F452602

General Info

Members Datasets Scaffolds Average Seq Length
482 237 479 199

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11095742|Ga0114129_110957421
Length 225
Sequence MCYTPGTAFYAEDDHGGHAEPANVEDSIMRKLIVLEHLTLDGVIQAPGGSDEDASDGFAYGGWSAPYSDDVLGTALSEQMNRPFDLLLGRKTFDIWASYWPHHADFWPGVMTATKYVASTTLTSSEWQPSVFLNGDIAEKVANIKQQQGPDVHVWGSGNLLQTLIKHDLVDVFWLMIYPITLGSGKRLFADGTIPAAFKVTESHVSPDGVIIVSYERAGAITTGT

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
3 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
4 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
221 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.41
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 0.83
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_1954 2124908026 Bacteria 784
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI24751J29686_10000036 3300002459 Bacteria 82067
4 Ga0055531_10001817 3300003794 Bacteria 15134
5 Ga0065714_10064460 3300005288 Bacteria 66400
6 Ga0065704_10070575 3300005289 Bacteria 20060
7 Ga0065712_10000119 3300005290 Bacteria 137052
8 Ga0065712_10135620 3300005290 Bacteria 1429
9 Ga0065712_10255835 3300005290 Bacteria 921
10 Ga0065715_10089467 3300005293 Bacteria 10038
11 Ga0065715_10266570 3300005293 Bacteria 1113
12 Ga0065715_10335324 3300005293 Bacteria 976
13 Ga0065707_10005873 3300005295 Bacteria 4362
14 Ga0065707_10007266 3300005295 Bacteria 3319
15 Ga0065707_10082364 3300005295 Bacteria 16154
16 Ga0070690_100359687 3300005330 Bacteria 1059
17 Ga0070670_100003166 3300005331 Bacteria 13604
18 Ga0070670_100018717 3300005331 Bacteria 5937
19 Ga0068869_100000137 3300005334 Bacteria 35570
20 Ga0068869_100535877 3300005334 Bacteria 982
21 Ga0070666_10049209 3300005335 Bacteria 2832
22 Ga0070666_10310055 3300005335 Bacteria 1125
23 Ga0068868_100063856 3300005338 Bacteria 2922
24 Ga0070689_100414349 3300005340 Unclassified 1141
25 Ga0070687_100375058 3300005343 Bacteria 925
26 Ga0070692_10207225 3300005345 Bacteria 1152
27 Ga0070669_100210792 3300005353 Bacteria 1533
28 Ga0070669_100881500 3300005353 Unclassified 764
29 Ga0070675_100155735 3300005354 Bacteria 1962
30 Ga0070675_100301794 3300005354 Unclassified 1411
31 Ga0070671_100001809 3300005355 Bacteria 16263
32 Ga0070671_100043971 3300005355 Bacteria 3711
33 Ga0070671_100247039 3300005355 Bacteria 1515
34 Ga0070673_100206101 3300005364 Bacteria 1696
35 Ga0070673_100354540 3300005364 Bacteria 1303
36 Ga0070673_100689189 3300005364 Bacteria 938
37 Ga0070703_10000501 3300005406 Bacteria 15404
38 Ga0070709_10000084 3300005434 Bacteria 70621
39 Ga0070710_10015583 3300005437 Bacteria 3851
40 Ga0070701_10075638 3300005438 Bacteria 1811
41 Ga0070711_100000175 3300005439 Bacteria 34287
42 Ga0070711_100048533 3300005439 Unclassified 2904
43 Ga0070711_100067686 3300005439 Bacteria 2506
44 Ga0070700_100000289 3300005441 Bacteria 26444
45 Ga0070700_100021378 3300005441 Bacteria 3760
46 Ga0070700_100438833 3300005441 Bacteria 991
47 Ga0070694_100021506 3300005444 Bacteria 4124
48 Ga0070694_100576088 3300005444 Unclassified 904
49 Ga0070708_100038080 3300005445 Bacteria 4199
50 Ga0070708_100150220 3300005445 Bacteria 2166
51 Ga0070708_100786505 3300005445 Bacteria 894
52 Ga0068867_100717954 3300005459 Unclassified 884
53 Ga0070685_10497965 3300005466 Bacteria 862
54 Ga0070706_100000050 3300005467 Bacteria 140240
55 Ga0070706_100277512 3300005467 Bacteria 1564
56 Ga0070706_100300673 3300005467 Bacteria 1497
57 Ga0070707_100132691 3300005468 Bacteria 2422
58 Ga0070707_100231230 3300005468 Unclassified 1800
59 Ga0070707_100397281 3300005468 Unclassified 1339
60 Ga0070707_100583100 3300005468 Bacteria 1080
61 Ga0070707_101118697 3300005468 Bacteria 754
62 Ga0070698_100005844 3300005471 Bacteria 13448
63 Ga0070698_100068432 3300005471 Unclassified 3568
64 Ga0070698_100107406 3300005471 Unclassified 2759
65 Ga0070698_100226161 3300005471 Bacteria 1804
66 Ga0070698_100389258 3300005471 Bacteria 1327
67 Ga0070698_100669279 3300005471 Unclassified 979
68 Ga0070699_100010494 3300005518 Bacteria 8013
69 Ga0070699_100010501 3300005518 Bacteria 8011
70 Ga0070699_100020952 3300005518 Bacteria 5636
71 Ga0070699_100136422 3300005518 Bacteria 2164
72 Ga0070699_100231026 3300005518 Bacteria 1649
73 Ga0070699_100267165 3300005518 Bacteria 1530
74 Ga0070699_100491242 3300005518 Unclassified 1115
75 Ga0070697_100211679 3300005536 Bacteria 1650
76 Ga0070696_100192268 3300005546 Bacteria 1519
77 Ga0070693_100511206 3300005547 Bacteria 854
78 Ga0070665_100140212 3300005548 Bacteria 2421
79 Ga0070704_100193779 3300005549 Bacteria 1635
80 Ga0068855_101412359 3300005563 Bacteria 717
81 Ga0070664_100401738 3300005564 Bacteria 1253
82 Ga0070664_100533114 3300005564 Bacteria 1085
83 Ga0068857_100089359 3300005577 Bacteria 2756
84 Ga0068856_100036190 3300005614 Bacteria 4840
85 Ga0070702_100131075 3300005615 Unclassified 1584
86 Ga0068852_100450827 3300005616 Unclassified 1274
87 Ga0068859_100003735 3300005617 Bacteria 15514
88 Ga0068859_100027122 3300005617 Bacteria 5746
89 Ga0068859_100070669 3300005617 Bacteria 3526
90 Ga0068859_100299772 3300005617 Bacteria 1700
91 Ga0068859_100302057 3300005617 Bacteria 1694
92 Ga0068859_100406654 3300005617 Unclassified 1457
93 Ga0068859_100642022 3300005617 Bacteria 1154
94 Ga0068859_100863168 3300005617 Bacteria 991
95 Ga0068859_100997226 3300005617 Bacteria 920
96 Ga0068864_100107413 3300005618 Bacteria 2483
97 Ga0068864_100397902 3300005618 Bacteria 1308
98 Ga0068861_100007458 3300005719 Bacteria 7496
99 Ga0068861_100238763 3300005719 Bacteria 1545
100 Ga0068861_100379194 3300005719 Bacteria 1249
101 Ga0068870_10122012 3300005840 Bacteria 1502
102 Ga0068863_100036888 3300005841 Bacteria 4655
103 Ga0068863_100462002 3300005841 Bacteria 1247
104 Ga0068858_100000005 3300005842 Bacteria 305830
105 Ga0068858_100055152 3300005842 Bacteria 3674
106 Ga0068858_100367395 3300005842 Bacteria 1379
107 Ga0068860_100347170 3300005843 Unclassified 1460
108 Ga0068860_100560190 3300005843 Bacteria 1146
109 Ga0068862_100454079 3300005844 Bacteria 1209
110 Ga0081455_10138403 3300005937 Bacteria 1894
111 Ga0081539_10014025 3300005985 Bacteria 5968
112 Ga0081539_10169586 3300005985 Bacteria 1033
113 Ga0075365_10003194 3300006038 Bacteria 8371
114 Ga0075364_10009876 3300006051 Bacteria 5742
115 Ga0070716_100000002 3300006173 Bacteria 396037
116 Ga0070716_100511625 3300006173 Bacteria 888
117 Ga0075362_10069038 3300006177 Bacteria 1611
118 Ga0075367_10148887 3300006178 Bacteria 1452
119 Ga0075366_10065175 3300006195 Bacteria 2167
120 Ga0097621_100003491 3300006237 Bacteria 10844
121 Ga0097621_100597965 3300006237 Unclassified 1008
122 Ga0068871_100022816 3300006358 Bacteria 4831
123 Ga0068871_100201456 3300006358 Bacteria 1718
124 Ga0075428_100190111 3300006844 Bacteria 2221
125 Ga0075428_100991646 3300006844 Bacteria 889
126 Ga0075428_101425992 3300006844 Unclassified 726
