F452602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 482 | 237 | 479 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_11095742|Ga0114129_110957421 |
| Length | 225 |
| Sequence | MCYTPGTAFYAEDDHGGHAEPANVEDSIMRKLIVLEHLTLDGVIQAPGGSDEDASDGFAYGGWSAPYSDDVLGTALSEQMNRPFDLLLGRKTFDIWASYWPHHADFWPGVMTATKYVASTTLTSSEWQPSVFLNGDIAEKVANIKQQQGPDVHVWGSGNLLQTLIKHDLVDVFWLMIYPITLGSGKRLFADGTIPAAFKVTESHVSPDGVIIVSYERAGAITTGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908026 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 3 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 4 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 166 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 167 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 187 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 188 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 203 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 212 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 213 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 214 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 217 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 220 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 221 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 222 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 225 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 235 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.28 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 96.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1a_Contig_1954 | 2124908026 | Bacteria | 784 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | JGI24751J29686_10000036 | 3300002459 | Bacteria | 82067 |
| 4 | Ga0055531_10001817 | 3300003794 | Bacteria | 15134 |
| 5 | Ga0065714_10064460 | 3300005288 | Bacteria | 66400 |
| 6 | Ga0065704_10070575 | 3300005289 | Bacteria | 20060 |
| 7 | Ga0065712_10000119 | 3300005290 | Bacteria | 137052 |
| 8 | Ga0065712_10135620 | 3300005290 | Bacteria | 1429 |
| 9 | Ga0065712_10255835 | 3300005290 | Bacteria | 921 |
| 10 | Ga0065715_10089467 | 3300005293 | Bacteria | 10038 |
| 11 | Ga0065715_10266570 | 3300005293 | Bacteria | 1113 |
| 12 | Ga0065715_10335324 | 3300005293 | Bacteria | 976 |
| 13 | Ga0065707_10005873 | 3300005295 | Bacteria | 4362 |
| 14 | Ga0065707_10007266 | 3300005295 | Bacteria | 3319 |
| 15 | Ga0065707_10082364 | 3300005295 | Bacteria | 16154 |
| 16 | Ga0070690_100359687 | 3300005330 | Bacteria | 1059 |
| 17 | Ga0070670_100003166 | 3300005331 | Bacteria | 13604 |
| 18 | Ga0070670_100018717 | 3300005331 | Bacteria | 5937 |
| 19 | Ga0068869_100000137 | 3300005334 | Bacteria | 35570 |
| 20 | Ga0068869_100535877 | 3300005334 | Bacteria | 982 |
| 21 | Ga0070666_10049209 | 3300005335 | Bacteria | 2832 |
| 22 | Ga0070666_10310055 | 3300005335 | Bacteria | 1125 |
| 23 | Ga0068868_100063856 | 3300005338 | Bacteria | 2922 |
| 24 | Ga0070689_100414349 | 3300005340 | Unclassified | 1141 |
| 25 | Ga0070687_100375058 | 3300005343 | Bacteria | 925 |
| 26 | Ga0070692_10207225 | 3300005345 | Bacteria | 1152 |
| 27 | Ga0070669_100210792 | 3300005353 | Bacteria | 1533 |
| 28 | Ga0070669_100881500 | 3300005353 | Unclassified | 764 |
| 29 | Ga0070675_100155735 | 3300005354 | Bacteria | 1962 |
| 30 | Ga0070675_100301794 | 3300005354 | Unclassified | 1411 |
| 31 | Ga0070671_100001809 | 3300005355 | Bacteria | 16263 |
| 32 | Ga0070671_100043971 | 3300005355 | Bacteria | 3711 |
| 33 | Ga0070671_100247039 | 3300005355 | Bacteria | 1515 |
| 34 | Ga0070673_100206101 | 3300005364 | Bacteria | 1696 |
| 35 | Ga0070673_100354540 | 3300005364 | Bacteria | 1303 |
| 36 | Ga0070673_100689189 | 3300005364 | Bacteria | 938 |
| 37 | Ga0070703_10000501 | 3300005406 | Bacteria | 15404 |
| 38 | Ga0070709_10000084 | 3300005434 | Bacteria | 70621 |
| 39 | Ga0070710_10015583 | 3300005437 | Bacteria | 3851 |
| 40 | Ga0070701_10075638 | 3300005438 | Bacteria | 1811 |
| 41 | Ga0070711_100000175 | 3300005439 | Bacteria | 34287 |
| 42 | Ga0070711_100048533 | 3300005439 | Unclassified | 2904 |
| 43 | Ga0070711_100067686 | 3300005439 | Bacteria | 2506 |
| 44 | Ga0070700_100000289 | 3300005441 | Bacteria | 26444 |
| 45 | Ga0070700_100021378 | 3300005441 | Bacteria | 3760 |
| 46 | Ga0070700_100438833 | 3300005441 | Bacteria | 991 |
| 47 | Ga0070694_100021506 | 3300005444 | Bacteria | 4124 |
| 48 | Ga0070694_100576088 | 3300005444 | Unclassified | 904 |
| 49 | Ga0070708_100038080 | 3300005445 | Bacteria | 4199 |
| 50 | Ga0070708_100150220 | 3300005445 | Bacteria | 2166 |
| 51 | Ga0070708_100786505 | 3300005445 | Bacteria | 894 |
| 52 | Ga0068867_100717954 | 3300005459 | Unclassified | 884 |
| 53 | Ga0070685_10497965 | 3300005466 | Bacteria | 862 |
| 54 | Ga0070706_100000050 | 3300005467 | Bacteria | 140240 |
| 55 | Ga0070706_100277512 | 3300005467 | Bacteria | 1564 |
| 56 | Ga0070706_100300673 | 3300005467 | Bacteria | 1497 |
| 57 | Ga0070707_100132691 | 3300005468 | Bacteria | 2422 |
| 58 | Ga0070707_100231230 | 3300005468 | Unclassified | 1800 |
| 59 | Ga0070707_100397281 | 3300005468 | Unclassified | 1339 |
| 60 | Ga0070707_100583100 | 3300005468 | Bacteria | 1080 |
| 61 | Ga0070707_101118697 | 3300005468 | Bacteria | 754 |
| 62 | Ga0070698_100005844 | 3300005471 | Bacteria | 13448 |
| 63 | Ga0070698_100068432 | 3300005471 | Unclassified | 3568 |
| 64 | Ga0070698_100107406 | 3300005471 | Unclassified | 2759 |
| 65 | Ga0070698_100226161 | 3300005471 | Bacteria | 1804 |
| 66 | Ga0070698_100389258 | 3300005471 | Bacteria | 1327 |
| 67 | Ga0070698_100669279 | 3300005471 | Unclassified | 979 |
| 68 | Ga0070699_100010494 | 3300005518 | Bacteria | 8013 |
| 69 | Ga0070699_100010501 | 3300005518 | Bacteria | 8011 |
| 70 | Ga0070699_100020952 | 3300005518 | Bacteria | 5636 |
| 71 | Ga0070699_100136422 | 3300005518 | Bacteria | 2164 |
| 72 | Ga0070699_100231026 | 3300005518 | Bacteria | 1649 |
| 73 | Ga0070699_100267165 | 3300005518 | Bacteria | 1530 |
| 74 | Ga0070699_100491242 | 3300005518 | Unclassified | 1115 |
| 75 | Ga0070697_100211679 | 3300005536 | Bacteria | 1650 |
| 76 | Ga0070696_100192268 | 3300005546 | Bacteria | 1519 |
| 77 | Ga0070693_100511206 | 3300005547 | Bacteria | 854 |
| 78 | Ga0070665_100140212 | 3300005548 | Bacteria | 2421 |
| 79 | Ga0070704_100193779 | 3300005549 | Bacteria | 1635 |
| 80 | Ga0068855_101412359 | 3300005563 | Bacteria | 717 |
| 81 | Ga0070664_100401738 | 3300005564 | Bacteria | 1253 |
| 82 | Ga0070664_100533114 | 3300005564 | Bacteria | 1085 |
| 83 | Ga0068857_100089359 | 3300005577 | Bacteria | 2756 |
| 84 | Ga0068856_100036190 | 3300005614 | Bacteria | 4840 |
| 85 | Ga0070702_100131075 | 3300005615 | Unclassified | 1584 |
| 86 | Ga0068852_100450827 | 3300005616 | Unclassified | 1274 |
| 87 | Ga0068859_100003735 | 3300005617 | Bacteria | 15514 |
| 88 | Ga0068859_100027122 | 3300005617 | Bacteria | 5746 |
| 89 | Ga0068859_100070669 | 3300005617 | Bacteria | 3526 |
| 90 | Ga0068859_100299772 | 3300005617 | Bacteria | 1700 |
| 91 | Ga0068859_100302057 | 3300005617 | Bacteria | 1694 |
| 92 | Ga0068859_100406654 | 3300005617 | Unclassified | 1457 |
| 93 | Ga0068859_100642022 | 3300005617 | Bacteria | 1154 |
| 94 | Ga0068859_100863168 | 3300005617 | Bacteria | 991 |
| 95 | Ga0068859_100997226 | 3300005617 | Bacteria | 920 |
| 96 | Ga0068864_100107413 | 3300005618 | Bacteria | 2483 |
| 97 | Ga0068864_100397902 | 3300005618 | Bacteria | 1308 |
| 98 | Ga0068861_100007458 | 3300005719 | Bacteria | 7496 |
| 99 | Ga0068861_100238763 | 3300005719 | Bacteria | 1545 |
| 100 | Ga0068861_100379194 | 3300005719 | Bacteria | 1249 |
| 101 | Ga0068870_10122012 | 3300005840 | Bacteria | 1502 |
| 102 | Ga0068863_100036888 | 3300005841 | Bacteria | 4655 |
| 103 | Ga0068863_100462002 | 3300005841 | Bacteria | 1247 |
| 104 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 105 | Ga0068858_100055152 | 3300005842 | Bacteria | 3674 |
