496119_0215737 3300048922 Bacteria 984
301 Ga0496119_0291445 3300048922 Bacteria 808
302 Ga0496119_0360901 3300048922 Bacteria 701
303 Ga0496120_0001117 3300048923 Bacteria 34800
304 Ga0496120_0227766 3300048923 Bacteria 887
305 Ga0496121_0311811 3300048924 Bacteria 1063
306 Ga0496121_0846743 3300048924 Bacteria 532
307 Ga0496122_0000031 3300048925 Bacteria 329726
308 Ga0496122_0000194 3300048925 Bacteria 139191
309 Ga0496122_0003254 3300048925 Bacteria 21559
310 Ga0496122_0005409 3300048925 Bacteria 15237
311 Ga0496122_0056820 3300048925 Bacteria 2913
312 Ga0496123_0000013 3300048926 Bacteria 439694
313 Ga0496123_0000225 3300048926 Bacteria 115105
314 Ga0496123_0001723 3300048926 Bacteria 29070
315 Ga0496123_0139084 3300048926 Bacteria 1330
316 Ga0496124_0008832 3300048927 Bacteria 10461
317 Ga0496124_0009763 3300048927 Bacteria 9820
318 Ga0496124_0075426 3300048927 Bacteria 2786
319 Ga0496125_0026149 3300048928 Bacteria 5329
320 Ga0496125_0074089 3300048928 Bacteria 2641
321 Ga0496125_0094184 3300048928 Bacteria 2232
322 Ga0496125_0237097 3300048928 Bacteria 1161
323 Ga0496126_0002808 3300048929 Bacteria 22901
324 Ga0496126_0003250 3300048929 Bacteria 20771
325 Ga0496126_0014461 3300048929 Bacteria 7975
326 Ga0496126_0058192 3300048929 Bacteria 3485
327 Ga0496126_0067338 3300048929 Bacteria 3199
328 Ga0496126_0130568 3300048929 Bacteria 2171
329 Ga0496126_0133833 3300048929 Bacteria 2140
330 Ga0496126_0409541 3300048929 Bacteria 1098
331 Ga0496126_0443050 3300048929 Bacteria 1047
332 Ga0496126_0484347 3300048929 Bacteria 991
333 Ga0496126_0796004 3300048929 Bacteria 726
334 Ga0496126_1043669 3300048929 Bacteria 611
335 Ga0501031_0002184 3300049568 Bacteria 12353
336 Ga0501031_0304906 3300049568 Bacteria 1032
337 Ga0501032_0009167 3300049569 Bacteria 7177
338 Ga0501032_0056560 3300049569 Bacteria 2637
339 Ga0501033_0001609 3300049570 Bacteria 19839
340 Ga0501033_0003085 3300049570 Bacteria 13845
341 Ga0501033_0013712 3300049570 Bacteria 6166
342 Ga0501033_0127190 3300049570 Bacteria 1847
343 Ga0501033_0131761 3300049570 Bacteria 1811
344 Ga0501034_0004814 3300049571 Bacteria 14917
345 Ga0501034_0022590 3300049571 Bacteria 6409
346 Ga0501034_0033037 3300049571 Bacteria 5253
347 Ga0501034_0055756 3300049571 Bacteria 3977
348 Ga0501034_0081857 3300049571 Bacteria 3230
349 Ga0501034_0103569 3300049571 Bacteria 2839
350 Ga0501034_0107952 3300049571 Bacteria 2775
351 Ga0501034_0124674 3300049571 Bacteria 2561
352 Ga0501034_0154979 3300049571 Bacteria 2265
353 Ga0501034_0169165 3300049571 Bacteria 2153
354 Ga0501036_0763100 3300049572 Bacteria 797
355 Ga0501038_0017804 3300049574 Bacteria 6419
356 Ga0501039_0067297 3300049575 Bacteria 2781
357 Ga0501039_0545568 3300049575 Bacteria 910
358 Ga0501040_0138581 3300049576 Bacteria 1713
359 Ga0501041_0533047 3300049577 Bacteria 748
360 Ga0501042_0002237 3300049578 Bacteria 11809
361 Ga0501042_0022787 3300049578 Bacteria 4376
362 Ga0501043_0001056 3300049579 Bacteria 24194
363 Ga0501043_0014359 3300049579 Bacteria 6200
364 Ga0501043_0280045 3300049579 Bacteria 1278
365 Ga0501043_0353984 3300049579 Bacteria 1115
366 Ga0501046_0006857 3300049580 Bacteria 10049
367 Ga0501046_0027133 3300049580 Bacteria 4676
368 Ga0501046_0071815 3300049580 Bacteria 2688
369 Ga0501047_0013675 3300049581 Bacteria 7704
370 Ga0501047_0020643 3300049581 Bacteria 6324
371 Ga0501047_0083572 3300049581 Bacteria 3068
372 Ga0501047_0400915 3300049581 Bacteria 1205
373 Ga0501047_0637275 3300049581 Bacteria 886
374 Ga0501047_0919090 3300049581 Bacteria 688
375 Ga0501048_0005083 3300049582 Bacteria 10016
376 Ga0501048_0397682 3300049582 Bacteria 985
377 Ga0501048_0713898 3300049582 Bacteria 720
378 Ga0501067_0073307 3300049583 Bacteria 1897
379 Ga0501067_0188790 3300049583 Bacteria 1148
380 Ga0501067_0237016 3300049583 Bacteria 1015
381 Ga0501068_0308747 3300049584 Bacteria 1013
382 Ga0501068_0417632 3300049584 Bacteria 866
383 Ga0501069_0116845 3300049585 Bacteria 1522
384 Ga0501070_0000100 3300049586 Bacteria 75001
385 Ga0501070_0002232 3300049586 Bacteria 17020
386 Ga0501070_0004119 3300049586 Bacteria 12505
387 Ga0501070_0063573 3300049586 Bacteria 3057
388 Ga0501070_0068771 3300049586 Bacteria 2932
389 Ga0501070_0121374 3300049586 Bacteria 2160
390 Ga0501070_0145612 3300049586 Bacteria 1955
391 Ga0501070_0462187 3300049586 Bacteria 1022
392 Ga0501071_0030558 3300049587 Bacteria 3811
393 Ga0501071_0668837 3300049587 Bacteria 799
394 Ga0501072_0078933 3300049588 Bacteria 2606
395 Ga0501072_1112186 3300049588 Bacteria 615
396 Ga0501073_0000087 3300049589 Bacteria 58557
397 Ga0501073_0060755 3300049589 Bacteria 2637
398 Ga0501073_0095093 3300049589 Bacteria 2070
399 Ga0501074_0024343 3300049590 Bacteria 4400
400 Ga0501077_0440601 3300049593 Bacteria 834
401 Ga0501202_194990 3300049652 Bacteria 552
402 Ga0501080_0004689 3300049742 Bacteria 12195
403 Ga0501080_0100859 3300049742 Bacteria 2678
404 Ga0501080_0177226 3300049742 Bacteria 1963