127 Ga0075431_100084801 3300006847 Bacteria 3270
128 Ga0075431_100739390 3300006847 Bacteria 960
129 Ga0075433_10065408 3300006852 Unclassified 3189
130 Ga0075433_10246764 3300006852 Bacteria 1585
131 Ga0075433_10322099 3300006852 Bacteria 1367
132 Ga0075434_100047971 3300006871 Bacteria 4238
133 Ga0075434_100092864 3300006871 Unclassified 3020
134 Ga0075434_100485364 3300006871 Unclassified 1257
135 Ga0075434_100640234 3300006871 Unclassified 1081
136 Ga0075429_100057855 3300006880 Unclassified 3376
137 Ga0075429_100097945 3300006880 Plasmid 2559
138 Ga0075429_100190710 3300006880 Unclassified 1796
139 Ga0075429_100358625 3300006880 Unclassified 1277
140 Ga0075429_100492818 3300006880 Unclassified 1074
141 Ga0075429_101081777 3300006880 Unclassified 700
142 Ga0068865_100476605 3300006881 Bacteria 1036
143 Ga0075436_100000136 3300006914 Bacteria 44102
144 Ga0075436_100056914 3300006914 Bacteria 2700
145 Ga0075436_100240147 3300006914 Bacteria 1288
146 Ga0097620_100003735 3300006931 Bacteria 15514
147 Ga0097620_100027122 3300006931 Bacteria 5746
148 Ga0097620_100070669 3300006931 Bacteria 3526
149 Ga0097620_100299766 3300006931 Bacteria 1700
150 Ga0097620_100302060 3300006931 Bacteria 1694
151 Ga0097620_100406655 3300006931 Unclassified 1457
152 Ga0097620_100642056 3300006931 Bacteria 1154
153 Ga0097620_100997290 3300006931 Bacteria 920
154 Ga0075435_100005843 3300007076 Bacteria 8654
155 Ga0075435_100161030 3300007076 Unclassified 1890
156 Ga0075435_100281429 3300007076 Bacteria 1420
157 Ga0099794_10130041 3300007265 Bacteria 1271
158 Ga0099795_10054555 3300007788 Bacteria 1466
159 Ga0105240_11052168 3300009093 Bacteria 868
160 Ga0105240_11256615 3300009093 Unclassified 782
161 Ga0111539_10042648 3300009094 Bacteria 5445
162 Ga0111539_10239448 3300009094 Bacteria 2112
163 Ga0105247_10000002 3300009101 Bacteria 724587
164 Ga0105247_10325907 3300009101 Bacteria 1073
165 Ga0105247_10365141 3300009101 Bacteria 1019
166 Ga0114129_10115449 3300009147 Unclassified 3700
167 Ga0114129_10227593 3300009147 Bacteria 2512
168 Ga0114129_10513403 3300009147 Unclassified 1563
169 Ga0114129_10827396 3300009147 Unclassified 1179
170 Ga0114129_11095742 3300009147 Bacteria 997
171 Ga0105243_10000715 3300009148 Bacteria 31978
172 Ga0105243_10129053 3300009148 Unclassified 2142
173 Ga0105243_10313290 3300009148 Unclassified 1427
174 Ga0105243_10993984 3300009148 Bacteria 841
175 Ga0105243_11180047 3300009148 Unclassified 778
176 Ga0105241_10509778 3300009174 Bacteria 1074
177 Ga0105242_10001084 3300009176 Bacteria 21382
178 Ga0105242_10097799 3300009176 Unclassified 2482
179 Ga0105248_10009967 3300009177 Bacteria 10463
180 Ga0105248_10018120 3300009177 Bacteria 7775
181 Ga0105248_10236439 3300009177 Bacteria 2057
182 Ga0105248_10340307 3300009177 Bacteria 1689
183 Ga0105238_10035489 3300009551 Bacteria 5069
184 Ga0105249_10051727 3300009553 Bacteria 3749
185 Ga0105249_10082592 3300009553 Bacteria 2990
186 Ga0105249_11533135 3300009553 Bacteria 739
187 Ga0099796_10064329 3300010159 Bacteria 1308
188 Ga0105246_10012340 3300011119 Bacteria 5328
189 Ga0105246_10054956 3300011119 Bacteria 2746
190 Ga0105246_10106067 3300011119 Unclassified 2054
191 Ga0157373_10085404 3300013100 Bacteria 2225
192 Ga0157374_10041833 3300013296 Bacteria 4225
193 Ga0157374_10109734 3300013296 Unclassified 2653
194 Ga0157378_10000001 3300013297 Bacteria 352632
195 Ga0157378_10199438 3300013297 Bacteria 1892
196 Ga0157378_10219662 3300013297 Bacteria 1806
197 Ga0157378_10608325 3300013297 Bacteria 1105
198 Ga0157378_10819589 3300013297 Bacteria 957
199 Ga0163162_10014966 3300013306 Bacteria 7577
200 Ga0163162_10073113 3300013306 Bacteria 3484
201 Ga0163162_10143661 3300013306 Unclassified 2501
202 Ga0163162_10348630 3300013306 Bacteria 1613
203 Ga0163162_10814527 3300013306 Bacteria 1050
204 Ga0157375_10042802 3300013308 Bacteria 4387
205 Ga0157375_10449409 3300013308 Bacteria 1454
206 Ga0157375_10625346 3300013308 Bacteria 1234
207 Ga0157375_10922249 3300013308 Bacteria 1016
208 Ga0163163_10002456 3300014325 Bacteria 15671
209 Ga0163163_10192774 3300014325 Bacteria 2086
210 Ga0157380_10126483 3300014326 Bacteria 2173
211 Ga0157380_10310500 3300014326 Bacteria 1457
212 Ga0157376_10014983 3300014969 Bacteria 5844
213 Ga0157376_10053020 3300014969 Bacteria 3375
214 Ga0157376_10274697 3300014969 Bacteria 1584
215 Ga0157376_11266579 3300014969 Unclassified 767
216 Ga0163161_10035730 3300017792 Bacteria 3557
217 Ga0207653_10000240 3300025885 Bacteria 36488
218 Ga0207682_10134101 3300025893 Unclassified 1107
219 Ga0207710_10000002 3300025900 Bacteria 1251998
220 Ga0207710_10174412 3300025900 Unclassified 1052
221 Ga0207710_10212652 3300025900 Bacteria 958
222 Ga0207688_10164761 3300025901 Bacteria 1316
223 Ga0207685_10000038 3300025905 Bacteria 61306
224 Ga0207699_10000006 3300025906 Bacteria 430147
225 Ga0207645_10118329 3300025907 Bacteria 1719
226 Ga0207643_10483633 3300025908 Bacteria 790
227 Ga0207684_10000131 3300025910 Bacteria 137508
228 Ga0207684_10388842 3300025910 Bacteria 1199
229 Ga0207654_10083564 3300025911 Bacteria 1928
230 Ga0207693_10008793 3300025915 Bacteria 8255
231 Ga0207663_10000031 3300025916 Bacteria 96659
232 Ga0207663_10068726 3300025916 Unclassified 2276
233 Ga0207663_10106223 3300025916 Bacteria 1897
234 Ga0207660_10687289 3300025917 Unclassified 835
235 Ga0207662_10268617 3300025918 Bacteria 1125
236 Ga0207646_10080706 3300025922 Bacteria 2909
237 Ga0207646_10085680 3300025922 Bacteria 2818
238 Ga0207646_10153164 3300025922 Unclassified 2079
239 Ga0207646_10155367 3300025922 Bacteria 2063
240 Ga0207646_10226802 3300025922 Bacteria 1688
241 Ga0207646_10293621 3300025922 Bacteria 1469
242 Ga0207681_10000729 3300025923 Bacteria 21525
243 Ga0207694_10041840 3300025924 Unclassified 3532
244 Ga0207650_10000006 3300025925 Bacteria 544730
245 Ga0207650_10003171 3300025925 Bacteria 11327
246 Ga0207650_10311612 3300025925 Bacteria 1287
247 Ga0207659_10383532 3300025926 Bacteria 1172
248 Ga0207700_10463890 3300025928 Bacteria 1118
249 Ga0207700_10484894 3300025928 Bacteria 1093
250 Ga0207644_10005266 3300025931 Bacteria 8442
251 Ga0207644_10026968 3300025931 Bacteria 3966
252 Ga0207644_10150115 3300025931 Unclassified 1802
253 Ga0207644_10198051 3300025931 Bacteria 1583
254 Ga0207686_10002273 3300025934 Bacteria 10549
255 Ga0207686_10025988 3300025934 Bacteria 3413
256 Ga0207709_10000301 3300025935 Bacteria 54207
257 Ga0207709_10033452 3300025935 Unclassified 3019
258 Ga0207709_10832857 3300025935 Unclassified 746
259 Ga0207670_10144169 3300025936 Bacteria 1759
260 Ga0207704_10122997 3300025938 Bacteria 1780
261 Ga0207665_10000007 3300025939 Bacteria 177869
262 Ga0207665_10667260 3300025939 Unclassified 816
263 Ga0207691_10515310 3300025940 Unclassified 1015
264 Ga0207711_10021424 3300025941 Bacteria 5400
265 Ga0207711_10024802 3300025941 Bacteria 5030