| 106 | Ga0068858_100367395 | 3300005842 | Bacteria | 1379 |
| 107 | Ga0068860_100347170 | 3300005843 | Unclassified | 1460 |
| 108 | Ga0068860_100560190 | 3300005843 | Bacteria | 1146 |
| 109 | Ga0068862_100454079 | 3300005844 | Bacteria | 1209 |
| 110 | Ga0081455_10138403 | 3300005937 | Bacteria | 1894 |
| 111 | Ga0081539_10014025 | 3300005985 | Bacteria | 5968 |
| 112 | Ga0081539_10169586 | 3300005985 | Bacteria | 1033 |
| 113 | Ga0075365_10003194 | 3300006038 | Bacteria | 8371 |
| 114 | Ga0075364_10009876 | 3300006051 | Bacteria | 5742 |
| 115 | Ga0070716_100000002 | 3300006173 | Bacteria | 396037 |
| 116 | Ga0070716_100511625 | 3300006173 | Bacteria | 888 |
| 117 | Ga0075362_10069038 | 3300006177 | Bacteria | 1611 |
| 118 | Ga0075367_10148887 | 3300006178 | Bacteria | 1452 |
| 119 | Ga0075366_10065175 | 3300006195 | Bacteria | 2167 |
| 120 | Ga0097621_100003491 | 3300006237 | Bacteria | 10844 |
| 121 | Ga0097621_100597965 | 3300006237 | Unclassified | 1008 |
| 122 | Ga0068871_100022816 | 3300006358 | Bacteria | 4831 |
| 123 | Ga0068871_100201456 | 3300006358 | Bacteria | 1718 |
| 124 | Ga0075428_100190111 | 3300006844 | Bacteria | 2221 |
| 125 | Ga0075428_100991646 | 3300006844 | Bacteria | 889 |
| 126 | Ga0075428_101425992 | 3300006844 | Unclassified | 726 |
| 127 | Ga0075431_100084801 | 3300006847 | Bacteria | 3270 |
| 128 | Ga0075431_100739390 | 3300006847 | Bacteria | 960 |
| 129 | Ga0075433_10065408 | 3300006852 | Unclassified | 3189 |
| 130 | Ga0075433_10246764 | 3300006852 | Bacteria | 1585 |
| 131 | Ga0075433_10322099 | 3300006852 | Bacteria | 1367 |
| 132 | Ga0075434_100047971 | 3300006871 | Bacteria | 4238 |
| 133 | Ga0075434_100092864 | 3300006871 | Unclassified | 3020 |
| 134 | Ga0075434_100485364 | 3300006871 | Unclassified | 1257 |
| 135 | Ga0075434_100640234 | 3300006871 | Unclassified | 1081 |
| 136 | Ga0075429_100057855 | 3300006880 | Unclassified | 3376 |
| 137 | Ga0075429_100097945 | 3300006880 | Plasmid | 2559 |
| 138 | Ga0075429_100190710 | 3300006880 | Unclassified | 1796 |
| 139 | Ga0075429_100358625 | 3300006880 | Unclassified | 1277 |
| 140 | Ga0075429_100492818 | 3300006880 | Unclassified | 1074 |
| 141 | Ga0075429_101081777 | 3300006880 | Unclassified | 700 |
| 142 | Ga0068865_100476605 | 3300006881 | Bacteria | 1036 |
| 143 | Ga0075436_100000136 | 3300006914 | Bacteria | 44102 |
| 144 | Ga0075436_100056914 | 3300006914 | Bacteria | 2700 |
| 145 | Ga0075436_100240147 | 3300006914 | Bacteria | 1288 |
| 146 | Ga0097620_100003735 | 3300006931 | Bacteria | 15514 |
| 147 | Ga0097620_100027122 | 3300006931 | Bacteria | 5746 |
| 148 | Ga0097620_100070669 | 3300006931 | Bacteria | 3526 |
| 149 | Ga0097620_100299766 | 3300006931 | Bacteria | 1700 |
| 150 | Ga0097620_100302060 | 3300006931 | Bacteria | 1694 |
| 151 | Ga0097620_100406655 | 3300006931 | Unclassified | 1457 |
| 152 | Ga0097620_100642056 | 3300006931 | Bacteria | 1154 |
| 153 | Ga0097620_100997290 | 3300006931 | Bacteria | 920 |
| 154 | Ga0075435_100005843 | 3300007076 | Bacteria | 8654 |
| 155 | Ga0075435_100161030 | 3300007076 | Unclassified | 1890 |
| 156 | Ga0075435_100281429 | 3300007076 | Bacteria | 1420 |
| 157 | Ga0099794_10130041 | 3300007265 | Bacteria | 1271 |
| 158 | Ga0099795_10054555 | 3300007788 | Bacteria | 1466 |
| 159 | Ga0105240_11052168 | 3300009093 | Bacteria | 868 |
| 160 | Ga0105240_11256615 | 3300009093 | Unclassified | 782 |
| 161 | Ga0111539_10042648 | 3300009094 | Bacteria | 5445 |
| 162 | Ga0111539_10239448 | 3300009094 | Bacteria | 2112 |
| 163 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 164 | Ga0105247_10325907 | 3300009101 | Bacteria | 1073 |
| 165 | Ga0105247_10365141 | 3300009101 | Bacteria | 1019 |
| 166 | Ga0114129_10115449 | 3300009147 | Unclassified | 3700 |
| 167 | Ga0114129_10227593 | 3300009147 | Bacteria | 2512 |
| 168 | Ga0114129_10513403 | 3300009147 | Unclassified | 1563 |
| 169 | Ga0114129_10827396 | 3300009147 | Unclassified | 1179 |
| 170 | Ga0114129_11095742 | 3300009147 | Bacteria | 997 |
| 171 | Ga0105243_10000715 | 3300009148 | Bacteria | 31978 |
| 172 | Ga0105243_10129053 | 3300009148 | Unclassified | 2142 |
| 173 | Ga0105243_10313290 | 3300009148 | Unclassified | 1427 |
| 174 | Ga0105243_10993984 | 3300009148 | Bacteria | 841 |
| 175 | Ga0105243_11180047 | 3300009148 | Unclassified | 778 |
| 176 | Ga0105241_10509778 | 3300009174 | Bacteria | 1074 |
| 177 | Ga0105242_10001084 | 3300009176 | Bacteria | 21382 |
| 178 | Ga0105242_10097799 | 3300009176 | Unclassified | 2482 |
| 179 | Ga0105248_10009967 | 3300009177 | Bacteria | 10463 |
| 180 | Ga0105248_10018120 | 3300009177 | Bacteria | 7775 |
| 181 | Ga0105248_10236439 | 3300009177 | Bacteria | 2057 |
| 182 | Ga0105248_10340307 | 3300009177 | Bacteria | 1689 |
| 183 | Ga0105238_10035489 | 3300009551 | Bacteria | 5069 |
| 184 | Ga0105249_10051727 | 3300009553 | Bacteria | 3749 |
| 185 | Ga0105249_10082592 | 3300009553 | Bacteria | 2990 |
| 186 | Ga0105249_11533135 | 3300009553 | Bacteria | 739 |
| 187 | Ga0099796_10064329 | 3300010159 | Bacteria | 1308 |
| 188 | Ga0105246_10012340 | 3300011119 | Bacteria | 5328 |
| 189 | Ga0105246_10054956 | 3300011119 | Bacteria | 2746 |
| 190 | Ga0105246_10106067 | 3300011119 | Unclassified | 2054 |
| 191 | Ga0157373_10085404 | 3300013100 | Bacteria | 2225 |
| 192 | Ga0157374_10041833 | 3300013296 | Bacteria | 4225 |
| 193 | Ga0157374_10109734 | 3300013296 | Unclassified | 2653 |
| 194 | Ga0157378_10000001 | 3300013297 | Bacteria | 352632 |
| 195 | Ga0157378_10199438 | 3300013297 | Bacteria | 1892 |
| 196 | Ga0157378_10219662 | 3300013297 | Bacteria | 1806 |
| 197 | Ga0157378_10608325 | 3300013297 | Bacteria | 1105 |
| 198 | Ga0157378_10819589 | 3300013297 | Bacteria | 957 |
| 199 | Ga0163162_10014966 | 3300013306 | Bacteria | 7577 |
| 200 | Ga0163162_10073113 | 3300013306 | Bacteria | 3484 |
| 201 | Ga0163162_10143661 | 3300013306 | Unclassified | 2501 |
| 202 | Ga0163162_10348630 | 3300013306 | Bacteria | 1613 |
| 203 | Ga0163162_10814527 | 3300013306 | Bacteria | 1050 |
| 204 | Ga0157375_10042802 | 3300013308 | Bacteria | 4387 |
| 205 | Ga0157375_10449409 | 3300013308 | Bacteria | 1454 |
| 206 | Ga0157375_10625346 | 3300013308 | Bacteria | 1234 |
| 207 | Ga0157375_10922249 | 3300013308 | Bacteria | 1016 |
| 208 | Ga0163163_10002456 | 3300014325 | Bacteria | 15671 |
| 209 | Ga0163163_10192774 | 3300014325 | Bacteria | 2086 |
| 210 | Ga0157380_10126483 | 3300014326 | Bacteria | 2173 |
| 211 | Ga0157380_10310500 | 3300014326 | Bacteria | 1457 |
| 212 | Ga0157376_10014983 | 3300014969 | Bacteria | 5844 |
| 213 | Ga0157376_10053020 | 3300014969 | Bacteria | 3375 |
| 214 | Ga0157376_10274697 | 3300014969 | Bacteria | 1584 |
| 215 | Ga0157376_11266579 | 3300014969 | Unclassified | 767 |
| 216 | Ga0163161_10035730 | 3300017792 | Bacteria | 3557 |
| 217 | Ga0207653_10000240 | 3300025885 | Bacteria | 36488 |
| 218 | Ga0207682_10134101 | 3300025893 | Unclassified | 1107 |
| 219 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 220 | Ga0207710_10174412 | 3300025900 | Unclassified | 1052 |
| 221 | Ga0207710_10212652 | 3300025900 | Bacteria | 958 |
| 222 | Ga0207688_10164761 | 3300025901 | Bacteria | 1316 |
| 223 | Ga0207685_10000038 | 3300025905 | Bacteria | 61306 |
| 224 | Ga0207699_10000006 | 3300025906 | Bacteria | 430147 |
| 225 | Ga0207645_10118329 | 3300025907 | Bacteria | 1719 |
| 226 | Ga0207643_10483633 | 3300025908 | Bacteria | 790 |
| 227 | Ga0207684_10000131 | 3300025910 | Bacteria | 137508 |
| 228 | Ga0207684_10388842 | 3300025910 | Bacteria | 1199 |
| 229 | Ga0207654_10083564 | 3300025911 | Bacteria | 1928 |
| 230 | Ga0207693_10008793 | 3300025915 | Bacteria | 8255 |
| 231 | Ga0207663_10000031 | 3300025916 | Bacteria | 96659 |
| 232 | Ga0207663_10068726 | 3300025916 | Unclassified | 2276 |
| 233 | Ga0207663_10106223 | 3300025916 | Bacteria | 1897 |
| 234 | Ga0207660_10687289 | 3300025917 | Unclassified | 835 |