405 Ga0501035_0004284 3300049822 Bacteria 13546
406 Ga0501035_0038106 3300049822 Bacteria 4353
407 Ga0501035_0611352 3300049822 Bacteria 887
408 Ga0501035_0736252 3300049822 Bacteria 792
409 Ga0501035_0873577 3300049822 Bacteria 714
410 Ga0501044_0006761 3300049823 Bacteria 12638
411 Ga0501044_0011666 3300049823 Bacteria 9523
412 Ga0501044_0042432 3300049823 Bacteria 4731
413 Ga0501044_0113629 3300049823 Bacteria 2714
414 Ga0501044_0184303 3300049823 Bacteria 2053
415 Ga0501044_0381334 3300049823 Bacteria 1325
416 Ga0501045_0006985 3300049824 Bacteria 7829
417 nmdc:mga03n38_97192_c1 3300050490 Bacteria 1414
418 nmdc:mga00v17_121791_c1 3300050491 Bacteria 1661
419 nmdc:mga00v17_17040_c1 3300050491 Bacteria 4103
420 nmdc:mga00v17_173453_c1 3300050491 Bacteria 1391
421 nmdc:mga00v17_23031_c1 3300050491 Bacteria 3600
422 nmdc:mga0yw44_15887_c1 3300050492 Bacteria 4049
423 nmdc:mga0yw44_34720_c1 3300050492 Bacteria 2957
424 nmdc:mga0yw44_38507_c1 3300050492 Bacteria 2830
425 nmdc:mga0yw44_417614_c1 3300050492 Bacteria 908
426 nmdc:mga0yw44_498181_c1 3300050492 Bacteria 826
427 nmdc:mga0yw44_798141_c1 3300050492 Bacteria 641
428 nmdc:mga06z11_219439_c1 3300050494 Bacteria 640
429 nmdc:mga04h51_11081_c1 3300050495 Bacteria 2493
430 nmdc:mga07m45_66895_c1 3300050496 Bacteria 2042
431 nmdc:mga0qj67_778211_c1 3300050509 Bacteria 758
432 nmdc:mga0sz30_237504_c1 3300050516 Bacteria 811
433 nmdc:mga0sz30_347943_c1 3300050516 Bacteria 662
434 nmdc:mga0sz30_41127_c1 3300050516 Bacteria 1943
435 nmdc:mga0sz30_5817_c1 3300050516 Bacteria 3999
436 nmdc:mga0sz30_58658_c1 3300050516 Bacteria 1641
437 Ga0500643_001841 3300053087 Bacteria 11595
438 Ga0500651_0758450 3300053093 Bacteria 515
439 Ga0500554_181650 3300053102 Bacteria 707
440 Ga0500556_0000001 3300053104 Bacteria 1135060
441 Ga0500556_0000920 3300053104 Bacteria 16109
442 Ga0500562_015936 3300053108 Bacteria 1930
443 Ga0500593_123290 3300053117 Bacteria 1046
444 Ga0500655_001201 3300053133 Bacteria 4929
445 Ga0500559_0000182 3300053136 Bacteria 49814
446 Ga0500559_0000443 3300053136 Bacteria 29438
447 Ga0500559_0004678 3300053136 Bacteria 6444
448 Ga0500559_0023006 3300053136 Bacteria 2645
449 Ga0500559_0045776 3300053136 Bacteria 1917
450 Ga0500559_0145342 3300053136 Bacteria 1111
451 Ga0500559_0232320 3300053136 Bacteria 869
452 Ga0500568_0000006 3300053139 Bacteria 522235
453 Ga0500568_0000698 3300053139 Bacteria 24073
454 Ga0500568_0006247 3300053139 Bacteria 6014
455 Ga0500568_0056794 3300053139 Bacteria 1524
456 Ga0500573_0016021 3300053140 Bacteria 4252
457 Ga0500573_0049708 3300053140 Bacteria 2413
458 Ga0500573_0057652 3300053140 Bacteria 2228
459 Ga0500573_0065468 3300053140 Bacteria 2078
460 Ga0500573_0070355 3300053140 Bacteria 1996
461 Ga0500573_0076151 3300053140 Bacteria 1909
462 Ga0500573_0183279 3300053140 Bacteria 1124
463 Ga0500573_0248771 3300053140 Bacteria 917
464 Ga0500573_0259366 3300053140 Bacteria 891
465 Ga0500573_0291715 3300053140 Bacteria 820
466 Ga0500573_0359362 3300053140 Bacteria 704
467 Ga0500573_0373675 3300053140 Bacteria 684
468 Ga0500573_0438837 3300053140 Bacteria 607
469 Ga0500573_0489654 3300053140 Bacteria 558
470 Ga0500577_0006459 3300053142 Bacteria 3238
471 Ga0500577_0100779 3300053142 Bacteria 1180
472 Ga0500588_0034034 3300053146 Bacteria 1490
473 Ga0500590_000733 3300053148 Bacteria 11965
474 Ga0500616_0000078 3300053153 Bacteria 202009
475 Ga0500616_0002208 3300053153 Bacteria 16677
476 Ga0500616_0160491 3300053153 Bacteria 1031
477 Ga0501084_0023435 3300054114 Bacteria 5151
478 Ga0587106_165710 3300059605 Bacteria 501
479 Ga0466962_0099466 3300061719 Bacteria 1396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100205547 Ga0070708_1002055474 112
2 iso_pu_bacteria 2870622029 2870624039 112
3 iso_pu_bacteria 2870628048 2870630487 112
4 3300025944 Ga0207661_10860811 Ga0207661_108608111 114
5 iso_pu_bacteria 2984580707 2984581245 114
6 3300005329 Ga0070683_100715303 Ga0070683_1007153031 115
7 3300005353 Ga0070669_100550088 Ga0070669_1005500882 115
8 3300005441 Ga0070700_100615477 Ga0070700_1006154771 115
9 3300005444 Ga0070694_101931940 Ga0070694_1019319401 115
10 3300005466 Ga0070685_11598851 Ga0070685_115988511 115
11 3300005577 Ga0068857_100403684 Ga0068857_1004036843 115
12 3300005719 Ga0068861_100270220 Ga0068861_1002702203 115
13 3300005840 Ga0068870_10350705 Ga0068870_103507051 115
14 3300005844 Ga0068862_100052700 Ga0068862_1000527002 115
15 3300006846 Ga0075430_100726552 Ga0075430_1007265522 115
16 3300009148 Ga0105243_10179661 Ga0105243_101796612 115
17 3300009553 Ga0105249_10250105 Ga0105249_102501051 115
18 3300011119 Ga0105246_10301117 Ga0105246_103011172 115
19 3300013105 Ga0157369_10113106 Ga0157369_101131062 115
20 3300013105 Ga0157369_10120626 Ga0157369_101206263 115
21 3300014326 Ga0157380_10003895 Ga0157380_100038954 115
22 3300020082 Ga0206353_11629956 Ga0206353_116299562 115
23 3300025908 Ga0207643_10050686 Ga0207643_100506862 115
24 3300025909 Ga0207705_10172122 Ga0207705_101721223 115