266 Ga0207711_10201266 3300025941 Bacteria 1817
267 Ga0207711_10316635 3300025941 Bacteria 1441
268 Ga0207689_10015621 3300025942 Bacteria 6430
269 Ga0207689_10150192 3300025942 Bacteria 1920
270 Ga0207679_10146884 3300025945 Bacteria 1914
271 Ga0207679_10739484 3300025945 Bacteria 894
272 Ga0207651_10371321 3300025960 Bacteria 1210
273 Ga0207651_10738444 3300025960 Bacteria 869
274 Ga0207712_10026197 3300025961 Unclassified 3882
275 Ga0207712_10051094 3300025961 Bacteria 2889
276 Ga0207668_10859766 3300025972 Unclassified 806
277 Ga0207640_10226105 3300025981 Unclassified 1436
278 Ga0207703_10000475 3300026035 Bacteria 42000
279 Ga0207639_10757742 3300026041 Bacteria 903
280 Ga0207708_10000148 3300026075 Bacteria 56156
281 Ga0207708_10032184 3300026075 Bacteria 3983
282 Ga0207708_10456321 3300026075 Bacteria 1065
283 Ga0207702_10054003 3300026078 Bacteria 3403
284 Ga0207641_10560969 3300026088 Unclassified 1115
285 Ga0207648_10173152 3300026089 Unclassified 1908
286 Ga0207648_10437237 3300026089 Bacteria 1189
287 Ga0207676_10333789 3300026095 Bacteria 1396
288 Ga0207674_10121744 3300026116 Bacteria 2576
289 Ga0207674_10144377 3300026116 Unclassified 2339
290 Ga0207674_10159992 3300026116 Bacteria 2206
291 Ga0207674_10189876 3300026116 Bacteria 2004
292 Ga0207674_10545533 3300026116 Bacteria 1120
293 Ga0207675_100016334 3300026118 Bacteria 6929
294 Ga0207675_100060847 3300026118 Bacteria 3526
295 Ga0207675_100088039 3300026118 Bacteria 2917
296 Ga0207675_101021526 3300026118 Bacteria 845
297 Ga0207683_10294962 3300026121 Bacteria 1483
298 Ga0207428_10020626 3300027907 Bacteria 5595
299 Ga0268266_10324323 3300028379 Bacteria 1442
300 Ga0268265_10136276 3300028380 Bacteria 2049
301 Ga0268265_10191622 3300028380 Unclassified 1766
302 Ga0268264_10206139 3300028381 Unclassified 1802
303 Ga0268264_10558432 3300028381 Bacteria 1124
304 Ga0265338_10086628 3300028800 Unclassified 2606
305 Ga0265320_10056433 3300031240 Unclassified 1887
306 Ga0316575_10016152 3300031665 Bacteria 2821
307 Ga0316579_10009614 3300031691 Bacteria 4070
308 Ga0316576_10013391 3300031727 Bacteria 5450
309 Ga0316576_10270249 3300031727 Bacteria 1274
310 Ga0316576_10382667 3300031727 Bacteria 1044
311 Ga0316578_10003694 3300031728 Bacteria 7064
312 Ga0316578_10190678 3300031728 Bacteria 1235
313 Ga0316578_10275609 3300031728 Bacteria 1007
314 Ga0307405_10003287 3300031731 Bacteria 7387
315 Ga0316577_10049209 3300031733 Bacteria 2352
316 Ga0316577_10554804 3300031733 Bacteria 653
317 Ga0307413_10102245 3300031824 Bacteria 1897
318 Ga0307413_10173413 3300031824 Bacteria 1529
319 Ga0307413_10437259 3300031824 Bacteria 1035
320 Ga0307410_10232494 3300031852 Bacteria 1424
321 Ga0307410_10953214 3300031852 Unclassified 738
322 Ga0307406_10008863 3300031901 Bacteria 5623
323 Ga0307406_10396227 3300031901 Bacteria 1093
324 Ga0307407_10085280 3300031903 Bacteria 1921
325 Ga0307412_10011394 3300031911 Bacteria 5150
326 Ga0307412_10337338 3300031911 Bacteria 1205
327 Ga0307412_10703059 3300031911 Bacteria 868
328 Ga0307416_100012210 3300032002 Bacteria 5773
329 Ga0307416_100135443 3300032002 Bacteria 2227
330 Ga0307416_100347746 3300032002 Unclassified 1499
331 Ga0307414_10826749 3300032004 Bacteria 846
332 Ga0307411_10006879 3300032005 Bacteria 5733
333 Ga0307415_100084454 3300032126 Bacteria 2278
334 Ga0307415_100175984 3300032126 Bacteria 1674
335 Ga0307415_100786413 3300032126 Unclassified 867
336 Ga0316585_10180470 3300032137 Bacteria 697
337 Ga0316580_10085694 3300032139 Bacteria 963
338 Ga0316596_1007557 3300033541 Bacteria 2573
339 Ga0373951_0006494 3300035091 Bacteria 2675
340 Ga0373923_0092227 3300035111 Bacteria 1326
341 Ga0373939_0090071 3300035114 Unclassified 1035
342 Ga0373953_0009191 3300035117 Bacteria 3387
343 Ga0373956_0021635 3300035119 Bacteria 2744
344 Ga0373957_0082574 3300035120 Bacteria 1270
345 Ga0373955_0008153 3300035172 Bacteria 4848
346 Ga0316574_0009270 3300035398 Bacteria 5505
347 Ga0373924_0338281 3300035410 Bacteria 670
348 Ga0373933_0045593 3300035724 Bacteria 2600
349 Ga0373937_0074551 3300036401 Bacteria 3131
350 Ga0373937_0535123 3300036401 Bacteria 1113
351 Ga0316584_0011081 3300036712 Bacteria 6321
352 Ga0316584_0014818 3300036712 Bacteria 5568
353 Ga0316584_0274052 3300036712 Bacteria 1227
354 Ga0316584_0298849 3300036712 Bacteria 1166
355 Ga0395899_0433648 3300037312 Unclassified 864
356 Ga0395900_0728021 3300037418 Bacteria 924
357 Ga0395898_0217592 3300037466 Bacteria 1822
358 Ga0436364_1430824 3300037853 Bacteria 6375
359 Ga0395901_0167524 3300038443 Bacteria 2306
360 Ga0451853_0085171 3300041512 Unclassified 741
361 Ga0439433_0061682 3300041999 Bacteria 895
362 Ga0439455_0119533 3300042012 Unclassified 738
363 Ga0439444_0019467 3300042437 Unclassified 1185
364 Ga0451577_0000003 3300042876 Bacteria 921850
365 Ga0451577_0000007 3300042876 Bacteria 694123
366 Ga0451577_0001447 3300042876 Bacteria 31590
367 Ga0451577_0027855 3300042876 Bacteria 5113
368 Ga0451577_0065071 3300042876 Bacteria 3251
369 Ga0451577_0155812 3300042876 Bacteria 2056
370 Ga0451577_0482013 3300042876 Unclassified 1126
371 Ga0451577_0777843 3300042876 Unclassified 865
372 Ga0453683_0002041 3300044673 Bacteria 16222
373 Ga0453683_0047058 3300044673 Bacteria 2703
374 Ga0453683_0278241 3300044673 Bacteria 1068
375 Ga0453683_0349867 3300044673 Unclassified 949
376 Ga0453683_0610417 3300044673 Unclassified 712
377 Ga0466963_0055839 3300044694 Bacteria 2627
378 Ga0453684_0000003 3300044712 Bacteria 1481694
379 Ga0453684_0000018 3300044712 Bacteria 921850
380 Ga0453684_0000094 3300044712 Bacteria 382117
381 Ga0453684_0000162 3300044712 Bacteria 298154
382 Ga0453684_0001158 3300044712 Bacteria 82247
383 Ga0453684_0003650 3300044712 Bacteria 34176
384 Ga0453684_0040800 3300044712 Bacteria 6294
385 Ga0453684_0044672 3300044712 Bacteria 5922
386 Ga0453684_0082494 3300044712 Unclassified 4005
387 Ga0453684_0103049 3300044712 Unclassified 3488
388 Ga0453684_0105481 3300044712 Bacteria 3437
389 Ga0453684_0121530 3300044712 Bacteria 3151
390 Ga0453684_0144217 3300044712 Unclassified 2839
391 Ga0453684_0150406 3300044712 Unclassified 2767
392 Ga0453684_0222489 3300044712 Bacteria 2185
393 Ga0453684_0224238 3300044712 Bacteria 2175
394 Ga0453684_0226236 3300044712 Bacteria 2163
395 Ga0453684_0287352 3300044712 Bacteria 1874
396 Ga0453684_0315634 3300044712 Bacteria 1772
397 Ga0453684_0321373 3300044712 Bacteria 1753
398 Ga0453684_0469606 3300044712 Unclassified 1397
399 Ga0453684_0560312 3300044712 Bacteria 1257
400 Ga0453684_0578979 3300044712 Unclassified 1233
401 Ga0453684_0670733 3300044712 Unclassified 1129
402 Ga0453684_0817992 3300044712 Bacteria 1003
403 Ga0453684_0908031 3300044712 Bacteria 943
404 Ga0453684_1108921 3300044712 Unclassified 835
405 Ga0453684_1220448 3300044712 Unclassified 788
406 Ga0466959_0028404 3300045049 Bacteria 4148
407 Ga0451576_0000027 3300045051 Bacteria 422925