| 235 | Ga0207662_10268617 | 3300025918 | Bacteria | 1125 |
| 236 | Ga0207646_10080706 | 3300025922 | Bacteria | 2909 |
| 237 | Ga0207646_10085680 | 3300025922 | Bacteria | 2818 |
| 238 | Ga0207646_10153164 | 3300025922 | Unclassified | 2079 |
| 239 | Ga0207646_10155367 | 3300025922 | Bacteria | 2063 |
| 240 | Ga0207646_10226802 | 3300025922 | Bacteria | 1688 |
| 241 | Ga0207646_10293621 | 3300025922 | Bacteria | 1469 |
| 242 | Ga0207681_10000729 | 3300025923 | Bacteria | 21525 |
| 243 | Ga0207694_10041840 | 3300025924 | Unclassified | 3532 |
| 244 | Ga0207650_10000006 | 3300025925 | Bacteria | 544730 |
| 245 | Ga0207650_10003171 | 3300025925 | Bacteria | 11327 |
| 246 | Ga0207650_10311612 | 3300025925 | Bacteria | 1287 |
| 247 | Ga0207659_10383532 | 3300025926 | Bacteria | 1172 |
| 248 | Ga0207700_10463890 | 3300025928 | Bacteria | 1118 |
| 249 | Ga0207700_10484894 | 3300025928 | Bacteria | 1093 |
| 250 | Ga0207644_10005266 | 3300025931 | Bacteria | 8442 |
| 251 | Ga0207644_10026968 | 3300025931 | Bacteria | 3966 |
| 252 | Ga0207644_10150115 | 3300025931 | Unclassified | 1802 |
| 253 | Ga0207644_10198051 | 3300025931 | Bacteria | 1583 |
| 254 | Ga0207686_10002273 | 3300025934 | Bacteria | 10549 |
| 255 | Ga0207686_10025988 | 3300025934 | Bacteria | 3413 |
| 256 | Ga0207709_10000301 | 3300025935 | Bacteria | 54207 |
| 257 | Ga0207709_10033452 | 3300025935 | Unclassified | 3019 |
| 258 | Ga0207709_10832857 | 3300025935 | Unclassified | 746 |
| 259 | Ga0207670_10144169 | 3300025936 | Bacteria | 1759 |
| 260 | Ga0207704_10122997 | 3300025938 | Bacteria | 1780 |
| 261 | Ga0207665_10000007 | 3300025939 | Bacteria | 177869 |
| 262 | Ga0207665_10667260 | 3300025939 | Unclassified | 816 |
| 263 | Ga0207691_10515310 | 3300025940 | Unclassified | 1015 |
| 264 | Ga0207711_10021424 | 3300025941 | Bacteria | 5400 |
| 265 | Ga0207711_10024802 | 3300025941 | Bacteria | 5030 |
| 266 | Ga0207711_10201266 | 3300025941 | Bacteria | 1817 |
| 267 | Ga0207711_10316635 | 3300025941 | Bacteria | 1441 |
| 268 | Ga0207689_10015621 | 3300025942 | Bacteria | 6430 |
| 269 | Ga0207689_10150192 | 3300025942 | Bacteria | 1920 |
| 270 | Ga0207679_10146884 | 3300025945 | Bacteria | 1914 |
| 271 | Ga0207679_10739484 | 3300025945 | Bacteria | 894 |
| 272 | Ga0207651_10371321 | 3300025960 | Bacteria | 1210 |
| 273 | Ga0207651_10738444 | 3300025960 | Bacteria | 869 |
| 274 | Ga0207712_10026197 | 3300025961 | Unclassified | 3882 |
| 275 | Ga0207712_10051094 | 3300025961 | Bacteria | 2889 |
| 276 | Ga0207668_10859766 | 3300025972 | Unclassified | 806 |
| 277 | Ga0207640_10226105 | 3300025981 | Unclassified | 1436 |
| 278 | Ga0207703_10000475 | 3300026035 | Bacteria | 42000 |
| 279 | Ga0207639_10757742 | 3300026041 | Bacteria | 903 |
| 280 | Ga0207708_10000148 | 3300026075 | Bacteria | 56156 |
| 281 | Ga0207708_10032184 | 3300026075 | Bacteria | 3983 |
| 282 | Ga0207708_10456321 | 3300026075 | Bacteria | 1065 |
| 283 | Ga0207702_10054003 | 3300026078 | Bacteria | 3403 |
| 284 | Ga0207641_10560969 | 3300026088 | Unclassified | 1115 |
| 285 | Ga0207648_10173152 | 3300026089 | Unclassified | 1908 |
| 286 | Ga0207648_10437237 | 3300026089 | Bacteria | 1189 |
| 287 | Ga0207676_10333789 | 3300026095 | Bacteria | 1396 |
| 288 | Ga0207674_10121744 | 3300026116 | Bacteria | 2576 |
| 289 | Ga0207674_10144377 | 3300026116 | Unclassified | 2339 |
| 290 | Ga0207674_10159992 | 3300026116 | Bacteria | 2206 |
| 291 | Ga0207674_10189876 | 3300026116 | Bacteria | 2004 |
| 292 | Ga0207674_10545533 | 3300026116 | Bacteria | 1120 |
| 293 | Ga0207675_100016334 | 3300026118 | Bacteria | 6929 |
| 294 | Ga0207675_100060847 | 3300026118 | Bacteria | 3526 |
| 295 | Ga0207675_100088039 | 3300026118 | Bacteria | 2917 |
| 296 | Ga0207675_101021526 | 3300026118 | Bacteria | 845 |
| 297 | Ga0207683_10294962 | 3300026121 | Bacteria | 1483 |
| 298 | Ga0207428_10020626 | 3300027907 | Bacteria | 5595 |
| 299 | Ga0268266_10324323 | 3300028379 | Bacteria | 1442 |
| 300 | Ga0268265_10136276 | 3300028380 | Bacteria | 2049 |
| 301 | Ga0268265_10191622 | 3300028380 | Unclassified | 1766 |
| 302 | Ga0268264_10206139 | 3300028381 | Unclassified | 1802 |
| 303 | Ga0268264_10558432 | 3300028381 | Bacteria | 1124 |
| 304 | Ga0265338_10086628 | 3300028800 | Unclassified | 2606 |
| 305 | Ga0265320_10056433 | 3300031240 | Unclassified | 1887 |
| 306 | Ga0316575_10016152 | 3300031665 | Bacteria | 2821 |
| 307 | Ga0316579_10009614 | 3300031691 | Bacteria | 4070 |
| 308 | Ga0316576_10013391 | 3300031727 | Bacteria | 5450 |
| 309 | Ga0316576_10270249 | 3300031727 | Bacteria | 1274 |
| 310 | Ga0316576_10382667 | 3300031727 | Bacteria | 1044 |
| 311 | Ga0316578_10003694 | 3300031728 | Bacteria | 7064 |
| 312 | Ga0316578_10190678 | 3300031728 | Bacteria | 1235 |
| 313 | Ga0316578_10275609 | 3300031728 | Bacteria | 1007 |
| 314 | Ga0307405_10003287 | 3300031731 | Bacteria | 7387 |
| 315 | Ga0316577_10049209 | 3300031733 | Bacteria | 2352 |
| 316 | Ga0316577_10554804 | 3300031733 | Bacteria | 653 |
| 317 | Ga0307413_10102245 | 3300031824 | Bacteria | 1897 |
| 318 | Ga0307413_10173413 | 3300031824 | Bacteria | 1529 |
| 319 | Ga0307413_10437259 | 3300031824 | Bacteria | 1035 |
| 320 | Ga0307410_10232494 | 3300031852 | Bacteria | 1424 |
| 321 | Ga0307410_10953214 | 3300031852 | Unclassified | 738 |
| 322 | Ga0307406_10008863 | 3300031901 | Bacteria | 5623 |
| 323 | Ga0307406_10396227 | 3300031901 | Bacteria | 1093 |
| 324 | Ga0307407_10085280 | 3300031903 | Bacteria | 1921 |
| 325 | Ga0307412_10011394 | 3300031911 | Bacteria | 5150 |
| 326 | Ga0307412_10337338 | 3300031911 | Bacteria | 1205 |
| 327 | Ga0307412_10703059 | 3300031911 | Bacteria | 868 |
| 328 | Ga0307416_100012210 | 3300032002 | Bacteria | 5773 |
| 329 | Ga0307416_100135443 | 3300032002 | Bacteria | 2227 |
| 330 | Ga0307416_100347746 | 3300032002 | Unclassified | 1499 |
| 331 | Ga0307414_10826749 | 3300032004 | Bacteria | 846 |
| 332 | Ga0307411_10006879 | 3300032005 | Bacteria | 5733 |
| 333 | Ga0307415_100084454 | 3300032126 | Bacteria | 2278 |
| 334 | Ga0307415_100175984 | 3300032126 | Bacteria | 1674 |
| 335 | Ga0307415_100786413 | 3300032126 | Unclassified | 867 |
| 336 | Ga0316585_10180470 | 3300032137 | Bacteria | 697 |
| 337 | Ga0316580_10085694 | 3300032139 | Bacteria | 963 |
| 338 | Ga0316596_1007557 | 3300033541 | Bacteria | 2573 |
| 339 | Ga0373951_0006494 | 3300035091 | Bacteria | 2675 |
| 340 | Ga0373923_0092227 | 3300035111 | Bacteria | 1326 |
| 341 | Ga0373939_0090071 | 3300035114 | Unclassified | 1035 |
| 342 | Ga0373953_0009191 | 3300035117 | Bacteria | 3387 |
| 343 | Ga0373956_0021635 | 3300035119 | Bacteria | 2744 |
| 344 | Ga0373957_0082574 | 3300035120 | Bacteria | 1270 |
| 345 | Ga0373955_0008153 | 3300035172 | Bacteria | 4848 |
| 346 | Ga0316574_0009270 | 3300035398 | Bacteria | 5505 |
| 347 | Ga0373924_0338281 | 3300035410 | Bacteria | 670 |
| 348 | Ga0373933_0045593 | 3300035724 | Bacteria | 2600 |
| 349 | Ga0373937_0074551 | 3300036401 | Bacteria | 3131 |
| 350 | Ga0373937_0535123 | 3300036401 | Bacteria | 1113 |
| 351 | Ga0316584_0011081 | 3300036712 | Bacteria | 6321 |
| 352 | Ga0316584_0014818 | 3300036712 | Bacteria | 5568 |
| 353 | Ga0316584_0274052 | 3300036712 | Bacteria | 1227 |
| 354 | Ga0316584_0298849 | 3300036712 | Bacteria | 1166 |
| 355 | Ga0395899_0433648 | 3300037312 | Unclassified | 864 |
| 356 | Ga0395900_0728021 | 3300037418 | Bacteria | 924 |
| 357 | Ga0395898_0217592 | 3300037466 | Bacteria | 1822 |
| 358 | Ga0436364_1430824 | 3300037853 | Bacteria | 6375 |
| 359 | Ga0395901_0167524 | 3300038443 | Bacteria | 2306 |
| 360 | Ga0451853_0085171 | 3300041512 | Unclassified | 741 |
| 361 | Ga0439433_0061682 | 3300041999 | Bacteria | 895 |
| 362 | Ga0439455_0119533 | 3300042012 | Unclassified | 738 |
| 363 | Ga0439444_0019467 | 3300042437 | Unclassified | 1185 |
| 364 | Ga0451577_0000003 | 3300042876 | Bacteria | 921850 |