25 3300025926 Ga0207659_10126343 Ga0207659_101263432 115
26 3300025935 Ga0207709_10036857 Ga0207709_100368575 115
27 3300026095 Ga0207676_10941692 Ga0207676_109416922 115
28 3300026118 Ga0207675_100225123 Ga0207675_1002251232 115
29 3300028380 Ga0268265_10115197 Ga0268265_101151972 115
30 3300028794 Ga0307515_10370220 Ga0307515_103702202 115
31 3300028794 Ga0307515_10807734 Ga0307515_108077342 115
32 3300031548 Ga0307408_100145897 Ga0307408_1001458972 115
33 3300031548 Ga0307408_101151230 Ga0307408_1011512302 115
34 3300031649 Ga0307514_10012355 Ga0307514_100123553 115
35 3300031824 Ga0307413_10897319 Ga0307413_108973192 115
36 3300031995 Ga0307409_100427638 Ga0307409_1004276383 115
37 3300031995 Ga0307409_101062048 Ga0307409_1010620482 115
38 3300032002 Ga0307416_100509935 Ga0307416_1005099352 115
39 3300032002 Ga0307416_101292678 Ga0307416_1012926781 115
40 3300032002 Ga0307416_102780263 Ga0307416_1027802631 115
41 3300032004 Ga0307414_10302763 Ga0307414_103027632 115
42 3300032004 Ga0307414_10697783 Ga0307414_106977833 115
43 3300032005 Ga0307411_10722188 Ga0307411_107221881 115
44 3300032126 Ga0307415_101592981 Ga0307415_1015929811 115
45 3300037418 Ga0395900_0680442 Ga0395900_0680442_76_423 115
46 3300038443 Ga0395901_0408110 Ga0395901_0408110_331_678 115
47 3300041405 Ga0439438_114826 Ga0439438_114826_271_618 115
48 3300041441 Ga0451787_399641 Ga0451787_399641_146_493 115
49 3300041443 Ga0451789_0639749 Ga0451789_0639749_54_401 115
50 3300041491 Ga0451833_0444373 Ga0451833_0444373_79_426 115
51 3300041509 Ga0451843_1058260 Ga0451843_1058260_117_464 115
52 3300041512 Ga0451853_3307998 Ga0451853_3307998_295_642 115
53 3300046453 Ga0495627_001560 Ga0495627_001560_4989_5336 115
54 3300046460 Ga0495638_0062879 Ga0495638_0062879_1812_2159 115
55 3300046689 Ga0495613_0142888 Ga0495613_0142888_717_1064 115
56 3300048905 Ga0496102_1515436 Ga0496102_1515436_160_507 115
57 3300048906 Ga0496103_0661644 Ga0496103_0661644_104_451 115
58 3300048916 Ga0496113_1347689 Ga0496113_1347689_191_538 115
59 3300048920 Ga0496117_0000741 Ga0496117_0000741_7187_7534 115
60 3300048920 Ga0496117_0103406 Ga0496117_0103406_132_479 115
61 3300048922 Ga0496119_0027472 Ga0496119_0027472_847_1194 115
62 3300048922 Ga0496119_0215737 Ga0496119_0215737_426_773 115
63 3300048924 Ga0496121_0311811 Ga0496121_0311811_608_955 115
64 3300048925 Ga0496122_0005409 Ga0496122_0005409_5861_6208 115
65 3300048925 Ga0496122_0056820 Ga0496122_0056820_1931_2278 115
66 3300048927 Ga0496124_0075426 Ga0496124_0075426_955_1302 115
67 3300048928 Ga0496125_0026149 Ga0496125_0026149_3019_3366 115
68 3300048928 Ga0496125_0094184 Ga0496125_0094184_1351_1698 115
69 3300048929 Ga0496126_0002808 Ga0496126_0002808_7375_7722 115
70 3300048929 Ga0496126_0003250 Ga0496126_0003250_12990_13337 115
71 3300048929 Ga0496126_0058192 Ga0496126_0058192_1331_1678 115
72 3300048929 Ga0496126_0130568 Ga0496126_0130568_1640_1987 115
73 3300048929 Ga0496126_0133833 Ga0496126_0133833_29_376 115
74 3300048929 Ga0496126_0796004 Ga0496126_0796004_255_602 115
75 3300049568 Ga0501031_0002184 Ga0501031_0002184_8024_8371 115
76 3300049568 Ga0501031_0304906 Ga0501031_0304906_53_400 115
77 3300049569 Ga0501032_0009167 Ga0501032_0009167_3055_3402 115
78 3300049570 Ga0501033_0001609 Ga0501033_0001609_7170_7517 115
79 3300049570 Ga0501033_0003085 Ga0501033_0003085_9775_10122 115
80 3300049571 Ga0501034_0004814 Ga0501034_0004814_11576_11923 115
81 3300049571 Ga0501034_0107952 Ga0501034_0107952_422_769 115
82 3300049574 Ga0501038_0017804 Ga0501038_0017804_631_978 115
83 3300049575 Ga0501039_0067297 Ga0501039_0067297_479_826 115
84 3300049576 Ga0501040_0138581 Ga0501040_0138581_281_628 115
85 3300049577 Ga0501041_0533047 Ga0501041_0533047_326_673 115
86 3300049578 Ga0501042_0022787 Ga0501042_0022787_2051_2398 115
87 3300049579 Ga0501043_0014359 Ga0501043_0014359_976_1323 115
88 3300049580 Ga0501046_0006857 Ga0501046_0006857_6015_6362 115
89 3300049581 Ga0501047_0020643 Ga0501047_0020643_206_553 115
90 3300049581 Ga0501047_0919090 Ga0501047_0919090_34_381 115
91 3300049582 Ga0501048_0005083 Ga0501048_0005083_1663_2010 115
92 3300049582 Ga0501048_0397682 Ga0501048_0397682_55_402 115
93 3300049583 Ga0501067_0073307 Ga0501067_0073307_1022_1369 115
94 3300049586 Ga0501070_0121374 Ga0501070_0121374_1341_1688 115
95 3300049586 Ga0501070_0462187 Ga0501070_0462187_470_817 115
96 3300049588 Ga0501072_1112186 Ga0501072_1112186_246_593 115
97 3300049589 Ga0501073_0060755 Ga0501073_0060755_1961_2308 115
98 3300049590 Ga0501074_0024343 Ga0501074_0024343_3666_4013 115
99 3300049652 Ga0501202_194990 Ga0501202_194990_107_454 115
100 3300049742 Ga0501080_0177226 Ga0501080_0177226_441_788 115
101 3300049822 Ga0501035_0004284 Ga0501035_0004284_9096_9443 115
102 3300049822 Ga0501035_0736252 Ga0501035_0736252_94_441 115
103 3300049823 Ga0501044_0011666 Ga0501044_0011666_1005_1352 115
104 3300049823 Ga0501044_0042432 Ga0501044_0042432_1653_2000 115