408 Ga0451576_0001312 3300045051 Bacteria 43065
409 Ga0451576_0014148 3300045051 Bacteria 8890
410 Ga0451576_0054176 3300045051 Unclassified 4200
411 Ga0451576_0058635 3300045051 Bacteria 4022
412 Ga0451576_0442932 3300045051 Unclassified 1363
413 Ga0495652_0241674 3300046529 Bacteria 1343
414 Ga0495587_0004239 3300046536 Bacteria 9480
415 Ga0495604_0063033 3300047317 Bacteria 2830
416 Ga0495636_0103817 3300047318 Bacteria 1245
417 Ga0495636_0105137 3300047318 Bacteria 1238
418 Ga0495684_0119211 3300047471 Bacteria 1988
419 Ga0495602_0054553 3300048088 Bacteria 3527
420 Ga0496106_0000698 3300048909 Bacteria 24110
421 Ga0496106_0236934 3300048909 Bacteria 1458
422 Ga0496107_0213812 3300048910 Bacteria 1434
423 Ga0496107_0770084 3300048910 Unclassified 706
424 Ga0501308_014227 3300049128 Bacteria 929
425 Ga0501031_0292730 3300049568 Bacteria 1056
426 Ga0501039_0721923 3300049575 Bacteria 779
427 Ga0501042_0474456 3300049578 Unclassified 908
428 Ga0501068_0370684 3300049584 Unclassified 921
429 Ga0501068_0653089 3300049584 Bacteria 687
430 Ga0501072_0290918 3300049588 Unclassified 1299
431 Ga0501072_0820063 3300049588 Unclassified 728
432 Ga0501075_0224792 3300049591 Unclassified 1432
433 Ga0501076_0398244 3300049592 Unclassified 1132
434 Ga0501207_001509 3300049654 Bacteria 2917
435 Ga0501209_013404 3300049656 Bacteria 1773
436 Ga0501217_013260 3300049661 Bacteria 1848
437 Ga0501223_001818 3300049663 Bacteria 4816
438 Ga0501224_004485 3300049664 Bacteria 1983
439 Ga0501230_003470 3300049667 Bacteria 2099
440 Ga0501233_009297 3300049668 Bacteria 1915
441 Ga0501235_004346 3300049669 Bacteria 3068
442 Ga0501257_008978 3300049686 Bacteria 2253
443 Ga0501283_021685 3300049779 Bacteria 1032
444 Ga0501212_027287 3300049851 Bacteria 908
445 nmdc:mga00v17_7675_c1 3300050491 Bacteria 5771
446 nmdc:mga0yw44_214_c1 3300050492 Bacteria 20542
447 nmdc:mga0k408_30215_c2 3300050493 Bacteria 2490
448 nmdc:mga06z11_127432_c1 3300050494 Bacteria 1426
449 nmdc:mga05p37_1012992_c1 3300050507 Unclassified 881
450 nmdc:mga05p37_1094961_c1 3300050507 Bacteria 835
451 nmdc:mga05p37_175410_c1 3300050507 Unclassified 2612
452 nmdc:mga05p37_19131_c1 3300050507 Bacteria 8284
453 nmdc:mga05p37_344679_c1 3300050507 Unclassified 1756
454 nmdc:mga05p37_39878_c1 3300050507 Bacteria 5766
455 nmdc:mga05p37_725247_c1 3300050507 Bacteria 1100
456 nmdc:mga05p37_80409_c1 3300050507 Bacteria 4015
457 nmdc:mga05p37_833762_c1 3300050507 Bacteria 1004
458 nmdc:mga09592_127820_c1 3300050508 Unclassified 2185
459 nmdc:mga09592_197333_c1 3300050508 Unclassified 1743
460 nmdc:mga09592_46270_c2 3300050508 Bacteria 1844
461 nmdc:mga09592_552413_c1 3300050508 Bacteria 989
462 nmdc:mga09592_92773_c1 3300050508 Unclassified 2581
463 nmdc:mga09592_959516_c1 3300050508 Unclassified 716
464 nmdc:mga06r32_190839_c1 3300050510 Bacteria 2037
465 nmdc:mga06r32_460308_c1 3300050510 Unclassified 1251
466 nmdc:mga08y16_59455_c1 3300050511 Bacteria 3992
467 nmdc:mga0n895_390590_c1 3300050512 Bacteria 1408
468 nmdc:mga0n895_458832_c1 3300050512 Bacteria 1286
469 nmdc:mga0n895_62802_c1 3300050512 Plasmid 3672
470 nmdc:mga0rr50_952_c1 3300050513 Bacteria 4356
471 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
472 nmdc:mga08x19_48925_c1 3300050514 Bacteria 2710
473 nmdc:mga0a205_118561_c1 3300050515 Unclassified 2545
474 nmdc:mga0a205_279527_c1 3300050515 Bacteria 1545
475 nmdc:mga0a205_41502_c1 3300050515 Plasmid 4431
476 Ga0500594_0000002 3300053118 Bacteria 916890
477 Ga0501084_0080957 3300054114 Bacteria 2723
478 Ga0501082_0372666 3300060353 Unclassified 1245
479 Ga0530510_0066546 3300061734 Bacteria 2613

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100000137 Ga0068869_10000013724 163
2 3300035091 Ga0373951_0006494 Ga0373951_0006494_1179_1781 187
3 3300053118 Ga0500594_0000002 Ga0500594_0000002_719172_719762 190
4 3300025928 Ga0207700_10463890 Ga0207700_104638901 191
5 iso_pu_bacteria 2919034639 2919037217 191
6 iso_pu_bacteria 2939674588 2939675726 191
7 3300049128 Ga0501308_014227 Ga0501308_014227_335_919 193
8 3300050508 nmdc:mga09592_127820_c1 nmdc:mga09592_127820_c1_243_824 193
9 3300060353 Ga0501082_0372666 Ga0501082_0372666_259_840 193
10 3300026121 Ga0207683_10294962 Ga0207683_102949622 194
11 3300044712 Ga0453684_0670733 Ga0453684_0670733_82_678 194
12 3300049578 Ga0501042_0474456 Ga0501042_0474456_71_655 194
13 3300003794 Ga0055531_10001817 Ga0055531_100018177 195
14 3300025928 Ga0207700_10484894 Ga0207700_104848942 195
15 3300044673 Ga0453683_0349867 Ga0453683_0349867_349_936 195
16 3300044712 Ga0453684_0003650 Ga0453684_0003650_14771_15358 195
17 3300044712 Ga0453684_0044672 Ga0453684_0044672_3906_4493 195
18 3300044712 Ga0453684_0150406 Ga0453684_0150406_850_1437 195
19 3300044712 Ga0453684_0315634 Ga0453684_0315634_720_1307 195
20 3300044712 Ga0453684_0578979 Ga0453684_0578979_258_845 195
21 3300045051 Ga0451576_0000027 Ga0451576_0000027_335526_336113 195
22 3300047318 Ga0495636_0103817 Ga0495636_0103817_23_610 195
23 3300061734 Ga0530510_0066546 Ga0530510_0066546_622_1209 195
24 iso_pu_bacteria 2980182181 2980186599 195
25 3300005439 Ga0070711_100048533 Ga0070711_1000485333 196
26 3300005445 Ga0070708_100786505 Ga0070708_1007865052 196
27 3300005467 Ga0070706_100300673 Ga0070706_1003006732 196
28 3300006173 Ga0070716_100511625 Ga0070716_1005116251 196
29 3300006177 Ga0075362_10069038 Ga0075362_100690382 196
30 3300006195 Ga0075366_10065175 Ga0075366_100651752 196
31 3300013306 Ga0163162_10143661 Ga0163162_101436615 196
32 3300025910 Ga0207684_10388842 Ga0207684_103888422 196
33 3300025916 Ga0207663_10068726 Ga0207663_100687261 196
34 3300026116 Ga0207674_10189876 Ga0207674_101898761 196
35 3300042876 Ga0451577_0027855 Ga0451577_0027855_2414_3004 196
36 3300044712 Ga0453684_0000003 Ga0453684_0000003_337265_337855 196
37 3300044712 Ga0453684_0103049 Ga0453684_0103049_1191_1781 196
38 3300050493 nmdc:mga0k408_30215_c2 nmdc:mga0k408_30215_c2_666_1271 196
39 3300005289 Ga0065704_10070575 Ga0065704_100705753 197
40 3300005295 Ga0065707_10005873 Ga0065707_100058734 197
41 3300005295 Ga0065707_10082364 Ga0065707_1008236411 197
42 3300005354 Ga0070675_100301794 Ga0070675_1003017943 197
43 3300005444 Ga0070694_100576088 Ga0070694_1005760882 197
44 3300005468 Ga0070707_100397281 Ga0070707_1003972811 197
45 3300005518 Ga0070699_100136422 Ga0070699_1001364221 197
46 3300005719 Ga0068861_100379194 Ga0068861_1003791943 197
47 3300006844 Ga0075428_101425992 Ga0075428_1014259921 197
48 3300006880 Ga0075429_101081777 Ga0075429_1010817771 197
49 3300009093 Ga0105240_11052168 Ga0105240_110521681 197
50 3300009147 Ga0114129_10827396 Ga0114129_108273962 197
51 3300009147 Ga0114129_11095742 Ga0114129_110957421 197
52 3300009553 Ga0105249_10051727 Ga0105249_100517273 197
53 3300011119 Ga0105246_10106067 Ga0105246_101060673 197
54 3300025961 Ga0207712_10026197 Ga0207712_100261976 197