| 365 | Ga0451577_0000007 | 3300042876 | Bacteria | 694123 |
| 366 | Ga0451577_0001447 | 3300042876 | Bacteria | 31590 |
| 367 | Ga0451577_0027855 | 3300042876 | Bacteria | 5113 |
| 368 | Ga0451577_0065071 | 3300042876 | Bacteria | 3251 |
| 369 | Ga0451577_0155812 | 3300042876 | Bacteria | 2056 |
| 370 | Ga0451577_0482013 | 3300042876 | Unclassified | 1126 |
| 371 | Ga0451577_0777843 | 3300042876 | Unclassified | 865 |
| 372 | Ga0453683_0002041 | 3300044673 | Bacteria | 16222 |
| 373 | Ga0453683_0047058 | 3300044673 | Bacteria | 2703 |
| 374 | Ga0453683_0278241 | 3300044673 | Bacteria | 1068 |
| 375 | Ga0453683_0349867 | 3300044673 | Unclassified | 949 |
| 376 | Ga0453683_0610417 | 3300044673 | Unclassified | 712 |
| 377 | Ga0466963_0055839 | 3300044694 | Bacteria | 2627 |
| 378 | Ga0453684_0000003 | 3300044712 | Bacteria | 1481694 |
| 379 | Ga0453684_0000018 | 3300044712 | Bacteria | 921850 |
| 380 | Ga0453684_0000094 | 3300044712 | Bacteria | 382117 |
| 381 | Ga0453684_0000162 | 3300044712 | Bacteria | 298154 |
| 382 | Ga0453684_0001158 | 3300044712 | Bacteria | 82247 |
| 383 | Ga0453684_0003650 | 3300044712 | Bacteria | 34176 |
| 384 | Ga0453684_0040800 | 3300044712 | Bacteria | 6294 |
| 385 | Ga0453684_0044672 | 3300044712 | Bacteria | 5922 |
| 386 | Ga0453684_0082494 | 3300044712 | Unclassified | 4005 |
| 387 | Ga0453684_0103049 | 3300044712 | Unclassified | 3488 |
| 388 | Ga0453684_0105481 | 3300044712 | Bacteria | 3437 |
| 389 | Ga0453684_0121530 | 3300044712 | Bacteria | 3151 |
| 390 | Ga0453684_0144217 | 3300044712 | Unclassified | 2839 |
| 391 | Ga0453684_0150406 | 3300044712 | Unclassified | 2767 |
| 392 | Ga0453684_0222489 | 3300044712 | Bacteria | 2185 |
| 393 | Ga0453684_0224238 | 3300044712 | Bacteria | 2175 |
| 394 | Ga0453684_0226236 | 3300044712 | Bacteria | 2163 |
| 395 | Ga0453684_0287352 | 3300044712 | Bacteria | 1874 |
| 396 | Ga0453684_0315634 | 3300044712 | Bacteria | 1772 |
| 397 | Ga0453684_0321373 | 3300044712 | Bacteria | 1753 |
| 398 | Ga0453684_0469606 | 3300044712 | Unclassified | 1397 |
| 399 | Ga0453684_0560312 | 3300044712 | Bacteria | 1257 |
| 400 | Ga0453684_0578979 | 3300044712 | Unclassified | 1233 |
| 401 | Ga0453684_0670733 | 3300044712 | Unclassified | 1129 |
| 402 | Ga0453684_0817992 | 3300044712 | Bacteria | 1003 |
| 403 | Ga0453684_0908031 | 3300044712 | Bacteria | 943 |
| 404 | Ga0453684_1108921 | 3300044712 | Unclassified | 835 |
| 405 | Ga0453684_1220448 | 3300044712 | Unclassified | 788 |
| 406 | Ga0466959_0028404 | 3300045049 | Bacteria | 4148 |
| 407 | Ga0451576_0000027 | 3300045051 | Bacteria | 422925 |
| 408 | Ga0451576_0001312 | 3300045051 | Bacteria | 43065 |
| 409 | Ga0451576_0014148 | 3300045051 | Bacteria | 8890 |
| 410 | Ga0451576_0054176 | 3300045051 | Unclassified | 4200 |
| 411 | Ga0451576_0058635 | 3300045051 | Bacteria | 4022 |
| 412 | Ga0451576_0442932 | 3300045051 | Unclassified | 1363 |
| 413 | Ga0495652_0241674 | 3300046529 | Bacteria | 1343 |
| 414 | Ga0495587_0004239 | 3300046536 | Bacteria | 9480 |
| 415 | Ga0495604_0063033 | 3300047317 | Bacteria | 2830 |
| 416 | Ga0495636_0103817 | 3300047318 | Bacteria | 1245 |
| 417 | Ga0495636_0105137 | 3300047318 | Bacteria | 1238 |
| 418 | Ga0495684_0119211 | 3300047471 | Bacteria | 1988 |
| 419 | Ga0495602_0054553 | 3300048088 | Bacteria | 3527 |
| 420 | Ga0496106_0000698 | 3300048909 | Bacteria | 24110 |
| 421 | Ga0496106_0236934 | 3300048909 | Bacteria | 1458 |
| 422 | Ga0496107_0213812 | 3300048910 | Bacteria | 1434 |
| 423 | Ga0496107_0770084 | 3300048910 | Unclassified | 706 |
| 424 | Ga0501308_014227 | 3300049128 | Bacteria | 929 |
| 425 | Ga0501031_0292730 | 3300049568 | Bacteria | 1056 |
| 426 | Ga0501039_0721923 | 3300049575 | Bacteria | 779 |
| 427 | Ga0501042_0474456 | 3300049578 | Unclassified | 908 |
| 428 | Ga0501068_0370684 | 3300049584 | Unclassified | 921 |
| 429 | Ga0501068_0653089 | 3300049584 | Bacteria | 687 |
| 430 | Ga0501072_0290918 | 3300049588 | Unclassified | 1299 |
| 431 | Ga0501072_0820063 | 3300049588 | Unclassified | 728 |
| 432 | Ga0501075_0224792 | 3300049591 | Unclassified | 1432 |
| 433 | Ga0501076_0398244 | 3300049592 | Unclassified | 1132 |
| 434 | Ga0501207_001509 | 3300049654 | Bacteria | 2917 |
| 435 | Ga0501209_013404 | 3300049656 | Bacteria | 1773 |
| 436 | Ga0501217_013260 | 3300049661 | Bacteria | 1848 |
| 437 | Ga0501223_001818 | 3300049663 | Bacteria | 4816 |
| 438 | Ga0501224_004485 | 3300049664 | Bacteria | 1983 |
| 439 | Ga0501230_003470 | 3300049667 | Bacteria | 2099 |
| 440 | Ga0501233_009297 | 3300049668 | Bacteria | 1915 |
| 441 | Ga0501235_004346 | 3300049669 | Bacteria | 3068 |
| 442 | Ga0501257_008978 | 3300049686 | Bacteria | 2253 |
| 443 | Ga0501283_021685 | 3300049779 | Bacteria | 1032 |
| 444 | Ga0501212_027287 | 3300049851 | Bacteria | 908 |
| 445 | nmdc:mga00v17_7675_c1 | 3300050491 | Bacteria | 5771 |
| 446 | nmdc:mga0yw44_214_c1 | 3300050492 | Bacteria | 20542 |
| 447 | nmdc:mga0k408_30215_c2 | 3300050493 | Bacteria | 2490 |
| 448 | nmdc:mga06z11_127432_c1 | 3300050494 | Bacteria | 1426 |
| 449 | nmdc:mga05p37_1012992_c1 | 3300050507 | Unclassified | 881 |
| 450 | nmdc:mga05p37_1094961_c1 | 3300050507 | Bacteria | 835 |
| 451 | nmdc:mga05p37_175410_c1 | 3300050507 | Unclassified | 2612 |
| 452 | nmdc:mga05p37_19131_c1 | 3300050507 | Bacteria | 8284 |
| 453 | nmdc:mga05p37_344679_c1 | 3300050507 | Unclassified | 1756 |
| 454 | nmdc:mga05p37_39878_c1 | 3300050507 | Bacteria | 5766 |
| 455 | nmdc:mga05p37_725247_c1 | 3300050507 | Bacteria | 1100 |
| 456 | nmdc:mga05p37_80409_c1 | 3300050507 | Bacteria | 4015 |
| 457 | nmdc:mga05p37_833762_c1 | 3300050507 | Bacteria | 1004 |
| 458 | nmdc:mga09592_127820_c1 | 3300050508 | Unclassified | 2185 |
| 459 | nmdc:mga09592_197333_c1 | 3300050508 | Unclassified | 1743 |
| 460 | nmdc:mga09592_46270_c2 | 3300050508 | Bacteria | 1844 |
| 461 | nmdc:mga09592_552413_c1 | 3300050508 | Bacteria | 989 |
| 462 | nmdc:mga09592_92773_c1 | 3300050508 | Unclassified | 2581 |
| 463 | nmdc:mga09592_959516_c1 | 3300050508 | Unclassified | 716 |
| 464 | nmdc:mga06r32_190839_c1 | 3300050510 | Bacteria | 2037 |
| 465 | nmdc:mga06r32_460308_c1 | 3300050510 | Unclassified | 1251 |
| 466 | nmdc:mga08y16_59455_c1 | 3300050511 | Bacteria | 3992 |
| 467 | nmdc:mga0n895_390590_c1 | 3300050512 | Bacteria | 1408 |
| 468 | nmdc:mga0n895_458832_c1 | 3300050512 | Bacteria | 1286 |
| 469 | nmdc:mga0n895_62802_c1 | 3300050512 | Plasmid | 3672 |
| 470 | nmdc:mga0rr50_952_c1 | 3300050513 | Bacteria | 4356 |
| 471 | nmdc:mga08x19_12_c1 | 3300050514 | Bacteria | 395395 |
| 472 | nmdc:mga08x19_48925_c1 | 3300050514 | Bacteria | 2710 |
| 473 | nmdc:mga0a205_118561_c1 | 3300050515 | Unclassified | 2545 |
| 474 | nmdc:mga0a205_279527_c1 | 3300050515 | Bacteria | 1545 |
| 475 | nmdc:mga0a205_41502_c1 | 3300050515 | Plasmid | 4431 |
| 476 | Ga0500594_0000002 | 3300053118 | Bacteria | 916890 |
| 477 | Ga0501084_0080957 | 3300054114 | Bacteria | 2723 |
| 478 | Ga0501082_0372666 | 3300060353 | Unclassified | 1245 |
| 479 | Ga0530510_0066546 | 3300061734 | Bacteria | 2613 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100000137 | Ga0068869_10000013724 | 163 |
| 2 | 3300035091 | Ga0373951_0006494 | Ga0373951_0006494_1179_1781 | 187 |
| 3 | 3300053118 | Ga0500594_0000002 | Ga0500594_0000002_719172_719762 | 190 |
| 4 | 3300025928 | Ga0207700_10463890 | Ga0207700_104638901 | 191 |
| 5 | iso_pu_bacteria | 2919034639 | 2919037217 | 191 |
| 6 | iso_pu_bacteria | 2939674588 | 2939675726 | 191 |
| 7 | 3300049128 | Ga0501308_014227 | Ga0501308_014227_335_919 | 193 |
| 8 | 3300050508 | nmdc:mga09592_127820_c1 | nmdc:mga09592_127820_c1_243_824 | 193 |
| 9 | 3300060353 | Ga0501082_0372666 | Ga0501082_0372666_259_840 | 193 |
| 10 | 3300026121 | Ga0207683_10294962 | Ga0207683_102949622 | 194 |
| 11 | 3300044712 | Ga0453684_0670733 | Ga0453684_0670733_82_678 | 194 |