105 3300049823 Ga0501044_0113629 Ga0501044_0113629_206_553 115
106 3300049824 Ga0501045_0006985 Ga0501045_0006985_6319_6666 115
107 3300050492 nmdc:mga0yw44_498181_c1 nmdc:mga0yw44_498181_c1_318_665 115
108 3300050509 nmdc:mga0qj67_778211_c1 nmdc:mga0qj67_778211_c1_271_618 115
109 3300053104 Ga0500556_0000001 Ga0500556_0000001_614541_614891 115
110 3300053136 Ga0500559_0004678 Ga0500559_0004678_1279_1629 115
111 3300053136 Ga0500559_0023006 Ga0500559_0023006_712_1059 115
112 3300053136 Ga0500559_0145342 Ga0500559_0145342_599_949 115
113 3300053136 Ga0500559_0232320 Ga0500559_0232320_469_816 115
114 3300053139 Ga0500568_0000006 Ga0500568_0000006_79733_80083 115
115 3300053139 Ga0500568_0006247 Ga0500568_0006247_2176_2523 115
116 3300053140 Ga0500573_0183279 Ga0500573_0183279_622_972 115
117 3300053140 Ga0500573_0359362 Ga0500573_0359362_224_571 115
118 3300053140 Ga0500573_0438837 Ga0500573_0438837_179_526 115
119 3300054114 Ga0501084_0023435 Ga0501084_0023435_824_1171 115
120 3300005288 Ga0065714_10080879 Ga0065714_100808794 116
121 3300005288 Ga0065714_10259321 Ga0065714_102593212 116
122 3300005327 Ga0070658_10013790 Ga0070658_100137903 116
123 3300005327 Ga0070658_10075565 Ga0070658_100755652 116
124 3300005337 Ga0070682_100940825 Ga0070682_1009408252 116
125 3300005339 Ga0070660_100096819 Ga0070660_1000968194 116
126 3300005339 Ga0070660_101892618 Ga0070660_1018926181 116
127 3300005344 Ga0070661_100184203 Ga0070661_1001842033 116
128 3300005356 Ga0070674_101101880 Ga0070674_1011018803 116
129 3300005365 Ga0070688_100389240 Ga0070688_1003892402 116
130 3300005366 Ga0070659_100000890 Ga0070659_10000089016 116
131 3300005367 Ga0070667_101374799 Ga0070667_1013747992 116
132 3300005466 Ga0070685_10645427 Ga0070685_106454272 116
133 3300005539 Ga0068853_100043217 Ga0068853_1000432174 116
134 3300005543 Ga0070672_100490480 Ga0070672_1004904803 116
135 3300005548 Ga0070665_101143812 Ga0070665_1011438122 116
136 3300005563 Ga0068855_100000948 Ga0068855_10000094843 116
137 3300005563 Ga0068855_100005621 Ga0068855_1000056216 116
138 3300005563 Ga0068855_100400810 Ga0068855_1004008101 116
139 3300005577 Ga0068857_101915301 Ga0068857_1019153011 116
140 3300005614 Ga0068856_100049716 Ga0068856_1000497166 116
141 3300005616 Ga0068852_100699543 Ga0068852_1006995433 116
142 3300005617 Ga0068859_100186240 Ga0068859_1001862404 116
143 3300005842 Ga0068858_100000220 Ga0068858_10000022034 116
144 3300006038 Ga0075365_10024374 Ga0075365_100243742 116
145 3300006042 Ga0075368_10027469 Ga0075368_100274695 116
146 3300006048 Ga0075363_100040504 Ga0075363_1000405043 116
147 3300006051 Ga0075364_10558408 Ga0075364_105584083 116
148 3300006051 Ga0075364_10630562 Ga0075364_106305621 116
149 3300006178 Ga0075367_10010608 Ga0075367_100106088 116
150 3300006186 Ga0075369_10052586 Ga0075369_100525864 116
151 3300006195 Ga0075366_10204527 Ga0075366_102045273 116
152 3300006353 Ga0075370_10012113 Ga0075370_100121134 116
153 3300006931 Ga0097620_100186238 Ga0097620_1001862384 116
154 3300009093 Ga0105240_10261938 Ga0105240_102619383 116
155 3300009093 Ga0105240_10772869 Ga0105240_107728692 116
156 3300009098 Ga0105245_10021376 Ga0105245_100213762 116
157 3300009177 Ga0105248_10000373 Ga0105248_1000037359 116
158 3300009545 Ga0105237_10110997 Ga0105237_101109974 116
159 3300009545 Ga0105237_10142051 Ga0105237_101420513 116
160 3300009551 Ga0105238_11049484 Ga0105238_110494841 116
161 3300010375 Ga0105239_11293991 Ga0105239_112939911 116
162 3300011119 Ga0105246_10436166 Ga0105246_104361662 116
163 3300013306 Ga0163162_11436051 Ga0163162_114360512 116
164 3300013306 Ga0163162_12583058 Ga0163162_125830582 116
165 3300013308 Ga0157375_10397105 Ga0157375_103971052 116
166 3300014325 Ga0163163_10136910 Ga0163163_101369104 116
167 3300014968 Ga0157379_10021193 Ga0157379_100211939 116
168 3300025909 Ga0207705_10047617 Ga0207705_100476172 116
169 3300025909 Ga0207705_10085465 Ga0207705_100854653 116
170 3300025913 Ga0207695_10001300 Ga0207695_1000130020 116
171 3300025913 Ga0207695_10564387 Ga0207695_105643872 116
172 3300025914 Ga0207671_10027275 Ga0207671_100272754 116
173 3300025914 Ga0207671_11027296 Ga0207671_110272962 116
174 3300025919 Ga0207657_10109746 Ga0207657_101097464 116
175 3300025919 Ga0207657_10166962 Ga0207657_101669622 116
176 3300025920 Ga0207649_10502494 Ga0207649_105024942 116
177 3300025927 Ga0207687_10045776 Ga0207687_100457767 116
178 3300025932 Ga0207690_10010448 Ga0207690_100104485 116
179 3300025937 Ga0207669_11349021 Ga0207669_113490211 116
180 3300025941 Ga0207711_10000702 Ga0207711_1000070216 116
181 3300025941 Ga0207711_11508346 Ga0207711_115083462 116
182 3300025949 Ga0207667_10003840 Ga0207667_1000384024 116
183 3300025949 Ga0207667_10010319 Ga0207667_100103194 116
184 3300025949 Ga0207667_10031662 Ga0207667_100316625 116
185 3300025949 Ga0207667_10352329 Ga0207667_103523294 116
186 3300026035 Ga0207703_10000031 Ga0207703_10000031208 116
187 3300026041 Ga0207639_10025505 Ga0207639_100255055 116