55 3300028380 Ga0268265_10136276 Ga0268265_101362763 197
56 3300028800 Ga0265338_10086628 Ga0265338_100866284 197
57 3300031665 Ga0316575_10016152 Ga0316575_100161523 197
58 3300031691 Ga0316579_10009614 Ga0316579_100096143 197
59 3300031727 Ga0316576_10013391 Ga0316576_100133914 197
60 3300031727 Ga0316576_10270249 Ga0316576_102702492 197
61 3300031727 Ga0316576_10382667 Ga0316576_103826672 197
62 3300031728 Ga0316578_10003694 Ga0316578_100036945 197
63 3300031728 Ga0316578_10190678 Ga0316578_101906782 197
64 3300031728 Ga0316578_10275609 Ga0316578_102756091 197
65 3300031733 Ga0316577_10049209 Ga0316577_100492091 197
66 3300031733 Ga0316577_10554804 Ga0316577_105548041 197
67 3300031824 Ga0307413_10102245 Ga0307413_101022453 197
68 3300031824 Ga0307413_10437259 Ga0307413_104372592 197
69 3300031852 Ga0307410_10232494 Ga0307410_102324943 197
70 3300031901 Ga0307406_10396227 Ga0307406_103962272 197
71 3300031903 Ga0307407_10085280 Ga0307407_100852803 197
72 3300031911 Ga0307412_10337338 Ga0307412_103373382 197
73 3300032004 Ga0307414_10826749 Ga0307414_108267491 197
74 3300032137 Ga0316585_10180470 Ga0316585_101804701 197
75 3300032139 Ga0316580_10085694 Ga0316580_100856942 197
76 3300033541 Ga0316596_1007557 Ga0316596_10075572 197
77 3300035111 Ga0373923_0092227 Ga0373923_0092227_491_1093 197
78 3300035114 Ga0373939_0090071 Ga0373939_0090071_85_678 197
79 3300035117 Ga0373953_0009191 Ga0373953_0009191_2458_3060 197
80 3300035119 Ga0373956_0021635 Ga0373956_0021635_1026_1628 197
81 3300035120 Ga0373957_0082574 Ga0373957_0082574_263_865 197
82 3300035172 Ga0373955_0008153 Ga0373955_0008153_2438_3040 197
83 3300035398 Ga0316574_0009270 Ga0316574_0009270_3136_3729 197
84 3300035410 Ga0373924_0338281 Ga0373924_0338281_15_617 197
85 3300035724 Ga0373933_0045593 Ga0373933_0045593_819_1421 197
86 3300036401 Ga0373937_0074551 Ga0373937_0074551_1920_2522 197
87 3300036712 Ga0316584_0011081 Ga0316584_0011081_4568_5188 197
88 3300036712 Ga0316584_0014818 Ga0316584_0014818_4638_5231 197
89 3300036712 Ga0316584_0274052 Ga0316584_0274052_321_914 197
90 3300036712 Ga0316584_0298849 Ga0316584_0298849_133_726 197
91 3300042876 Ga0451577_0065071 Ga0451577_0065071_2187_2780 197
92 3300042876 Ga0451577_0155812 Ga0451577_0155812_770_1363 197
93 3300042876 Ga0451577_0777843 Ga0451577_0777843_35_628 197
94 3300044673 Ga0453683_0002041 Ga0453683_0002041_12160_12753 197
95 3300044673 Ga0453683_0047058 Ga0453683_0047058_1920_2513 197
96 3300044673 Ga0453683_0278241 Ga0453683_0278241_190_783 197
97 3300044712 Ga0453684_0000162 Ga0453684_0000162_92544_93137 197
98 3300044712 Ga0453684_0001158 Ga0453684_0001158_25880_26527 197
99 3300044712 Ga0453684_0040800 Ga0453684_0040800_2468_3061 197
100 3300044712 Ga0453684_0121530 Ga0453684_0121530_596_1189 197
101 3300044712 Ga0453684_0222489 Ga0453684_0222489_501_1094 197
102 3300044712 Ga0453684_0224238 Ga0453684_0224238_1366_1959 197
103 3300044712 Ga0453684_0560312 Ga0453684_0560312_129_722 197
104 3300044712 Ga0453684_0817992 Ga0453684_0817992_65_658 197
105 3300044712 Ga0453684_1108921 Ga0453684_1108921_63_656 197
106 3300044712 Ga0453684_1220448 Ga0453684_1220448_114_707 197
107 3300045051 Ga0451576_0001312 Ga0451576_0001312_39211_39804 197
108 3300045051 Ga0451576_0014148 Ga0451576_0014148_915_1508 197
109 3300045051 Ga0451576_0058635 Ga0451576_0058635_2905_3498 197
110 3300045051 Ga0451576_0442932 Ga0451576_0442932_604_1197 197
111 3300046529 Ga0495652_0241674 Ga0495652_0241674_434_1036 197
112 3300046536 Ga0495587_0004239 Ga0495587_0004239_3317_3919 197
113 3300047317 Ga0495604_0063033 Ga0495604_0063033_1793_2395 197
114 3300047471 Ga0495684_0119211 Ga0495684_0119211_702_1304 197
115 3300048088 Ga0495602_0054553 Ga0495602_0054553_1800_2402 197
116 3300049588 Ga0501072_0290918 Ga0501072_0290918_175_768 197
117 3300050507 nmdc:mga05p37_1094961_c1 nmdc:mga05p37_1094961_c1_55_732 197
118 3300050507 nmdc:mga05p37_175410_c1 nmdc:mga05p37_175410_c1_1836_2429 197
119 3300050507 nmdc:mga05p37_19131_c1 nmdc:mga05p37_19131_c1_428_1021 197
120 3300050508 nmdc:mga09592_197333_c1 nmdc:mga09592_197333_c1_894_1487 197
121 3300050508 nmdc:mga09592_959516_c1 nmdc:mga09592_959516_c1_53_646 197
122 3300050510 nmdc:mga06r32_460308_c1 nmdc:mga06r32_460308_c1_388_981 197
123 2124908026 MRS1a_Contig_1954 MRS1a_00149570 198
124 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001545 198
125 3300002459 JGI24751J29686_10000036 JGI24751J29686_1000003642 198
126 3300005288 Ga0065714_10064460 Ga0065714_1006446042 198
127 3300005290 Ga0065712_10000119 Ga0065712_10000119114 198
128 3300005290 Ga0065712_10135620 Ga0065712_101356202 198
129 3300005290 Ga0065712_10255835 Ga0065712_102558351 198
130 3300005293 Ga0065715_10089467 Ga0065715_100894672 198
131 3300005293 Ga0065715_10266570 Ga0065715_102665702 198
132 3300005293 Ga0065715_10335324 Ga0065715_103353241 198
133 3300005295 Ga0065707_10007266 Ga0065707_100072663 198
134 3300005330 Ga0070690_100359687 Ga0070690_1003596871 198
135 3300005331 Ga0070670_100003166 Ga0070670_10000316610 198
136 3300005331 Ga0070670_100018717 Ga0070670_1000187173 198
137 3300005334 Ga0068869_100535877 Ga0068869_1005358771 198
138 3300005335 Ga0070666_10049209 Ga0070666_100492093 198
139 3300005335 Ga0070666_10310055 Ga0070666_103100552 198
140 3300005338 Ga0068868_100063856 Ga0068868_1000638565 198
141 3300005340 Ga0070689_100414349 Ga0070689_1004143493 198
142 3300005343 Ga0070687_100375058 Ga0070687_1003750582 198
143 3300005345 Ga0070692_10207225 Ga0070692_102072252 198
144 3300005353 Ga0070669_100210792 Ga0070669_1002107922 198
145 3300005353 Ga0070669_100881500 Ga0070669_1008815001 198
146 3300005354 Ga0070675_100155735 Ga0070675_1001557351 198
147 3300005355 Ga0070671_100001809 Ga0070671_1000018093 198
148 3300005355 Ga0070671_100043971 Ga0070671_1000439714 198
149 3300005355 Ga0070671_100247039 Ga0070671_1002470392 198
150 3300005364 Ga0070673_100206101 Ga0070673_1002061012 198
151 3300005364 Ga0070673_100354540 Ga0070673_1003545402 198
152 3300005364 Ga0070673_100689189 Ga0070673_1006891891 198
153 3300005406 Ga0070703_10000501 Ga0070703_1000050122 198
154 3300005434 Ga0070709_10000084 Ga0070709_1000008424 198
155 3300005437 Ga0070710_10015583 Ga0070710_100155833 198
156 3300005438 Ga0070701_10075638 Ga0070701_100756383 198
157 3300005439 Ga0070711_100000175 Ga0070711_10000017531 198
158 3300005439 Ga0070711_100067686 Ga0070711_1000676863 198
159 3300005441 Ga0070700_100000289 Ga0070700_10000028925 198
160 3300005441 Ga0070700_100021378 Ga0070700_1000213787 198
161 3300005441 Ga0070700_100438833 Ga0070700_1004388331 198
162 3300005444 Ga0070694_100021506 Ga0070694_1000215064 198
163 3300005445 Ga0070708_100038080 Ga0070708_1000380802 198
164 3300005445 Ga0070708_100150220 Ga0070708_1001502203 198
165 3300005459 Ga0068867_100717954 Ga0068867_1007179542 198
166 3300005466 Ga0070685_10497965 Ga0070685_104979651 198