| 12 | 3300049578 | Ga0501042_0474456 | Ga0501042_0474456_71_655 | 194 |
| 13 | 3300003794 | Ga0055531_10001817 | Ga0055531_100018177 | 195 |
| 14 | 3300025928 | Ga0207700_10484894 | Ga0207700_104848942 | 195 |
| 15 | 3300044673 | Ga0453683_0349867 | Ga0453683_0349867_349_936 | 195 |
| 16 | 3300044712 | Ga0453684_0003650 | Ga0453684_0003650_14771_15358 | 195 |
| 17 | 3300044712 | Ga0453684_0044672 | Ga0453684_0044672_3906_4493 | 195 |
| 18 | 3300044712 | Ga0453684_0150406 | Ga0453684_0150406_850_1437 | 195 |
| 19 | 3300044712 | Ga0453684_0315634 | Ga0453684_0315634_720_1307 | 195 |
| 20 | 3300044712 | Ga0453684_0578979 | Ga0453684_0578979_258_845 | 195 |
| 21 | 3300045051 | Ga0451576_0000027 | Ga0451576_0000027_335526_336113 | 195 |
| 22 | 3300047318 | Ga0495636_0103817 | Ga0495636_0103817_23_610 | 195 |
| 23 | 3300061734 | Ga0530510_0066546 | Ga0530510_0066546_622_1209 | 195 |
| 24 | iso_pu_bacteria | 2980182181 | 2980186599 | 195 |
| 25 | 3300005439 | Ga0070711_100048533 | Ga0070711_1000485333 | 196 |
| 26 | 3300005445 | Ga0070708_100786505 | Ga0070708_1007865052 | 196 |
| 27 | 3300005467 | Ga0070706_100300673 | Ga0070706_1003006732 | 196 |
| 28 | 3300006173 | Ga0070716_100511625 | Ga0070716_1005116251 | 196 |
| 29 | 3300006177 | Ga0075362_10069038 | Ga0075362_100690382 | 196 |
| 30 | 3300006195 | Ga0075366_10065175 | Ga0075366_100651752 | 196 |
| 31 | 3300013306 | Ga0163162_10143661 | Ga0163162_101436615 | 196 |
| 32 | 3300025910 | Ga0207684_10388842 | Ga0207684_103888422 | 196 |
| 33 | 3300025916 | Ga0207663_10068726 | Ga0207663_100687261 | 196 |
| 34 | 3300026116 | Ga0207674_10189876 | Ga0207674_101898761 | 196 |
| 35 | 3300042876 | Ga0451577_0027855 | Ga0451577_0027855_2414_3004 | 196 |
| 36 | 3300044712 | Ga0453684_0000003 | Ga0453684_0000003_337265_337855 | 196 |
| 37 | 3300044712 | Ga0453684_0103049 | Ga0453684_0103049_1191_1781 | 196 |
| 38 | 3300050493 | nmdc:mga0k408_30215_c2 | nmdc:mga0k408_30215_c2_666_1271 | 196 |
| 39 | 3300005289 | Ga0065704_10070575 | Ga0065704_100705753 | 197 |
| 40 | 3300005295 | Ga0065707_10005873 | Ga0065707_100058734 | 197 |
| 41 | 3300005295 | Ga0065707_10082364 | Ga0065707_1008236411 | 197 |
| 42 | 3300005354 | Ga0070675_100301794 | Ga0070675_1003017943 | 197 |
| 43 | 3300005444 | Ga0070694_100576088 | Ga0070694_1005760882 | 197 |
| 44 | 3300005468 | Ga0070707_100397281 | Ga0070707_1003972811 | 197 |
| 45 | 3300005518 | Ga0070699_100136422 | Ga0070699_1001364221 | 197 |
| 46 | 3300005719 | Ga0068861_100379194 | Ga0068861_1003791943 | 197 |
| 47 | 3300006844 | Ga0075428_101425992 | Ga0075428_1014259921 | 197 |
| 48 | 3300006880 | Ga0075429_101081777 | Ga0075429_1010817771 | 197 |
| 49 | 3300009093 | Ga0105240_11052168 | Ga0105240_110521681 | 197 |
| 50 | 3300009147 | Ga0114129_10827396 | Ga0114129_108273962 | 197 |
| 51 | 3300009147 | Ga0114129_11095742 | Ga0114129_110957421 | 197 |
| 52 | 3300009553 | Ga0105249_10051727 | Ga0105249_100517273 | 197 |
| 53 | 3300011119 | Ga0105246_10106067 | Ga0105246_101060673 | 197 |
| 54 | 3300025961 | Ga0207712_10026197 | Ga0207712_100261976 | 197 |
| 55 | 3300028380 | Ga0268265_10136276 | Ga0268265_101362763 | 197 |
| 56 | 3300028800 | Ga0265338_10086628 | Ga0265338_100866284 | 197 |
| 57 | 3300031665 | Ga0316575_10016152 | Ga0316575_100161523 | 197 |
| 58 | 3300031691 | Ga0316579_10009614 | Ga0316579_100096143 | 197 |
| 59 | 3300031727 | Ga0316576_10013391 | Ga0316576_100133914 | 197 |
| 60 | 3300031727 | Ga0316576_10270249 | Ga0316576_102702492 | 197 |
| 61 | 3300031727 | Ga0316576_10382667 | Ga0316576_103826672 | 197 |
| 62 | 3300031728 | Ga0316578_10003694 | Ga0316578_100036945 | 197 |
| 63 | 3300031728 | Ga0316578_10190678 | Ga0316578_101906782 | 197 |
| 64 | 3300031728 | Ga0316578_10275609 | Ga0316578_102756091 | 197 |
| 65 | 3300031733 | Ga0316577_10049209 | Ga0316577_100492091 | 197 |
| 66 | 3300031733 | Ga0316577_10554804 | Ga0316577_105548041 | 197 |
| 67 | 3300031824 | Ga0307413_10102245 | Ga0307413_101022453 | 197 |
| 68 | 3300031824 | Ga0307413_10437259 | Ga0307413_104372592 | 197 |
| 69 | 3300031852 | Ga0307410_10232494 | Ga0307410_102324943 | 197 |
| 70 | 3300031901 | Ga0307406_10396227 | Ga0307406_103962272 | 197 |
| 71 | 3300031903 | Ga0307407_10085280 | Ga0307407_100852803 | 197 |
| 72 | 3300031911 | Ga0307412_10337338 | Ga0307412_103373382 | 197 |
| 73 | 3300032004 | Ga0307414_10826749 | Ga0307414_108267491 | 197 |
| 74 | 3300032137 | Ga0316585_10180470 | Ga0316585_101804701 | 197 |
| 75 | 3300032139 | Ga0316580_10085694 | Ga0316580_100856942 | 197 |
| 76 | 3300033541 | Ga0316596_1007557 | Ga0316596_10075572 | 197 |
| 77 | 3300035111 | Ga0373923_0092227 | Ga0373923_0092227_491_1093 | 197 |
| 78 | 3300035114 | Ga0373939_0090071 | Ga0373939_0090071_85_678 | 197 |
| 79 | 3300035117 | Ga0373953_0009191 | Ga0373953_0009191_2458_3060 | 197 |
| 80 | 3300035119 | Ga0373956_0021635 | Ga0373956_0021635_1026_1628 | 197 |
| 81 | 3300035120 | Ga0373957_0082574 | Ga0373957_0082574_263_865 | 197 |
| 82 | 3300035172 | Ga0373955_0008153 | Ga0373955_0008153_2438_3040 | 197 |
| 83 | 3300035398 | Ga0316574_0009270 | Ga0316574_0009270_3136_3729 | 197 |
| 84 | 3300035410 | Ga0373924_0338281 | Ga0373924_0338281_15_617 | 197 |
| 85 | 3300035724 | Ga0373933_0045593 | Ga0373933_0045593_819_1421 | 197 |
| 86 | 3300036401 | Ga0373937_0074551 | Ga0373937_0074551_1920_2522 | 197 |
| 87 | 3300036712 | Ga0316584_0011081 | Ga0316584_0011081_4568_5188 | 197 |
| 88 | 3300036712 | Ga0316584_0014818 | Ga0316584_0014818_4638_5231 | 197 |
| 89 | 3300036712 | Ga0316584_0274052 | Ga0316584_0274052_321_914 | 197 |
| 90 | 3300036712 | Ga0316584_0298849 | Ga0316584_0298849_133_726 | 197 |
| 91 | 3300042876 | Ga0451577_0065071 | Ga0451577_0065071_2187_2780 | 197 |
| 92 | 3300042876 | Ga0451577_0155812 | Ga0451577_0155812_770_1363 | 197 |
| 93 | 3300042876 | Ga0451577_0777843 | Ga0451577_0777843_35_628 | 197 |
| 94 | 3300044673 | Ga0453683_0002041 | Ga0453683_0002041_12160_12753 | 197 |
| 95 | 3300044673 | Ga0453683_0047058 | Ga0453683_0047058_1920_2513 | 197 |
| 96 | 3300044673 | Ga0453683_0278241 | Ga0453683_0278241_190_783 | 197 |
| 97 | 3300044712 | Ga0453684_0000162 | Ga0453684_0000162_92544_93137 | 197 |
| 98 | 3300044712 | Ga0453684_0001158 | Ga0453684_0001158_25880_26527 | 197 |
| 99 | 3300044712 | Ga0453684_0040800 | Ga0453684_0040800_2468_3061 | 197 |
| 100 | 3300044712 | Ga0453684_0121530 | Ga0453684_0121530_596_1189 | 197 |
| 101 | 3300044712 | Ga0453684_0222489 | Ga0453684_0222489_501_1094 | 197 |
| 102 | 3300044712 | Ga0453684_0224238 | Ga0453684_0224238_1366_1959 | 197 |
| 103 | 3300044712 | Ga0453684_0560312 | Ga0453684_0560312_129_722 | 197 |
| 104 | 3300044712 | Ga0453684_0817992 | Ga0453684_0817992_65_658 | 197 |
| 105 | 3300044712 | Ga0453684_1108921 | Ga0453684_1108921_63_656 | 197 |
| 106 | 3300044712 | Ga0453684_1220448 | Ga0453684_1220448_114_707 | 197 |
| 107 | 3300045051 | Ga0451576_0001312 | Ga0451576_0001312_39211_39804 | 197 |
| 108 | 3300045051 | Ga0451576_0014148 | Ga0451576_0014148_915_1508 | 197 |
| 109 | 3300045051 | Ga0451576_0058635 | Ga0451576_0058635_2905_3498 | 197 |
| 110 | 3300045051 | Ga0451576_0442932 | Ga0451576_0442932_604_1197 | 197 |
| 111 | 3300046529 | Ga0495652_0241674 | Ga0495652_0241674_434_1036 | 197 |
| 112 | 3300046536 | Ga0495587_0004239 | Ga0495587_0004239_3317_3919 | 197 |
| 113 | 3300047317 | Ga0495604_0063033 | Ga0495604_0063033_1793_2395 | 197 |
| 114 | 3300047471 | Ga0495684_0119211 | Ga0495684_0119211_702_1304 | 197 |
| 115 | 3300048088 | Ga0495602_0054553 | Ga0495602_0054553_1800_2402 | 197 |
| 116 | 3300049588 | Ga0501072_0290918 | Ga0501072_0290918_175_768 | 197 |
| 117 | 3300050507 | nmdc:mga05p37_1094961_c1 | nmdc:mga05p37_1094961_c1_55_732 | 197 |
| 118 | 3300050507 | nmdc:mga05p37_175410_c1 | nmdc:mga05p37_175410_c1_1836_2429 | 197 |
| 119 | 3300050507 | nmdc:mga05p37_19131_c1 | nmdc:mga05p37_19131_c1_428_1021 | 197 |