188 3300026078 Ga0207702_10095013 Ga0207702_100950134 116
189 3300026116 Ga0207674_10208940 Ga0207674_102089402 116
190 3300026142 Ga0207698_11772896 Ga0207698_117728961 116
191 3300027866 Ga0209813_10199055 Ga0209813_101990551 116
192 3300028794 Ga0307515_10314773 Ga0307515_103147731 116
193 3300031456 Ga0307513_10424858 Ga0307513_104248581 116
194 3300031911 Ga0307412_10993314 Ga0307412_109933142 116
195 3300031995 Ga0307409_100947454 Ga0307409_1009474541 116
196 3300032004 Ga0307414_10208078 Ga0307414_102080783 116
197 3300032004 Ga0307414_10664618 Ga0307414_106646182 116
198 3300032004 Ga0307414_11350584 Ga0307414_113505842 116
199 3300041413 Ga0439465_0140330 Ga0439465_0140330_49_399 116
200 3300041443 Ga0451789_0486937 Ga0451789_0486937_94_444 116
201 3300041451 Ga0451791_0733286 Ga0451791_0733286_210_560 116
202 3300041452 Ga0451793_0380051 Ga0451793_0380051_39_389 116
203 3300041452 Ga0451793_1524513 Ga0451793_1524513_80_430 116
204 3300041453 Ga0451797_0862352 Ga0451797_0862352_1171_1521 116
205 3300041496 Ga0451839_0017204 Ga0451839_0017204_332_682 116
206 3300041512 Ga0451853_0024538 Ga0451853_0024538_27_377 116
207 3300046523 Ga0495644_0400680 Ga0495644_0400680_140_490 116
208 3300046615 Ga0495656_0381821 Ga0495656_0381821_28_378 116
209 3300048903 Ga0496100_0411761 Ga0496100_0411761_362_712 116
210 3300048905 Ga0496102_0273423 Ga0496102_0273423_944_1294 116
211 3300048907 Ga0496104_0077126 Ga0496104_0077126_2397_2747 116
212 3300048908 Ga0496105_0099414 Ga0496105_0099414_1138_1488 116
213 3300048908 Ga0496105_0162742 Ga0496105_0162742_277_627 116
214 3300048908 Ga0496105_1308109 Ga0496105_1308109_71_421 116
215 3300048914 Ga0496111_0888255 Ga0496111_0888255_44_394 116
216 3300048916 Ga0496113_1109915 Ga0496113_1109915_71_421 116
217 3300048917 Ga0496114_0150374 Ga0496114_0150374_339_689 116
218 3300048918 Ga0496115_0147283 Ga0496115_0147283_460_810 116
219 3300048918 Ga0496115_0199949 Ga0496115_0199949_885_1235 116
220 3300048919 Ga0496116_0035441 Ga0496116_0035441_810_1160 116
221 3300048920 Ga0496117_0016291 Ga0496117_0016291_2807_3157 116
222 3300048920 Ga0496117_0018380 Ga0496117_0018380_3040_3390 116
223 3300048921 Ga0496118_0031641 Ga0496118_0031641_3879_4229 116
224 3300048921 Ga0496118_0055246 Ga0496118_0055246_1808_2158 116
225 3300048921 Ga0496118_0121643 Ga0496118_0121643_921_1271 116
226 3300048921 Ga0496118_0161377 Ga0496118_0161377_218_568 116
227 3300048922 Ga0496119_0005846 Ga0496119_0005846_456_806 116
228 3300048922 Ga0496119_0006928 Ga0496119_0006928_6513_6863 116
229 3300048923 Ga0496120_0001117 Ga0496120_0001117_9746_10096 116
230 3300048925 Ga0496122_0000031 Ga0496122_0000031_66055_66405 116
231 3300048925 Ga0496122_0000194 Ga0496122_0000194_93272_93622 116
232 3300048926 Ga0496123_0000013 Ga0496123_0000013_66065_66415 116
233 3300048926 Ga0496123_0000225 Ga0496123_0000225_6693_7043 116
234 3300048927 Ga0496124_0008832 Ga0496124_0008832_2952_3302 116
235 3300048927 Ga0496124_0009763 Ga0496124_0009763_2812_3162 116
236 3300048928 Ga0496125_0074089 Ga0496125_0074089_613_963 116
237 3300048928 Ga0496125_0237097 Ga0496125_0237097_261_611 116
238 3300048929 Ga0496126_0014461 Ga0496126_0014461_682_1032 116
239 3300048929 Ga0496126_0067338 Ga0496126_0067338_2755_3105 116
240 3300048929 Ga0496126_0409541 Ga0496126_0409541_159_509 116
241 3300049570 Ga0501033_0013712 Ga0501033_0013712_196_549 116
242 3300049570 Ga0501033_0131761 Ga0501033_0131761_213_563 116
243 3300049571 Ga0501034_0055756 Ga0501034_0055756_2893_3246 116
244 3300049578 Ga0501042_0002237 Ga0501042_0002237_7841_8191 116
245 3300049579 Ga0501043_0353984 Ga0501043_0353984_407_760 116
246 3300049581 Ga0501047_0400915 Ga0501047_0400915_613_963 116
247 3300049581 Ga0501047_0637275 Ga0501047_0637275_62_412 116
248 3300049582 Ga0501048_0713898 Ga0501048_0713898_187_540 116
249 3300049586 Ga0501070_0068771 Ga0501070_0068771_277_630 116
250 3300049822 Ga0501035_0038106 Ga0501035_0038106_1012_1365 116
251 3300049823 Ga0501044_0381334 Ga0501044_0381334_474_824 116
252 3300050490 nmdc:mga03n38_97192_c1 nmdc:mga03n38_97192_c1_777_1127 116
253 3300050491 nmdc:mga00v17_173453_c1 nmdc:mga00v17_173453_c1_241_591 116
254 3300050492 nmdc:mga0yw44_15887_c1 nmdc:mga0yw44_15887_c1_2791_3141 116
255 3300050494 nmdc:mga06z11_219439_c1 nmdc:mga06z11_219439_c1_16_366 116
256 3300050495 nmdc:mga04h51_11081_c1 nmdc:mga04h51_11081_c1_1823_2173 116
257 3300050496 nmdc:mga07m45_66895_c1 nmdc:mga07m45_66895_c1_645_995 116
258 3300050516 nmdc:mga0sz30_41127_c1 nmdc:mga0sz30_41127_c1_1180_1530 116
259 3300053140 Ga0500573_0070355 Ga0500573_0070355_895_1245 116
260 3300053142 Ga0500577_0006459 Ga0500577_0006459_383_733 116
261 3300053148 Ga0500590_000733 Ga0500590_000733_9842_10192 116
262 3300001990 JGI24737J22298_10035992 JGI24737J22298_100359922 117
263 3300002067 JGI24735J21928_10017977 JGI24735J21928_100179773 117
264 3300002772 JGI25164J39214_1000526 JGI25164J39214_10005261 117