167 3300005467 Ga0070706_100000050 Ga0070706_1000000503 198
168 3300005467 Ga0070706_100277512 Ga0070706_1002775121 198
169 3300005468 Ga0070707_100132691 Ga0070707_1001326913 198
170 3300005468 Ga0070707_100231230 Ga0070707_1002312301 198
171 3300005468 Ga0070707_100583100 Ga0070707_1005831001 198
172 3300005468 Ga0070707_101118697 Ga0070707_1011186971 198
173 3300005471 Ga0070698_100005844 Ga0070698_1000058444 198
174 3300005471 Ga0070698_100068432 Ga0070698_1000684322 198
175 3300005471 Ga0070698_100107406 Ga0070698_1001074062 198
176 3300005471 Ga0070698_100226161 Ga0070698_1002261612 198
177 3300005471 Ga0070698_100389258 Ga0070698_1003892582 198
178 3300005471 Ga0070698_100669279 Ga0070698_1006692791 198
179 3300005518 Ga0070699_100010494 Ga0070699_10001049410 198
180 3300005518 Ga0070699_100010501 Ga0070699_1000105014 198
181 3300005518 Ga0070699_100020952 Ga0070699_1000209526 198
182 3300005518 Ga0070699_100231026 Ga0070699_1002310262 198
183 3300005518 Ga0070699_100267165 Ga0070699_1002671653 198
184 3300005518 Ga0070699_100491242 Ga0070699_1004912423 198
185 3300005536 Ga0070697_100211679 Ga0070697_1002116792 198
186 3300005546 Ga0070696_100192268 Ga0070696_1001922682 198
187 3300005547 Ga0070693_100511206 Ga0070693_1005112061 198
188 3300005548 Ga0070665_100140212 Ga0070665_1001402122 198
189 3300005549 Ga0070704_100193779 Ga0070704_1001937793 198
190 3300005563 Ga0068855_101412359 Ga0068855_1014123591 198
191 3300005564 Ga0070664_100401738 Ga0070664_1004017382 198
192 3300005564 Ga0070664_100533114 Ga0070664_1005331142 198
193 3300005577 Ga0068857_100089359 Ga0068857_1000893593 198
194 3300005614 Ga0068856_100036190 Ga0068856_1000361904 198
195 3300005615 Ga0070702_100131075 Ga0070702_1001310753 198
196 3300005616 Ga0068852_100450827 Ga0068852_1004508271 198
197 3300005617 Ga0068859_100003735 Ga0068859_10000373515 198
198 3300005617 Ga0068859_100027122 Ga0068859_1000271223 198
199 3300005617 Ga0068859_100070669 Ga0068859_1000706693 198
200 3300005617 Ga0068859_100299772 Ga0068859_1002997722 198
201 3300005617 Ga0068859_100302057 Ga0068859_1003020573 198
202 3300005617 Ga0068859_100406654 Ga0068859_1004066541 198
203 3300005617 Ga0068859_100642022 Ga0068859_1006420221 198
204 3300005617 Ga0068859_100863168 Ga0068859_1008631682 198
205 3300005617 Ga0068859_100997226 Ga0068859_1009972262 198
206 3300005618 Ga0068864_100107413 Ga0068864_1001074132 198
207 3300005618 Ga0068864_100397902 Ga0068864_1003979022 198
208 3300005719 Ga0068861_100007458 Ga0068861_1000074586 198
209 3300005719 Ga0068861_100238763 Ga0068861_1002387632 198
210 3300005840 Ga0068870_10122012 Ga0068870_101220122 198
211 3300005841 Ga0068863_100036888 Ga0068863_1000368885 198
212 3300005841 Ga0068863_100462002 Ga0068863_1004620022 198
213 3300005842 Ga0068858_100000005 Ga0068858_100000005196 198
214 3300005842 Ga0068858_100055152 Ga0068858_1000551525 198
215 3300005842 Ga0068858_100367395 Ga0068858_1003673952 198
216 3300005843 Ga0068860_100347170 Ga0068860_1003471702 198
217 3300005843 Ga0068860_100560190 Ga0068860_1005601902 198
218 3300005844 Ga0068862_100454079 Ga0068862_1004540792 198
219 3300005937 Ga0081455_10138403 Ga0081455_101384032 198
220 3300005985 Ga0081539_10014025 Ga0081539_100140259 198
221 3300005985 Ga0081539_10169586 Ga0081539_101695862 198
222 3300006038 Ga0075365_10003194 Ga0075365_100031947 198
223 3300006051 Ga0075364_10009876 Ga0075364_100098764 198
224 3300006173 Ga0070716_100000002 Ga0070716_100000002188 198
225 3300006178 Ga0075367_10148887 Ga0075367_101488872 198
226 3300006237 Ga0097621_100003491 Ga0097621_10000349110 198
227 3300006237 Ga0097621_100597965 Ga0097621_1005979651 198
228 3300006358 Ga0068871_100022816 Ga0068871_1000228161 198
229 3300006358 Ga0068871_100201456 Ga0068871_1002014563 198
230 3300006844 Ga0075428_100190111 Ga0075428_1001901112 198
231 3300006844 Ga0075428_100991646 Ga0075428_1009916462 198
232 3300006847 Ga0075431_100084801 Ga0075431_1000848013 198
233 3300006847 Ga0075431_100739390 Ga0075431_1007393901 198
234 3300006852 Ga0075433_10065408 Ga0075433_100654083 198
235 3300006852 Ga0075433_10246764 Ga0075433_102467641 198
236 3300006852 Ga0075433_10322099 Ga0075433_103220992 198
237 3300006871 Ga0075434_100047971 Ga0075434_1000479713 198
238 3300006871 Ga0075434_100092864 Ga0075434_1000928642 198
239 3300006871 Ga0075434_100485364 Ga0075434_1004853642 198
240 3300006871 Ga0075434_100640234 Ga0075434_1006402342 198
241 3300006880 Ga0075429_100057855 Ga0075429_1000578554 198
242 3300006880 Ga0075429_100097945 Ga0075429_1000979451 198
243 3300006880 Ga0075429_100190710 Ga0075429_1001907103 198
244 3300006880 Ga0075429_100358625 Ga0075429_1003586252 198
245 3300006880 Ga0075429_100492818 Ga0075429_1004928181 198
246 3300006881 Ga0068865_100476605 Ga0068865_1004766052 198
247 3300006914 Ga0075436_100000136 Ga0075436_10000013651 198
248 3300006914 Ga0075436_100056914 Ga0075436_1000569145 198
249 3300006914 Ga0075436_100240147 Ga0075436_1002401472 198
250 3300006931 Ga0097620_100003735 Ga0097620_10000373515 198
251 3300006931 Ga0097620_100027122 Ga0097620_1000271224 198
252 3300006931 Ga0097620_100070669 Ga0097620_1000706693 198
253 3300006931 Ga0097620_100299766 Ga0097620_1002997662 198
254 3300006931 Ga0097620_100302060 Ga0097620_1003020603 198
255 3300006931 Ga0097620_100406655 Ga0097620_1004066551 198
256 3300006931 Ga0097620_100642056 Ga0097620_1006420561 198
257 3300006931 Ga0097620_100997290 Ga0097620_1009972902 198
258 3300007076 Ga0075435_100005843 Ga0075435_1000058433 198
259 3300007076 Ga0075435_100161030 Ga0075435_1001610302 198
260 3300007076 Ga0075435_100281429 Ga0075435_1002814292 198
261 3300007265 Ga0099794_10130041 Ga0099794_101300411 198
262 3300007788 Ga0099795_10054555 Ga0099795_100545551 198
263 3300009093 Ga0105240_11256615 Ga0105240_112566152 198
264 3300009094 Ga0111539_10042648 Ga0111539_100426484 198
265 3300009094 Ga0111539_10239448 Ga0111539_102394483 198
266 3300009101 Ga0105247_10000002 Ga0105247_10000002448 198
267 3300009101 Ga0105247_10325907 Ga0105247_103259072 198
268 3300009101 Ga0105247_10365141 Ga0105247_103651411 198
269 3300009147 Ga0114129_10115449 Ga0114129_101154493 198
270 3300009147 Ga0114129_10227593 Ga0114129_102275933 198
271 3300009147 Ga0114129_10513403 Ga0114129_105134033 198
272 3300009148 Ga0105243_10000715 Ga0105243_1000071517 198
273 3300009148 Ga0105243_10129053 Ga0105243_101290532 198
274 3300009148 Ga0105243_10313290 Ga0105243_103132902 198
275 3300009148 Ga0105243_10993984 Ga0105243_109939841 198
276 3300009148 Ga0105243_11180047 Ga0105243_111800471 198
277 3300009174 Ga0105241_10509778 Ga0105241_105097782 198
278 3300009176 Ga0105242_10001084 Ga0105242_100010849 198
279 3300009176 Ga0105242_10097799 Ga0105242_100977992 198
280 3300009177 Ga0105248_10009967 Ga0105248_1000996713 198
281 3300009177 Ga0105248_10018120 Ga0105248_100181207 198