| 120 | 3300050508 | nmdc:mga09592_197333_c1 | nmdc:mga09592_197333_c1_894_1487 | 197 |
| 121 | 3300050508 | nmdc:mga09592_959516_c1 | nmdc:mga09592_959516_c1_53_646 | 197 |
| 122 | 3300050510 | nmdc:mga06r32_460308_c1 | nmdc:mga06r32_460308_c1_388_981 | 197 |
| 123 | 2124908026 | MRS1a_Contig_1954 | MRS1a_00149570 | 198 |
| 124 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001545 | 198 |
| 125 | 3300002459 | JGI24751J29686_10000036 | JGI24751J29686_1000003642 | 198 |
| 126 | 3300005288 | Ga0065714_10064460 | Ga0065714_1006446042 | 198 |
| 127 | 3300005290 | Ga0065712_10000119 | Ga0065712_10000119114 | 198 |
| 128 | 3300005290 | Ga0065712_10135620 | Ga0065712_101356202 | 198 |
| 129 | 3300005290 | Ga0065712_10255835 | Ga0065712_102558351 | 198 |
| 130 | 3300005293 | Ga0065715_10089467 | Ga0065715_100894672 | 198 |
| 131 | 3300005293 | Ga0065715_10266570 | Ga0065715_102665702 | 198 |
| 132 | 3300005293 | Ga0065715_10335324 | Ga0065715_103353241 | 198 |
| 133 | 3300005295 | Ga0065707_10007266 | Ga0065707_100072663 | 198 |
| 134 | 3300005330 | Ga0070690_100359687 | Ga0070690_1003596871 | 198 |
| 135 | 3300005331 | Ga0070670_100003166 | Ga0070670_10000316610 | 198 |
| 136 | 3300005331 | Ga0070670_100018717 | Ga0070670_1000187173 | 198 |
| 137 | 3300005334 | Ga0068869_100535877 | Ga0068869_1005358771 | 198 |
| 138 | 3300005335 | Ga0070666_10049209 | Ga0070666_100492093 | 198 |
| 139 | 3300005335 | Ga0070666_10310055 | Ga0070666_103100552 | 198 |
| 140 | 3300005338 | Ga0068868_100063856 | Ga0068868_1000638565 | 198 |
| 141 | 3300005340 | Ga0070689_100414349 | Ga0070689_1004143493 | 198 |
| 142 | 3300005343 | Ga0070687_100375058 | Ga0070687_1003750582 | 198 |
| 143 | 3300005345 | Ga0070692_10207225 | Ga0070692_102072252 | 198 |
| 144 | 3300005353 | Ga0070669_100210792 | Ga0070669_1002107922 | 198 |
| 145 | 3300005353 | Ga0070669_100881500 | Ga0070669_1008815001 | 198 |
| 146 | 3300005354 | Ga0070675_100155735 | Ga0070675_1001557351 | 198 |
| 147 | 3300005355 | Ga0070671_100001809 | Ga0070671_1000018093 | 198 |
| 148 | 3300005355 | Ga0070671_100043971 | Ga0070671_1000439714 | 198 |
| 149 | 3300005355 | Ga0070671_100247039 | Ga0070671_1002470392 | 198 |
| 150 | 3300005364 | Ga0070673_100206101 | Ga0070673_1002061012 | 198 |
| 151 | 3300005364 | Ga0070673_100354540 | Ga0070673_1003545402 | 198 |
| 152 | 3300005364 | Ga0070673_100689189 | Ga0070673_1006891891 | 198 |
| 153 | 3300005406 | Ga0070703_10000501 | Ga0070703_1000050122 | 198 |
| 154 | 3300005434 | Ga0070709_10000084 | Ga0070709_1000008424 | 198 |
| 155 | 3300005437 | Ga0070710_10015583 | Ga0070710_100155833 | 198 |
| 156 | 3300005438 | Ga0070701_10075638 | Ga0070701_100756383 | 198 |
| 157 | 3300005439 | Ga0070711_100000175 | Ga0070711_10000017531 | 198 |
| 158 | 3300005439 | Ga0070711_100067686 | Ga0070711_1000676863 | 198 |
| 159 | 3300005441 | Ga0070700_100000289 | Ga0070700_10000028925 | 198 |
| 160 | 3300005441 | Ga0070700_100021378 | Ga0070700_1000213787 | 198 |
| 161 | 3300005441 | Ga0070700_100438833 | Ga0070700_1004388331 | 198 |
| 162 | 3300005444 | Ga0070694_100021506 | Ga0070694_1000215064 | 198 |
| 163 | 3300005445 | Ga0070708_100038080 | Ga0070708_1000380802 | 198 |
| 164 | 3300005445 | Ga0070708_100150220 | Ga0070708_1001502203 | 198 |
| 165 | 3300005459 | Ga0068867_100717954 | Ga0068867_1007179542 | 198 |
| 166 | 3300005466 | Ga0070685_10497965 | Ga0070685_104979651 | 198 |
| 167 | 3300005467 | Ga0070706_100000050 | Ga0070706_1000000503 | 198 |
| 168 | 3300005467 | Ga0070706_100277512 | Ga0070706_1002775121 | 198 |
| 169 | 3300005468 | Ga0070707_100132691 | Ga0070707_1001326913 | 198 |
| 170 | 3300005468 | Ga0070707_100231230 | Ga0070707_1002312301 | 198 |
| 171 | 3300005468 | Ga0070707_100583100 | Ga0070707_1005831001 | 198 |
| 172 | 3300005468 | Ga0070707_101118697 | Ga0070707_1011186971 | 198 |
| 173 | 3300005471 | Ga0070698_100005844 | Ga0070698_1000058444 | 198 |
| 174 | 3300005471 | Ga0070698_100068432 | Ga0070698_1000684322 | 198 |
| 175 | 3300005471 | Ga0070698_100107406 | Ga0070698_1001074062 | 198 |
| 176 | 3300005471 | Ga0070698_100226161 | Ga0070698_1002261612 | 198 |
| 177 | 3300005471 | Ga0070698_100389258 | Ga0070698_1003892582 | 198 |
| 178 | 3300005471 | Ga0070698_100669279 | Ga0070698_1006692791 | 198 |
| 179 | 3300005518 | Ga0070699_100010494 | Ga0070699_10001049410 | 198 |
| 180 | 3300005518 | Ga0070699_100010501 | Ga0070699_1000105014 | 198 |
| 181 | 3300005518 | Ga0070699_100020952 | Ga0070699_1000209526 | 198 |
| 182 | 3300005518 | Ga0070699_100231026 | Ga0070699_1002310262 | 198 |
| 183 | 3300005518 | Ga0070699_100267165 | Ga0070699_1002671653 | 198 |
| 184 | 3300005518 | Ga0070699_100491242 | Ga0070699_1004912423 | 198 |
| 185 | 3300005536 | Ga0070697_100211679 | Ga0070697_1002116792 | 198 |
| 186 | 3300005546 | Ga0070696_100192268 | Ga0070696_1001922682 | 198 |
| 187 | 3300005547 | Ga0070693_100511206 | Ga0070693_1005112061 | 198 |
| 188 | 3300005548 | Ga0070665_100140212 | Ga0070665_1001402122 | 198 |
| 189 | 3300005549 | Ga0070704_100193779 | Ga0070704_1001937793 | 198 |
| 190 | 3300005563 | Ga0068855_101412359 | Ga0068855_1014123591 | 198 |
| 191 | 3300005564 | Ga0070664_100401738 | Ga0070664_1004017382 | 198 |
| 192 | 3300005564 | Ga0070664_100533114 | Ga0070664_1005331142 | 198 |
| 193 | 3300005577 | Ga0068857_100089359 | Ga0068857_1000893593 | 198 |
| 194 | 3300005614 | Ga0068856_100036190 | Ga0068856_1000361904 | 198 |
| 195 | 3300005615 | Ga0070702_100131075 | Ga0070702_1001310753 | 198 |
| 196 | 3300005616 | Ga0068852_100450827 | Ga0068852_1004508271 | 198 |
| 197 | 3300005617 | Ga0068859_100003735 | Ga0068859_10000373515 | 198 |
| 198 | 3300005617 | Ga0068859_100027122 | Ga0068859_1000271223 | 198 |
| 199 | 3300005617 | Ga0068859_100070669 | Ga0068859_1000706693 | 198 |
| 200 | 3300005617 | Ga0068859_100299772 | Ga0068859_1002997722 | 198 |
| 201 | 3300005617 | Ga0068859_100302057 | Ga0068859_1003020573 | 198 |
| 202 | 3300005617 | Ga0068859_100406654 | Ga0068859_1004066541 | 198 |
| 203 | 3300005617 | Ga0068859_100642022 | Ga0068859_1006420221 | 198 |
| 204 | 3300005617 | Ga0068859_100863168 | Ga0068859_1008631682 | 198 |
| 205 | 3300005617 | Ga0068859_100997226 | Ga0068859_1009972262 | 198 |
| 206 | 3300005618 | Ga0068864_100107413 | Ga0068864_1001074132 | 198 |
| 207 | 3300005618 | Ga0068864_100397902 | Ga0068864_1003979022 | 198 |
| 208 | 3300005719 | Ga0068861_100007458 | Ga0068861_1000074586 | 198 |
| 209 | 3300005719 | Ga0068861_100238763 | Ga0068861_1002387632 | 198 |
| 210 | 3300005840 | Ga0068870_10122012 | Ga0068870_101220122 | 198 |
| 211 | 3300005841 | Ga0068863_100036888 | Ga0068863_1000368885 | 198 |
| 212 | 3300005841 | Ga0068863_100462002 | Ga0068863_1004620022 | 198 |
| 213 | 3300005842 | Ga0068858_100000005 | Ga0068858_100000005196 | 198 |
| 214 | 3300005842 | Ga0068858_100055152 | Ga0068858_1000551525 | 198 |
| 215 | 3300005842 | Ga0068858_100367395 | Ga0068858_1003673952 | 198 |
| 216 | 3300005843 | Ga0068860_100347170 | Ga0068860_1003471702 | 198 |
| 217 | 3300005843 | Ga0068860_100560190 | Ga0068860_1005601902 | 198 |
| 218 | 3300005844 | Ga0068862_100454079 | Ga0068862_1004540792 | 198 |
| 219 | 3300005937 | Ga0081455_10138403 | Ga0081455_101384032 | 198 |
| 220 | 3300005985 | Ga0081539_10014025 | Ga0081539_100140259 | 198 |
| 221 | 3300005985 | Ga0081539_10169586 | Ga0081539_101695862 | 198 |
| 222 | 3300006038 | Ga0075365_10003194 | Ga0075365_100031947 | 198 |
| 223 | 3300006051 | Ga0075364_10009876 | Ga0075364_100098764 | 198 |
| 224 | 3300006173 | Ga0070716_100000002 | Ga0070716_100000002188 | 198 |
| 225 | 3300006178 | Ga0075367_10148887 | Ga0075367_101488872 | 198 |
| 226 | 3300006237 | Ga0097621_100003491 | Ga0097621_10000349110 | 198 |
| 227 | 3300006237 | Ga0097621_100597965 | Ga0097621_1005979651 | 198 |
| 228 | 3300006358 | Ga0068871_100022816 | Ga0068871_1000228161 | 198 |