265 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002457 117
266 3300003756 Ga0055533_1000001 Ga0055533_1000001512 117
267 3300003759 Ga0055525_1000180 Ga0055525_100018045 117
268 3300003760 Ga0055527_1000012 Ga0055527_1000012325 117
269 3300003762 Ga0055542_1000017 Ga0055542_1000017325 117
270 3300003763 Ga0055529_1000023 Ga0055529_1000023292 117
271 3300005339 Ga0070660_101802499 Ga0070660_1018024991 117
272 3300005437 Ga0070710_10165065 Ga0070710_101650652 117
273 3300005563 Ga0068855_100408663 Ga0068855_1004086631 117
274 3300006038 Ga0075365_10063414 Ga0075365_100634143 117
275 3300006038 Ga0075365_10158116 Ga0075365_101581163 117
276 3300006038 Ga0075365_10158138 Ga0075365_101581383 117
277 3300006051 Ga0075364_10033057 Ga0075364_100330573 117
278 3300006051 Ga0075364_10287804 Ga0075364_102878042 117
279 3300006186 Ga0075369_10063690 Ga0075369_100636903 117
280 3300006186 Ga0075369_10238670 Ga0075369_102386702 117
281 3300006186 Ga0075369_10653636 Ga0075369_106536361 117
282 3300006195 Ga0075366_11001398 Ga0075366_110013981 117
283 3300009093 Ga0105240_10261047 Ga0105240_102610472 117
284 3300009093 Ga0105240_11750969 Ga0105240_117509692 117
285 3300009098 Ga0105245_10011384 Ga0105245_100113848 117
286 3300009177 Ga0105248_10338711 Ga0105248_103387112 117
287 3300010375 Ga0105239_11462057 Ga0105239_114620572 117
288 3300013104 Ga0157370_10707231 Ga0157370_107072311 117
289 3300013105 Ga0157369_10397193 Ga0157369_103971931 117
290 3300013307 Ga0157372_10086978 Ga0157372_100869784 117
291 3300014326 Ga0157380_11225926 Ga0157380_112259261 117
292 3300017792 Ga0163161_11901385 Ga0163161_119013852 117
293 3300020069 Ga0197907_10281564 Ga0197907_102815643 117
294 3300020070 Ga0206356_10587081 Ga0206356_105870812 117
295 3300020075 Ga0206349_1147578 Ga0206349_11475782 117
296 3300020076 Ga0206355_1033871 Ga0206355_10338712 117
297 3300020077 Ga0206351_10198365 Ga0206351_101983652 117
298 3300020078 Ga0206352_10150558 Ga0206352_101505582 117
299 3300020078 Ga0206352_10376925 Ga0206352_103769253 117
300 3300020081 Ga0206354_11082210 Ga0206354_110822105 117
301 3300022467 Ga0224712_10142748 Ga0224712_101427482 117
302 3300022467 Ga0224712_10269081 Ga0224712_102690812 117
303 3300022467 Ga0224712_10311757 Ga0224712_103117573 117
304 3300025225 Ga0209566_100026 Ga0209566_100026211 117
305 3300025226 Ga0209674_100001 Ga0209674_100001513 117
306 3300025228 Ga0209672_100003 Ga0209672_10000321 117
307 3300025229 Ga0209147_100309 Ga0209147_10030932 117
308 3300025230 Ga0209563_100001 Ga0209563_100001513 117
309 3300025231 Ga0207427_100089 Ga0207427_10008954 117
310 3300025233 Ga0209437_100592 Ga0209437_10059213 117
311 3300025242 Ga0209258_113336 Ga0209258_1133362 117
312 3300025253 Ga0209677_100001 Ga0209677_100001513 117
313 3300025253 Ga0209677_103457 Ga0209677_1034572 117
314 3300025254 Ga0209148_1000004 Ga0209148_1000004316 117
315 3300025261 Ga0209233_1000001 Ga0209233_10000012349 117
316 3300025261 Ga0209233_1016585 Ga0209233_10165853 117
317 3300025272 Ga0209455_1000022 Ga0209455_1000022668 117
318 3300025272 Ga0209455_1001758 Ga0209455_100175810 117
319 3300025898 Ga0207692_10046133 Ga0207692_100461332 117
320 3300025913 Ga0207695_10194522 Ga0207695_101945224 117
321 3300025913 Ga0207695_11522759 Ga0207695_115227592 117
322 3300025927 Ga0207687_10008412 Ga0207687_100084123 117
323 3300025931 Ga0207644_10919434 Ga0207644_109194342 117
324 3300025941 Ga0207711_10051638 Ga0207711_100516384 117
325 3300025949 Ga0207667_10124311 Ga0207667_101243114 117
326 3300025986 Ga0207658_10247936 Ga0207658_102479363 117
327 3300026095 Ga0207676_11891969 Ga0207676_118919692 117
328 3300028379 Ga0268266_10259879 Ga0268266_102598794 117
329 3300028794 Ga0307515_10061060 Ga0307515_100610603 117
330 3300028794 Ga0307515_10667522 Ga0307515_106675222 117
331 3300031649 Ga0307514_10298744 Ga0307514_102987442 117
332 3300031838 Ga0307518_10397046 Ga0307518_103970462 117
333 3300037312 Ga0395899_0003904 Ga0395899_0003904_2998_3375 117
334 3300037418 Ga0395900_0008025 Ga0395900_0008025_2523_2894 117
335 3300037418 Ga0395900_0079171 Ga0395900_0079171_1889_2266 117
336 3300037466 Ga0395898_0000473 Ga0395898_0000473_6726_7097 117
337 3300041413 Ga0439465_0204109 Ga0439465_0204109_118_510 117
338 3300041451 Ga0451791_1350956 Ga0451791_1350956_291_644 117
339 3300041451 Ga0451791_1834760 Ga0451791_1834760_200_553 117
340 3300041452 Ga0451793_1005104 Ga0451793_1005104_290_643 117
341 3300041452 Ga0451793_1385713 Ga0451793_1385713_1589_2017 117
342 3300041460 Ga0451802_0496433 Ga0451802_0496433_56_409 117
343 3300041486 Ga0451807_1863057 Ga0451807_1863057_65_418 117
344 3300041486 Ga0451807_2073384 Ga0451807_2073384_395_748 117
345 3300041498 Ga0451841_1153759 Ga0451841_1153759_69_434 117
346 3300041511 Ga0451855_0076135 Ga0451855_0076135_220_648 117
347 3300044658 Ga0466972_0089340 Ga0466972_0089340_168_521 117
348 3300044658 Ga0466972_0135130 Ga0466972_0135130_310_663 117