282 3300009177 Ga0105248_10236439 Ga0105248_102364393 198
283 3300009177 Ga0105248_10340307 Ga0105248_103403072 198
284 3300009551 Ga0105238_10035489 Ga0105238_100354894 198
285 3300009553 Ga0105249_10082592 Ga0105249_100825923 198
286 3300009553 Ga0105249_11533135 Ga0105249_115331351 198
287 3300010159 Ga0099796_10064329 Ga0099796_100643292 198
288 3300011119 Ga0105246_10012340 Ga0105246_100123403 198
289 3300011119 Ga0105246_10054956 Ga0105246_100549563 198
290 3300013100 Ga0157373_10085404 Ga0157373_100854042 198
291 3300013296 Ga0157374_10041833 Ga0157374_100418332 198
292 3300013296 Ga0157374_10109734 Ga0157374_101097344 198
293 3300013297 Ga0157378_10000001 Ga0157378_1000000168 198
294 3300013297 Ga0157378_10199438 Ga0157378_101994382 198
295 3300013297 Ga0157378_10219662 Ga0157378_102196622 198
296 3300013297 Ga0157378_10608325 Ga0157378_106083252 198
297 3300013297 Ga0157378_10819589 Ga0157378_108195892 198
298 3300013306 Ga0163162_10014966 Ga0163162_100149663 198
299 3300013306 Ga0163162_10073113 Ga0163162_100731134 198
300 3300013306 Ga0163162_10348630 Ga0163162_103486302 198
301 3300013306 Ga0163162_10814527 Ga0163162_108145271 198
302 3300013308 Ga0157375_10042802 Ga0157375_100428024 198
303 3300013308 Ga0157375_10449409 Ga0157375_104494093 198
304 3300013308 Ga0157375_10625346 Ga0157375_106253462 198
305 3300013308 Ga0157375_10922249 Ga0157375_109222492 198
306 3300014325 Ga0163163_10002456 Ga0163163_1000245610 198
307 3300014325 Ga0163163_10192774 Ga0163163_101927742 198
308 3300014326 Ga0157380_10126483 Ga0157380_101264833 198
309 3300014326 Ga0157380_10310500 Ga0157380_103105002 198
310 3300014969 Ga0157376_10014983 Ga0157376_100149831 198
311 3300014969 Ga0157376_10053020 Ga0157376_100530204 198
312 3300014969 Ga0157376_10274697 Ga0157376_102746972 198
313 3300014969 Ga0157376_11266579 Ga0157376_112665791 198
314 3300017792 Ga0163161_10035730 Ga0163161_100357305 198
315 3300025885 Ga0207653_10000240 Ga0207653_1000024023 198
316 3300025893 Ga0207682_10134101 Ga0207682_101341011 198
317 3300025900 Ga0207710_10000002 Ga0207710_10000002448 198
318 3300025900 Ga0207710_10174412 Ga0207710_101744122 198
319 3300025900 Ga0207710_10212652 Ga0207710_102126522 198
320 3300025901 Ga0207688_10164761 Ga0207688_101647612 198
321 3300025905 Ga0207685_10000038 Ga0207685_1000003815 198
322 3300025906 Ga0207699_10000006 Ga0207699_10000006312 198
323 3300025907 Ga0207645_10118329 Ga0207645_101183291 198
324 3300025908 Ga0207643_10483633 Ga0207643_104836331 198
325 3300025910 Ga0207684_10000131 Ga0207684_1000013184 198
326 3300025911 Ga0207654_10083564 Ga0207654_100835642 198
327 3300025915 Ga0207693_10008793 Ga0207693_100087936 198
328 3300025916 Ga0207663_10000031 Ga0207663_1000003174 198
329 3300025916 Ga0207663_10106223 Ga0207663_101062232 198
330 3300025917 Ga0207660_10687289 Ga0207660_106872891 198
331 3300025918 Ga0207662_10268617 Ga0207662_102686172 198
332 3300025922 Ga0207646_10080706 Ga0207646_100807063 198
333 3300025922 Ga0207646_10085680 Ga0207646_100856802 198
334 3300025922 Ga0207646_10153164 Ga0207646_101531642 198
335 3300025922 Ga0207646_10155367 Ga0207646_101553673 198
336 3300025922 Ga0207646_10226802 Ga0207646_102268022 198
337 3300025922 Ga0207646_10293621 Ga0207646_102936212 198
338 3300025923 Ga0207681_10000729 Ga0207681_1000072919 198
339 3300025924 Ga0207694_10041840 Ga0207694_100418404 198
340 3300025925 Ga0207650_10000006 Ga0207650_10000006404 198
341 3300025925 Ga0207650_10003171 Ga0207650_100031718 198
342 3300025925 Ga0207650_10311612 Ga0207650_103116121 198
343 3300025926 Ga0207659_10383532 Ga0207659_103835322 198
344 3300025931 Ga0207644_10005266 Ga0207644_100052667 198
345 3300025931 Ga0207644_10026968 Ga0207644_100269686 198
346 3300025931 Ga0207644_10150115 Ga0207644_101501153 198
347 3300025931 Ga0207644_10198051 Ga0207644_101980512 198
348 3300025934 Ga0207686_10002273 Ga0207686_100022733 198
349 3300025934 Ga0207686_10025988 Ga0207686_100259883 198
350 3300025935 Ga0207709_10000301 Ga0207709_1000030125 198
351 3300025935 Ga0207709_10033452 Ga0207709_100334524 198
352 3300025935 Ga0207709_10832857 Ga0207709_108328571 198
353 3300025936 Ga0207670_10144169 Ga0207670_101441692 198
354 3300025938 Ga0207704_10122997 Ga0207704_101229973 198
355 3300025939 Ga0207665_10000007 Ga0207665_100000072 198
356 3300025939 Ga0207665_10667260 Ga0207665_106672602 198
357 3300025940 Ga0207691_10515310 Ga0207691_105153101 198
358 3300025941 Ga0207711_10021424 Ga0207711_100214247 198
359 3300025941 Ga0207711_10024802 Ga0207711_100248027 198
360 3300025941 Ga0207711_10201266 Ga0207711_102012663 198
361 3300025941 Ga0207711_10316635 Ga0207711_103166352 198
362 3300025942 Ga0207689_10015621 Ga0207689_100156217 198
363 3300025942 Ga0207689_10150192 Ga0207689_101501922 198
364 3300025945 Ga0207679_10146884 Ga0207679_101468843 198
365 3300025945 Ga0207679_10739484 Ga0207679_107394842 198
366 3300025960 Ga0207651_10371321 Ga0207651_103713212 198
367 3300025960 Ga0207651_10738444 Ga0207651_107384441 198
368 3300025961 Ga0207712_10051094 Ga0207712_100510943 198
369 3300025972 Ga0207668_10859766 Ga0207668_108597661 198
370 3300025981 Ga0207640_10226105 Ga0207640_102261052 198
371 3300026035 Ga0207703_10000475 Ga0207703_1000047532 198
372 3300026041 Ga0207639_10757742 Ga0207639_107577421 198
373 3300026075 Ga0207708_10000148 Ga0207708_1000014830 198
374 3300026075 Ga0207708_10032184 Ga0207708_100321846 198
375 3300026075 Ga0207708_10456321 Ga0207708_104563211 198
376 3300026078 Ga0207702_10054003 Ga0207702_100540034 198
377 3300026088 Ga0207641_10560969 Ga0207641_105609692 198
378 3300026089 Ga0207648_10173152 Ga0207648_101731522 198
379 3300026089 Ga0207648_10437237 Ga0207648_104372372 198
380 3300026095 Ga0207676_10333789 Ga0207676_103337892 198
381 3300026116 Ga0207674_10121744 Ga0207674_101217442 198
382 3300026116 Ga0207674_10144377 Ga0207674_101443772 198
383 3300026116 Ga0207674_10159992 Ga0207674_101599922 198
384 3300026116 Ga0207674_10545533 Ga0207674_105455331 198
385 3300026118 Ga0207675_100016334 Ga0207675_1000163344 198
386 3300026118 Ga0207675_100060847 Ga0207675_1000608471 198
387 3300026118 Ga0207675_100088039 Ga0207675_1000880392 198
388 3300026118 Ga0207675_101021526 Ga0207675_1010215261 198
389 3300027907 Ga0207428_10020626 Ga0207428_100206267 198
390 3300028379 Ga0268266_10324323 Ga0268266_103243232 198
391 3300028380 Ga0268265_10191622 Ga0268265_101916221 198
392 3300028381 Ga0268264_10206139 Ga0268264_102061392 198
393 3300028381 Ga0268264_10558432 Ga0268264_105584321 198
394 3300031240 Ga0265320_10056433 Ga0265320_100564334 198
395 3300031731 Ga0307405_10003287 Ga0307405_100032875 198
396 3300031824 Ga0307413_10173413 Ga0307413_101734132 198
397 3300031852 Ga0307410_10953214 Ga0307410_109532141 198
398 3300031901 Ga0307406_10008863 Ga0307406_100088635 198
399 3300031911 Ga0307412_10011394 Ga0307412_100113945 198