| 229 | 3300006358 | Ga0068871_100201456 | Ga0068871_1002014563 | 198 |
| 230 | 3300006844 | Ga0075428_100190111 | Ga0075428_1001901112 | 198 |
| 231 | 3300006844 | Ga0075428_100991646 | Ga0075428_1009916462 | 198 |
| 232 | 3300006847 | Ga0075431_100084801 | Ga0075431_1000848013 | 198 |
| 233 | 3300006847 | Ga0075431_100739390 | Ga0075431_1007393901 | 198 |
| 234 | 3300006852 | Ga0075433_10065408 | Ga0075433_100654083 | 198 |
| 235 | 3300006852 | Ga0075433_10246764 | Ga0075433_102467641 | 198 |
| 236 | 3300006852 | Ga0075433_10322099 | Ga0075433_103220992 | 198 |
| 237 | 3300006871 | Ga0075434_100047971 | Ga0075434_1000479713 | 198 |
| 238 | 3300006871 | Ga0075434_100092864 | Ga0075434_1000928642 | 198 |
| 239 | 3300006871 | Ga0075434_100485364 | Ga0075434_1004853642 | 198 |
| 240 | 3300006871 | Ga0075434_100640234 | Ga0075434_1006402342 | 198 |
| 241 | 3300006880 | Ga0075429_100057855 | Ga0075429_1000578554 | 198 |
| 242 | 3300006880 | Ga0075429_100097945 | Ga0075429_1000979451 | 198 |
| 243 | 3300006880 | Ga0075429_100190710 | Ga0075429_1001907103 | 198 |
| 244 | 3300006880 | Ga0075429_100358625 | Ga0075429_1003586252 | 198 |
| 245 | 3300006880 | Ga0075429_100492818 | Ga0075429_1004928181 | 198 |
| 246 | 3300006881 | Ga0068865_100476605 | Ga0068865_1004766052 | 198 |
| 247 | 3300006914 | Ga0075436_100000136 | Ga0075436_10000013651 | 198 |
| 248 | 3300006914 | Ga0075436_100056914 | Ga0075436_1000569145 | 198 |
| 249 | 3300006914 | Ga0075436_100240147 | Ga0075436_1002401472 | 198 |
| 250 | 3300006931 | Ga0097620_100003735 | Ga0097620_10000373515 | 198 |
| 251 | 3300006931 | Ga0097620_100027122 | Ga0097620_1000271224 | 198 |
| 252 | 3300006931 | Ga0097620_100070669 | Ga0097620_1000706693 | 198 |
| 253 | 3300006931 | Ga0097620_100299766 | Ga0097620_1002997662 | 198 |
| 254 | 3300006931 | Ga0097620_100302060 | Ga0097620_1003020603 | 198 |
| 255 | 3300006931 | Ga0097620_100406655 | Ga0097620_1004066551 | 198 |
| 256 | 3300006931 | Ga0097620_100642056 | Ga0097620_1006420561 | 198 |
| 257 | 3300006931 | Ga0097620_100997290 | Ga0097620_1009972902 | 198 |
| 258 | 3300007076 | Ga0075435_100005843 | Ga0075435_1000058433 | 198 |
| 259 | 3300007076 | Ga0075435_100161030 | Ga0075435_1001610302 | 198 |
| 260 | 3300007076 | Ga0075435_100281429 | Ga0075435_1002814292 | 198 |
| 261 | 3300007265 | Ga0099794_10130041 | Ga0099794_101300411 | 198 |
| 262 | 3300007788 | Ga0099795_10054555 | Ga0099795_100545551 | 198 |
| 263 | 3300009093 | Ga0105240_11256615 | Ga0105240_112566152 | 198 |
| 264 | 3300009094 | Ga0111539_10042648 | Ga0111539_100426484 | 198 |
| 265 | 3300009094 | Ga0111539_10239448 | Ga0111539_102394483 | 198 |
| 266 | 3300009101 | Ga0105247_10000002 | Ga0105247_10000002448 | 198 |
| 267 | 3300009101 | Ga0105247_10325907 | Ga0105247_103259072 | 198 |
| 268 | 3300009101 | Ga0105247_10365141 | Ga0105247_103651411 | 198 |
| 269 | 3300009147 | Ga0114129_10115449 | Ga0114129_101154493 | 198 |
| 270 | 3300009147 | Ga0114129_10227593 | Ga0114129_102275933 | 198 |
| 271 | 3300009147 | Ga0114129_10513403 | Ga0114129_105134033 | 198 |
| 272 | 3300009148 | Ga0105243_10000715 | Ga0105243_1000071517 | 198 |
| 273 | 3300009148 | Ga0105243_10129053 | Ga0105243_101290532 | 198 |
| 274 | 3300009148 | Ga0105243_10313290 | Ga0105243_103132902 | 198 |
| 275 | 3300009148 | Ga0105243_10993984 | Ga0105243_109939841 | 198 |
| 276 | 3300009148 | Ga0105243_11180047 | Ga0105243_111800471 | 198 |
| 277 | 3300009174 | Ga0105241_10509778 | Ga0105241_105097782 | 198 |
| 278 | 3300009176 | Ga0105242_10001084 | Ga0105242_100010849 | 198 |
| 279 | 3300009176 | Ga0105242_10097799 | Ga0105242_100977992 | 198 |
| 280 | 3300009177 | Ga0105248_10009967 | Ga0105248_1000996713 | 198 |
| 281 | 3300009177 | Ga0105248_10018120 | Ga0105248_100181207 | 198 |
| 282 | 3300009177 | Ga0105248_10236439 | Ga0105248_102364393 | 198 |
| 283 | 3300009177 | Ga0105248_10340307 | Ga0105248_103403072 | 198 |
| 284 | 3300009551 | Ga0105238_10035489 | Ga0105238_100354894 | 198 |
| 285 | 3300009553 | Ga0105249_10082592 | Ga0105249_100825923 | 198 |
| 286 | 3300009553 | Ga0105249_11533135 | Ga0105249_115331351 | 198 |
| 287 | 3300010159 | Ga0099796_10064329 | Ga0099796_100643292 | 198 |
| 288 | 3300011119 | Ga0105246_10012340 | Ga0105246_100123403 | 198 |
| 289 | 3300011119 | Ga0105246_10054956 | Ga0105246_100549563 | 198 |
| 290 | 3300013100 | Ga0157373_10085404 | Ga0157373_100854042 | 198 |
| 291 | 3300013296 | Ga0157374_10041833 | Ga0157374_100418332 | 198 |
| 292 | 3300013296 | Ga0157374_10109734 | Ga0157374_101097344 | 198 |
| 293 | 3300013297 | Ga0157378_10000001 | Ga0157378_1000000168 | 198 |
| 294 | 3300013297 | Ga0157378_10199438 | Ga0157378_101994382 | 198 |
| 295 | 3300013297 | Ga0157378_10219662 | Ga0157378_102196622 | 198 |
| 296 | 3300013297 | Ga0157378_10608325 | Ga0157378_106083252 | 198 |
| 297 | 3300013297 | Ga0157378_10819589 | Ga0157378_108195892 | 198 |
| 298 | 3300013306 | Ga0163162_10014966 | Ga0163162_100149663 | 198 |
| 299 | 3300013306 | Ga0163162_10073113 | Ga0163162_100731134 | 198 |
| 300 | 3300013306 | Ga0163162_10348630 | Ga0163162_103486302 | 198 |
| 301 | 3300013306 | Ga0163162_10814527 | Ga0163162_108145271 | 198 |
| 302 | 3300013308 | Ga0157375_10042802 | Ga0157375_100428024 | 198 |
| 303 | 3300013308 | Ga0157375_10449409 | Ga0157375_104494093 | 198 |
| 304 | 3300013308 | Ga0157375_10625346 | Ga0157375_106253462 | 198 |
| 305 | 3300013308 | Ga0157375_10922249 | Ga0157375_109222492 | 198 |
| 306 | 3300014325 | Ga0163163_10002456 | Ga0163163_1000245610 | 198 |
| 307 | 3300014325 | Ga0163163_10192774 | Ga0163163_101927742 | 198 |
| 308 | 3300014326 | Ga0157380_10126483 | Ga0157380_101264833 | 198 |
| 309 | 3300014326 | Ga0157380_10310500 | Ga0157380_103105002 | 198 |
| 310 | 3300014969 | Ga0157376_10014983 | Ga0157376_100149831 | 198 |
| 311 | 3300014969 | Ga0157376_10053020 | Ga0157376_100530204 | 198 |
| 312 | 3300014969 | Ga0157376_10274697 | Ga0157376_102746972 | 198 |
| 313 | 3300014969 | Ga0157376_11266579 | Ga0157376_112665791 | 198 |
| 314 | 3300017792 | Ga0163161_10035730 | Ga0163161_100357305 | 198 |
| 315 | 3300025885 | Ga0207653_10000240 | Ga0207653_1000024023 | 198 |
| 316 | 3300025893 | Ga0207682_10134101 | Ga0207682_101341011 | 198 |
| 317 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002448 | 198 |
| 318 | 3300025900 | Ga0207710_10174412 | Ga0207710_101744122 | 198 |
| 319 | 3300025900 | Ga0207710_10212652 | Ga0207710_102126522 | 198 |
| 320 | 3300025901 | Ga0207688_10164761 | Ga0207688_101647612 | 198 |
| 321 | 3300025905 | Ga0207685_10000038 | Ga0207685_1000003815 | 198 |
| 322 | 3300025906 | Ga0207699_10000006 | Ga0207699_10000006312 | 198 |
| 323 | 3300025907 | Ga0207645_10118329 | Ga0207645_101183291 | 198 |
| 324 | 3300025908 | Ga0207643_10483633 | Ga0207643_104836331 | 198 |
| 325 | 3300025910 | Ga0207684_10000131 | Ga0207684_1000013184 | 198 |
| 326 | 3300025911 | Ga0207654_10083564 | Ga0207654_100835642 | 198 |
| 327 | 3300025915 | Ga0207693_10008793 | Ga0207693_100087936 | 198 |
| 328 | 3300025916 | Ga0207663_10000031 | Ga0207663_1000003174 | 198 |
| 329 | 3300025916 | Ga0207663_10106223 | Ga0207663_101062232 | 198 |
| 330 | 3300025917 | Ga0207660_10687289 | Ga0207660_106872891 | 198 |
| 331 | 3300025918 | Ga0207662_10268617 | Ga0207662_102686172 | 198 |
| 332 | 3300025922 | Ga0207646_10080706 | Ga0207646_100807063 | 198 |
| 333 | 3300025922 | Ga0207646_10085680 | Ga0207646_100856802 | 198 |
| 334 | 3300025922 | Ga0207646_10153164 | Ga0207646_101531642 | 198 |
| 335 | 3300025922 | Ga0207646_10155367 | Ga0207646_101553673 | 198 |
| 336 | 3300025922 | Ga0207646_10226802 | Ga0207646_102268022 | 198 |
| 337 | 3300025922 | Ga0207646_10293621 | Ga0207646_102936212 | 198 |
| 338 | 3300025923 | Ga0207681_10000729 | Ga0207681_1000072919 | 198 |
| 339 | 3300025924 | Ga0207694_10041840 | Ga0207694_100418404 | 198 |