349 3300044658 Ga0466972_0209977 Ga0466972_0209977_300_653 117
350 3300044658 Ga0466972_0227188 Ga0466972_0227188_134_496 117
351 3300044683 Ga0466965_0061819 Ga0466965_0061819_1367_1720 117
352 3300044683 Ga0466965_0114870 Ga0466965_0114870_574_927 117
353 3300044683 Ga0466965_0136982 Ga0466965_0136982_790_1152 117
354 3300044683 Ga0466965_0339564 Ga0466965_0339564_38_397 117
355 3300044684 Ga0466966_0353799 Ga0466966_0353799_491_853 117
356 3300044693 Ga0466961_0207674 Ga0466961_0207674_402_764 117
357 3300044693 Ga0466961_0438168 Ga0466961_0438168_67_420 117
358 3300044706 Ga0466964_0049494 Ga0466964_0049494_671_1033 117
359 3300044735 Ga0466968_0404770 Ga0466968_0404770_158_511 117
360 3300044765 Ga0466970_0002053 Ga0466970_0002053_8528_8881 117
361 3300044765 Ga0466970_0066352 Ga0466970_0066352_877_1230 117
362 3300044765 Ga0466970_0096514 Ga0466970_0096514_977_1330 117
363 3300044765 Ga0466970_0107332 Ga0466970_0107332_503_865 117
364 3300044765 Ga0466970_0227484 Ga0466970_0227484_245_598 117
365 3300044842 Ga0466957_0207535 Ga0466957_0207535_231_584 117
366 3300044842 Ga0466957_0252284 Ga0466957_0252284_328_690 117
367 3300044901 Ga0466960_0062607 Ga0466960_0062607_934_1287 117
368 3300044901 Ga0466960_0286433 Ga0466960_0286433_293_655 117
369 3300045049 Ga0466959_0045733 Ga0466959_0045733_2454_2816 117
370 3300045049 Ga0466959_0119089 Ga0466959_0119089_791_1144 117
371 3300045836 Ga0466958_0100371 Ga0466958_0100371_711_1073 117
372 3300045836 Ga0466958_0105392 Ga0466958_0105392_554_907 117
373 3300045976 Ga0466967_0875142 Ga0466967_0875142_405_767 117
374 3300046457 Ga0495590_0000570 Ga0495590_0000570_9263_9616 117
375 3300046471 Ga0495650_0003430 Ga0495650_0003430_3739_4092 117
376 3300046523 Ga0495644_0301195 Ga0495644_0301195_144_497 117
377 3300046615 Ga0495656_0262607 Ga0495656_0262607_377_730 117
378 3300046616 Ga0495668_0855207 Ga0495668_0855207_53_406 117
379 3300047320 Ga0495672_0394390 Ga0495672_0394390_149_502 117
380 3300047472 Ga0495686_0224293 Ga0495686_0224293_169_522 117
381 3300048091 Ga0495626_0186564 Ga0495626_0186564_108_461 117
382 3300048903 Ga0496100_0247462 Ga0496100_0247462_795_1166 117
383 3300048905 Ga0496102_0069953 Ga0496102_0069953_1995_2357 117
384 3300048906 Ga0496103_0238922 Ga0496103_0238922_304_675 117
385 3300048908 Ga0496105_0097801 Ga0496105_0097801_44_415 117
386 3300048910 Ga0496107_0459095 Ga0496107_0459095_492_863 117
387 3300048916 Ga0496113_0508032 Ga0496113_0508032_587_940 117
388 3300048918 Ga0496115_0063205 Ga0496115_0063205_2526_2897 117
389 3300048920 Ga0496117_0012689 Ga0496117_0012689_3210_3572 117
390 3300048920 Ga0496117_0218798 Ga0496117_0218798_397_750 117
391 3300048921 Ga0496118_0084138 Ga0496118_0084138_411_773 117
392 3300048921 Ga0496118_0108073 Ga0496118_0108073_1186_1557 117
393 3300048922 Ga0496119_0091631 Ga0496119_0091631_903_1271 117
394 3300048922 Ga0496119_0291445 Ga0496119_0291445_435_788 117
395 3300048922 Ga0496119_0360901 Ga0496119_0360901_143_514 117
396 3300048923 Ga0496120_0227766 Ga0496120_0227766_80_436 117
397 3300048924 Ga0496121_0846743 Ga0496121_0846743_149_502 117
398 3300048925 Ga0496122_0003254 Ga0496122_0003254_19349_19705 117
399 3300048926 Ga0496123_0001723 Ga0496123_0001723_9674_10030 117
400 3300048926 Ga0496123_0139084 Ga0496123_0139084_77_433 117
401 3300048929 Ga0496126_0443050 Ga0496126_0443050_13_366 117
402 3300048929 Ga0496126_0484347 Ga0496126_0484347_43_396 117
403 3300048929 Ga0496126_1043669 Ga0496126_1043669_231_584 117
404 3300049569 Ga0501032_0056560 Ga0501032_0056560_1729_2082 117
405 3300049570 Ga0501033_0127190 Ga0501033_0127190_1140_1493 117
406 3300049571 Ga0501034_0022590 Ga0501034_0022590_5200_5553 117
407 3300049571 Ga0501034_0033037 Ga0501034_0033037_2878_3231 117
408 3300049571 Ga0501034_0081857 Ga0501034_0081857_1075_1428 117
409 3300049571 Ga0501034_0103569 Ga0501034_0103569_1236_1589 117
410 3300049571 Ga0501034_0124674 Ga0501034_0124674_1191_1547 117
411 3300049571 Ga0501034_0154979 Ga0501034_0154979_765_1118 117
412 3300049571 Ga0501034_0169165 Ga0501034_0169165_1008_1364 117
413 3300049572 Ga0501036_0763100 Ga0501036_0763100_129_482 117
414 3300049575 Ga0501039_0545568 Ga0501039_0545568_63_416 117
415 3300049579 Ga0501043_0001056 Ga0501043_0001056_13051_13404 117
416 3300049579 Ga0501043_0280045 Ga0501043_0280045_352_705 117
417 3300049580 Ga0501046_0027133 Ga0501046_0027133_2973_3338 117
418 3300049580 Ga0501046_0071815 Ga0501046_0071815_542_895 117
419 3300049581 Ga0501047_0013675 Ga0501047_0013675_6167_6520 117
420 3300049581 Ga0501047_0083572 Ga0501047_0083572_2152_2517 117
421 3300049583 Ga0501067_0188790 Ga0501067_0188790_14_367 117
422 3300049583 Ga0501067_0237016 Ga0501067_0237016_85_438 117
423 3300049584 Ga0501068_0308747 Ga0501068_0308747_581_934 117
424 3300049584 Ga0501068_0417632 Ga0501068_0417632_466_819 117
425 3300049585 Ga0501069_0116845 Ga0501069_0116845_799_1155 117
426 3300049586 Ga0501070_0000100 Ga0501070_0000100_65520_65879 117