400 3300031911 Ga0307412_10703059 Ga0307412_107030591 198
401 3300032002 Ga0307416_100012210 Ga0307416_1000122105 198
402 3300032002 Ga0307416_100135443 Ga0307416_1001354431 198
403 3300032002 Ga0307416_100347746 Ga0307416_1003477462 198
404 3300032005 Ga0307411_10006879 Ga0307411_100068791 198
405 3300032126 Ga0307415_100084454 Ga0307415_1000844544 198
406 3300032126 Ga0307415_100175984 Ga0307415_1001759842 198
407 3300032126 Ga0307415_100786413 Ga0307415_1007864132 198
408 3300036401 Ga0373937_0535123 Ga0373937_0535123_58_660 198
409 3300037312 Ga0395899_0433648 Ga0395899_0433648_32_634 198
410 3300037418 Ga0395900_0728021 Ga0395900_0728021_306_908 198
411 3300037466 Ga0395898_0217592 Ga0395898_0217592_249_851 198
412 3300037853 Ga0436364_1430824 Ga0436364_1430824_2425_3024 198
413 3300038443 Ga0395901_0167524 Ga0395901_0167524_1346_1948 198
414 3300041512 Ga0451853_0085171 Ga0451853_0085171_55_651 198
415 3300041999 Ga0439433_0061682 Ga0439433_0061682_159_761 198
416 3300042012 Ga0439455_0119533 Ga0439455_0119533_100_705 198
417 3300042437 Ga0439444_0019467 Ga0439444_0019467_86_688 198
418 3300042876 Ga0451577_0000003 Ga0451577_0000003_327906_328526 198
419 3300042876 Ga0451577_0000007 Ga0451577_0000007_11010_11621 198
420 3300042876 Ga0451577_0001447 Ga0451577_0001447_13007_13603 198
421 3300042876 Ga0451577_0482013 Ga0451577_0482013_408_1007 198
422 3300044673 Ga0453683_0610417 Ga0453683_0610417_96_692 198
423 3300044694 Ga0466963_0055839 Ga0466963_0055839_1398_1994 198
424 3300044712 Ga0453684_0000018 Ga0453684_0000018_204715_205335 198
425 3300044712 Ga0453684_0000094 Ga0453684_0000094_11010_11621 198
426 3300044712 Ga0453684_0082494 Ga0453684_0082494_1566_2162 198
427 3300044712 Ga0453684_0105481 Ga0453684_0105481_2781_3377 198
428 3300044712 Ga0453684_0144217 Ga0453684_0144217_273_872 198
429 3300044712 Ga0453684_0226236 Ga0453684_0226236_450_1052 198
430 3300044712 Ga0453684_0287352 Ga0453684_0287352_625_1221 198
431 3300044712 Ga0453684_0321373 Ga0453684_0321373_975_1571 198
432 3300044712 Ga0453684_0469606 Ga0453684_0469606_350_949 198
433 3300044712 Ga0453684_0908031 Ga0453684_0908031_163_765 198
434 3300045049 Ga0466959_0028404 Ga0466959_0028404_3263_3859 198
435 3300045051 Ga0451576_0054176 Ga0451576_0054176_294_908 198
436 3300047318 Ga0495636_0105137 Ga0495636_0105137_479_1081 198
437 3300048909 Ga0496106_0000698 Ga0496106_0000698_21194_21796 198
438 3300048909 Ga0496106_0236934 Ga0496106_0236934_378_980 198
439 3300048910 Ga0496107_0213812 Ga0496107_0213812_516_1118 198
440 3300048910 Ga0496107_0770084 Ga0496107_0770084_45_647 198
441 3300049568 Ga0501031_0292730 Ga0501031_0292730_27_623 198
442 3300049575 Ga0501039_0721923 Ga0501039_0721923_49_645 198
443 3300049584 Ga0501068_0370684 Ga0501068_0370684_182_778 198
444 3300049584 Ga0501068_0653089 Ga0501068_0653089_41_637 198
445 3300049588 Ga0501072_0820063 Ga0501072_0820063_37_633 198
446 3300049591 Ga0501075_0224792 Ga0501075_0224792_545_1141 198
447 3300049592 Ga0501076_0398244 Ga0501076_0398244_287_883 198
448 3300049654 Ga0501207_001509 Ga0501207_001509_1683_2285 198
449 3300049656 Ga0501209_013404 Ga0501209_013404_1024_1626 198
450 3300049661 Ga0501217_013260 Ga0501217_013260_178_780 198
451 3300049663 Ga0501223_001818 Ga0501223_001818_212_814 198
452 3300049664 Ga0501224_004485 Ga0501224_004485_1280_1882 198
453 3300049667 Ga0501230_003470 Ga0501230_003470_58_660 198
454 3300049668 Ga0501233_009297 Ga0501233_009297_1256_1858 198
455 3300049669 Ga0501235_004346 Ga0501235_004346_1945_2547 198
456 3300049686 Ga0501257_008978 Ga0501257_008978_1633_2235 198
457 3300049779 Ga0501283_021685 Ga0501283_021685_358_960 198
458 3300049851 Ga0501212_027287 Ga0501212_027287_181_783 198
459 3300050491 nmdc:mga00v17_7675_c1 nmdc:mga00v17_7675_c1_2333_2944 198
460 3300050492 nmdc:mga0yw44_214_c1 nmdc:mga0yw44_214_c1_3485_4096 198
461 3300050494 nmdc:mga06z11_127432_c1 nmdc:mga06z11_127432_c1_616_1233 198
462 3300050507 nmdc:mga05p37_1012992_c1 nmdc:mga05p37_1012992_c1_110_706 198
463 3300050507 nmdc:mga05p37_344679_c1 nmdc:mga05p37_344679_c1_948_1550 198
464 3300050507 nmdc:mga05p37_39878_c1 nmdc:mga05p37_39878_c1_2154_2750 198
465 3300050507 nmdc:mga05p37_725247_c1 nmdc:mga05p37_725247_c1_179_778 198
466 3300050507 nmdc:mga05p37_80409_c1 nmdc:mga05p37_80409_c1_1112_1714 198
467 3300050507 nmdc:mga05p37_833762_c1 nmdc:mga05p37_833762_c1_306_908 198
468 3300050508 nmdc:mga09592_46270_c2 nmdc:mga09592_46270_c2_376_972 198
469 3300050508 nmdc:mga09592_552413_c1 nmdc:mga09592_552413_c1_135_737 198
470 3300050508 nmdc:mga09592_92773_c1 nmdc:mga09592_92773_c1_1925_2521 198
471 3300050510 nmdc:mga06r32_190839_c1 nmdc:mga06r32_190839_c1_817_1413 198
472 3300050511 nmdc:mga08y16_59455_c1 nmdc:mga08y16_59455_c1_2604_3206 198
473 3300050512 nmdc:mga0n895_390590_c1 nmdc:mga0n895_390590_c1_519_1115 198
474 3300050512 nmdc:mga0n895_458832_c1 nmdc:mga0n895_458832_c1_262_867 198
475 3300050512 nmdc:mga0n895_62802_c1 nmdc:mga0n895_62802_c1_756_1358 198
476 3300050513 nmdc:mga0rr50_952_c1 nmdc:mga0rr50_952_c1_811_1413 198
477 3300050514 nmdc:mga08x19_12_c1 nmdc:mga08x19_12_c1_276436_277038 198
478 3300050514 nmdc:mga08x19_48925_c1 nmdc:mga08x19_48925_c1_212_814 198
479 3300050515 nmdc:mga0a205_118561_c1 nmdc:mga0a205_118561_c1_760_1371 198
480 3300050515 nmdc:mga0a205_279527_c1 nmdc:mga0a205_279527_c1_816_1418 198
481 3300050515 nmdc:mga0a205_41502_c1 nmdc:mga0a205_41502_c1_1134_1736 198
482 3300054114 Ga0501084_0080957 Ga0501084_0080957_1151_1747 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

30

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7685 2 190
1vdr-assembly1.cif.gz_B dihydrofolate reductase 0.7614 3 190
3ix9-assembly1.cif.gz_A crystal structure of streptococcus pneumoniae dihydrofolate reductase - sp9 mutant 0.7608 1 191
3e0b-assembly1.cif.gz_A bacillus anthracis dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b) 0.7593 2 189
1vdr-assembly1.cif.gz_B dihydrofolate reductase 0.7571 3 190
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7675 2 187 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7632 1 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7631 2 187 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7591 1 191 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7527 3 190 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.929 57 198 GO:0008703
GO:0009231
AF-A0A1Y5U461-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9163 55 197 GO:0008703
GO:0009231
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.9104 57 198 GO:0008703
GO:0009231
AF-A0A0J7I096-F1-model_v4 Dihydrofolate reductase 0.9039 1 198 GO:0008703
GO:0009231
AF-A0A1Q7UMG8-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9035 18 198 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
86.85 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map