427 3300049586 Ga0501070_0002232 Ga0501070_0002232_15804_16160 117
428 3300049586 Ga0501070_0004119 Ga0501070_0004119_11078_11431 117
429 3300049586 Ga0501070_0063573 Ga0501070_0063573_246_599 117
430 3300049586 Ga0501070_0145612 Ga0501070_0145612_85_438 117
431 3300049587 Ga0501071_0030558 Ga0501071_0030558_2552_2908 117
432 3300049587 Ga0501071_0668837 Ga0501071_0668837_286_642 117
433 3300049588 Ga0501072_0078933 Ga0501072_0078933_1320_1673 117
434 3300049589 Ga0501073_0000087 Ga0501073_0000087_44200_44553 117
435 3300049589 Ga0501073_0095093 Ga0501073_0095093_129_482 117
436 3300049593 Ga0501077_0440601 Ga0501077_0440601_403_756 117
437 3300049742 Ga0501080_0004689 Ga0501080_0004689_79_432 117
438 3300049742 Ga0501080_0100859 Ga0501080_0100859_1379_1732 117
439 3300049822 Ga0501035_0611352 Ga0501035_0611352_193_546 117
440 3300049822 Ga0501035_0873577 Ga0501035_0873577_109_462 117
441 3300049823 Ga0501044_0006761 Ga0501044_0006761_1298_1663 117
442 3300049823 Ga0501044_0184303 Ga0501044_0184303_1054_1407 117
443 3300050491 nmdc:mga00v17_121791_c1 nmdc:mga00v17_121791_c1_709_1062 117
444 3300050491 nmdc:mga00v17_17040_c1 nmdc:mga00v17_17040_c1_2116_2469 117
445 3300050491 nmdc:mga00v17_23031_c1 nmdc:mga00v17_23031_c1_1738_2091 117
446 3300050492 nmdc:mga0yw44_34720_c1 nmdc:mga0yw44_34720_c1_788_1141 117
447 3300050492 nmdc:mga0yw44_38507_c1 nmdc:mga0yw44_38507_c1_850_1203 117
448 3300050492 nmdc:mga0yw44_417614_c1 nmdc:mga0yw44_417614_c1_58_411 117
449 3300050492 nmdc:mga0yw44_798141_c1 nmdc:mga0yw44_798141_c1_232_585 117
450 3300050516 nmdc:mga0sz30_237504_c1 nmdc:mga0sz30_237504_c1_105_458 117
451 3300050516 nmdc:mga0sz30_347943_c1 nmdc:mga0sz30_347943_c1_78_431 117
452 3300050516 nmdc:mga0sz30_5817_c1 nmdc:mga0sz30_5817_c1_1274_1627 117
453 3300050516 nmdc:mga0sz30_58658_c1 nmdc:mga0sz30_58658_c1_424_777 117
454 3300053087 Ga0500643_001841 Ga0500643_001841_5224_5580 117
455 3300053093 Ga0500651_0758450 Ga0500651_0758450_48_404 117
456 3300053102 Ga0500554_181650 Ga0500554_181650_42_395 117
457 3300053104 Ga0500556_0000920 Ga0500556_0000920_11623_11976 117
458 3300053108 Ga0500562_015936 Ga0500562_015936_61_414 117
459 3300053117 Ga0500593_123290 Ga0500593_123290_331_684 117
460 3300053133 Ga0500655_001201 Ga0500655_001201_3653_4006 117
461 3300053136 Ga0500559_0000182 Ga0500559_0000182_8431_8856 117
462 3300053136 Ga0500559_0000443 Ga0500559_0000443_5723_6076 117
463 3300053136 Ga0500559_0045776 Ga0500559_0045776_131_487 117
464 3300053139 Ga0500568_0000698 Ga0500568_0000698_8193_8546 117
465 3300053139 Ga0500568_0056794 Ga0500568_0056794_24_377 117
466 3300053140 Ga0500573_0016021 Ga0500573_0016021_851_1207 117
467 3300053140 Ga0500573_0049708 Ga0500573_0049708_1428_1784 117
468 3300053140 Ga0500573_0057652 Ga0500573_0057652_858_1214 117
469 3300053140 Ga0500573_0065468 Ga0500573_0065468_981_1337 117
470 3300053140 Ga0500573_0076151 Ga0500573_0076151_290_646 117
471 3300053140 Ga0500573_0248771 Ga0500573_0248771_113_469 117
472 3300053140 Ga0500573_0259366 Ga0500573_0259366_445_801 117
473 3300053140 Ga0500573_0291715 Ga0500573_0291715_270_626 117
474 3300053140 Ga0500573_0373675 Ga0500573_0373675_44_397 117
475 3300053140 Ga0500573_0489654 Ga0500573_0489654_32_388 117
476 3300053142 Ga0500577_0100779 Ga0500577_0100779_409_762 117
477 3300053146 Ga0500588_0034034 Ga0500588_0034034_197_550 117
478 3300053153 Ga0500616_0000078 Ga0500616_0000078_55440_55796 117
479 3300053153 Ga0500616_0002208 Ga0500616_0002208_12912_13265 117
480 3300053153 Ga0500616_0160491 Ga0500616_0160491_338_691 117
481 3300059605 Ga0587106_165710 Ga0587106_165710_50_406 117
482 3300061719 Ga0466962_0099466 Ga0466962_0099466_29_391 117
483 iso_pu_bacteria 2643221635 2644198835 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

54

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7935 1 115
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.781 1 115
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.629 6 115
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6095 6 115
2ejq-assembly2.cif.gz_B conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.5671 6 114
ID Description Score Start End Superfamily
af_A4ICH4_855_1005_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8593 78 105 3.40.50.300
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7895 3 115 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7704 3 115 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7099 10 111 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.629 6 115 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A3E0HJV5-F1-model_v4 deleted 0.9519 1 117
AF-A0A3E0HJV5-F1-model_v4 deleted 0.9441 1 117
AF-A0A2V9LNA0-F1-model_v4 Metallopeptidase family protein 0.9246 5 106
AF-A0A086DU09-F1-model_v4 deleted 0.9232 3 78
AF-A0A6A7LQ05-F1-model_v4 Metallopeptidase family protein 0.9209 2 109

Feature Viewer

pLDDT pTM Quality
88.36 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map