| 340 | 3300025925 | Ga0207650_10000006 | Ga0207650_10000006404 | 198 |
| 341 | 3300025925 | Ga0207650_10003171 | Ga0207650_100031718 | 198 |
| 342 | 3300025925 | Ga0207650_10311612 | Ga0207650_103116121 | 198 |
| 343 | 3300025926 | Ga0207659_10383532 | Ga0207659_103835322 | 198 |
| 344 | 3300025931 | Ga0207644_10005266 | Ga0207644_100052667 | 198 |
| 345 | 3300025931 | Ga0207644_10026968 | Ga0207644_100269686 | 198 |
| 346 | 3300025931 | Ga0207644_10150115 | Ga0207644_101501153 | 198 |
| 347 | 3300025931 | Ga0207644_10198051 | Ga0207644_101980512 | 198 |
| 348 | 3300025934 | Ga0207686_10002273 | Ga0207686_100022733 | 198 |
| 349 | 3300025934 | Ga0207686_10025988 | Ga0207686_100259883 | 198 |
| 350 | 3300025935 | Ga0207709_10000301 | Ga0207709_1000030125 | 198 |
| 351 | 3300025935 | Ga0207709_10033452 | Ga0207709_100334524 | 198 |
| 352 | 3300025935 | Ga0207709_10832857 | Ga0207709_108328571 | 198 |
| 353 | 3300025936 | Ga0207670_10144169 | Ga0207670_101441692 | 198 |
| 354 | 3300025938 | Ga0207704_10122997 | Ga0207704_101229973 | 198 |
| 355 | 3300025939 | Ga0207665_10000007 | Ga0207665_100000072 | 198 |
| 356 | 3300025939 | Ga0207665_10667260 | Ga0207665_106672602 | 198 |
| 357 | 3300025940 | Ga0207691_10515310 | Ga0207691_105153101 | 198 |
| 358 | 3300025941 | Ga0207711_10021424 | Ga0207711_100214247 | 198 |
| 359 | 3300025941 | Ga0207711_10024802 | Ga0207711_100248027 | 198 |
| 360 | 3300025941 | Ga0207711_10201266 | Ga0207711_102012663 | 198 |
| 361 | 3300025941 | Ga0207711_10316635 | Ga0207711_103166352 | 198 |
| 362 | 3300025942 | Ga0207689_10015621 | Ga0207689_100156217 | 198 |
| 363 | 3300025942 | Ga0207689_10150192 | Ga0207689_101501922 | 198 |
| 364 | 3300025945 | Ga0207679_10146884 | Ga0207679_101468843 | 198 |
| 365 | 3300025945 | Ga0207679_10739484 | Ga0207679_107394842 | 198 |
| 366 | 3300025960 | Ga0207651_10371321 | Ga0207651_103713212 | 198 |
| 367 | 3300025960 | Ga0207651_10738444 | Ga0207651_107384441 | 198 |
| 368 | 3300025961 | Ga0207712_10051094 | Ga0207712_100510943 | 198 |
| 369 | 3300025972 | Ga0207668_10859766 | Ga0207668_108597661 | 198 |
| 370 | 3300025981 | Ga0207640_10226105 | Ga0207640_102261052 | 198 |
| 371 | 3300026035 | Ga0207703_10000475 | Ga0207703_1000047532 | 198 |
| 372 | 3300026041 | Ga0207639_10757742 | Ga0207639_107577421 | 198 |
| 373 | 3300026075 | Ga0207708_10000148 | Ga0207708_1000014830 | 198 |
| 374 | 3300026075 | Ga0207708_10032184 | Ga0207708_100321846 | 198 |
| 375 | 3300026075 | Ga0207708_10456321 | Ga0207708_104563211 | 198 |
| 376 | 3300026078 | Ga0207702_10054003 | Ga0207702_100540034 | 198 |
| 377 | 3300026088 | Ga0207641_10560969 | Ga0207641_105609692 | 198 |
| 378 | 3300026089 | Ga0207648_10173152 | Ga0207648_101731522 | 198 |
| 379 | 3300026089 | Ga0207648_10437237 | Ga0207648_104372372 | 198 |
| 380 | 3300026095 | Ga0207676_10333789 | Ga0207676_103337892 | 198 |
| 381 | 3300026116 | Ga0207674_10121744 | Ga0207674_101217442 | 198 |
| 382 | 3300026116 | Ga0207674_10144377 | Ga0207674_101443772 | 198 |
| 383 | 3300026116 | Ga0207674_10159992 | Ga0207674_101599922 | 198 |
| 384 | 3300026116 | Ga0207674_10545533 | Ga0207674_105455331 | 198 |
| 385 | 3300026118 | Ga0207675_100016334 | Ga0207675_1000163344 | 198 |
| 386 | 3300026118 | Ga0207675_100060847 | Ga0207675_1000608471 | 198 |
| 387 | 3300026118 | Ga0207675_100088039 | Ga0207675_1000880392 | 198 |
| 388 | 3300026118 | Ga0207675_101021526 | Ga0207675_1010215261 | 198 |
| 389 | 3300027907 | Ga0207428_10020626 | Ga0207428_100206267 | 198 |
| 390 | 3300028379 | Ga0268266_10324323 | Ga0268266_103243232 | 198 |
| 391 | 3300028380 | Ga0268265_10191622 | Ga0268265_101916221 | 198 |
| 392 | 3300028381 | Ga0268264_10206139 | Ga0268264_102061392 | 198 |
| 393 | 3300028381 | Ga0268264_10558432 | Ga0268264_105584321 | 198 |
| 394 | 3300031240 | Ga0265320_10056433 | Ga0265320_100564334 | 198 |
| 395 | 3300031731 | Ga0307405_10003287 | Ga0307405_100032875 | 198 |
| 396 | 3300031824 | Ga0307413_10173413 | Ga0307413_101734132 | 198 |
| 397 | 3300031852 | Ga0307410_10953214 | Ga0307410_109532141 | 198 |
| 398 | 3300031901 | Ga0307406_10008863 | Ga0307406_100088635 | 198 |
| 399 | 3300031911 | Ga0307412_10011394 | Ga0307412_100113945 | 198 |
| 400 | 3300031911 | Ga0307412_10703059 | Ga0307412_107030591 | 198 |
| 401 | 3300032002 | Ga0307416_100012210 | Ga0307416_1000122105 | 198 |
| 402 | 3300032002 | Ga0307416_100135443 | Ga0307416_1001354431 | 198 |
| 403 | 3300032002 | Ga0307416_100347746 | Ga0307416_1003477462 | 198 |
| 404 | 3300032005 | Ga0307411_10006879 | Ga0307411_100068791 | 198 |
| 405 | 3300032126 | Ga0307415_100084454 | Ga0307415_1000844544 | 198 |
| 406 | 3300032126 | Ga0307415_100175984 | Ga0307415_1001759842 | 198 |
| 407 | 3300032126 | Ga0307415_100786413 | Ga0307415_1007864132 | 198 |
| 408 | 3300036401 | Ga0373937_0535123 | Ga0373937_0535123_58_660 | 198 |
| 409 | 3300037312 | Ga0395899_0433648 | Ga0395899_0433648_32_634 | 198 |
| 410 | 3300037418 | Ga0395900_0728021 | Ga0395900_0728021_306_908 | 198 |
| 411 | 3300037466 | Ga0395898_0217592 | Ga0395898_0217592_249_851 | 198 |
| 412 | 3300037853 | Ga0436364_1430824 | Ga0436364_1430824_2425_3024 | 198 |
| 413 | 3300038443 | Ga0395901_0167524 | Ga0395901_0167524_1346_1948 | 198 |
| 414 | 3300041512 | Ga0451853_0085171 | Ga0451853_0085171_55_651 | 198 |
| 415 | 3300041999 | Ga0439433_0061682 | Ga0439433_0061682_159_761 | 198 |
| 416 | 3300042012 | Ga0439455_0119533 | Ga0439455_0119533_100_705 | 198 |
| 417 | 3300042437 | Ga0439444_0019467 | Ga0439444_0019467_86_688 | 198 |
| 418 | 3300042876 | Ga0451577_0000003 | Ga0451577_0000003_327906_328526 | 198 |
| 419 | 3300042876 | Ga0451577_0000007 | Ga0451577_0000007_11010_11621 | 198 |
| 420 | 3300042876 | Ga0451577_0001447 | Ga0451577_0001447_13007_13603 | 198 |
| 421 | 3300042876 | Ga0451577_0482013 | Ga0451577_0482013_408_1007 | 198 |
| 422 | 3300044673 | Ga0453683_0610417 | Ga0453683_0610417_96_692 | 198 |
| 423 | 3300044694 | Ga0466963_0055839 | Ga0466963_0055839_1398_1994 | 198 |
| 424 | 3300044712 | Ga0453684_0000018 | Ga0453684_0000018_204715_205335 | 198 |
| 425 | 3300044712 | Ga0453684_0000094 | Ga0453684_0000094_11010_11621 | 198 |
| 426 | 3300044712 | Ga0453684_0082494 | Ga0453684_0082494_1566_2162 | 198 |
| 427 | 3300044712 | Ga0453684_0105481 | Ga0453684_0105481_2781_3377 | 198 |
| 428 | 3300044712 | Ga0453684_0144217 | Ga0453684_0144217_273_872 | 198 |
| 429 | 3300044712 | Ga0453684_0226236 | Ga0453684_0226236_450_1052 | 198 |
| 430 | 3300044712 | Ga0453684_0287352 | Ga0453684_0287352_625_1221 | 198 |
| 431 | 3300044712 | Ga0453684_0321373 | Ga0453684_0321373_975_1571 | 198 |
| 432 | 3300044712 | Ga0453684_0469606 | Ga0453684_0469606_350_949 | 198 |
| 433 | 3300044712 | Ga0453684_0908031 | Ga0453684_0908031_163_765 | 198 |
| 434 | 3300045049 | Ga0466959_0028404 | Ga0466959_0028404_3263_3859 | 198 |
| 435 | 3300045051 | Ga0451576_0054176 | Ga0451576_0054176_294_908 | 198 |
| 436 | 3300047318 | Ga0495636_0105137 | Ga0495636_0105137_479_1081 | 198 |
| 437 | 3300048909 | Ga0496106_0000698 | Ga0496106_0000698_21194_21796 | 198 |
| 438 | 3300048909 | Ga0496106_0236934 | Ga0496106_0236934_378_980 | 198 |
| 439 | 3300048910 | Ga0496107_0213812 | Ga0496107_0213812_516_1118 | 198 |
| 440 | 3300048910 | Ga0496107_0770084 | Ga0496107_0770084_45_647 | 198 |
| 441 | 3300049568 | Ga0501031_0292730 | Ga0501031_0292730_27_623 | 198 |
| 442 | 3300049575 | Ga0501039_0721923 | Ga0501039_0721923_49_645 | 198 |
| 443 | 3300049584 | Ga0501068_0370684 | Ga0501068_0370684_182_778 | 198 |
| 444 | 3300049584 | Ga0501068_0653089 | Ga0501068_0653089_41_637 | 198 |
| 445 | 3300049588 | Ga0501072_0820063 | Ga0501072_0820063_37_633 | 198 |
| 446 | 3300049591 | Ga0501075_0224792 | Ga0501075_0224792_545_1141 | 198 |
| 447 | 3300049592 | Ga0501076_0398244 | Ga0501076_0398244_287_883 | 198 |
| 448 | 3300049654 | Ga0501207_001509 | Ga0501207_001509_1683_2285 | 198 |
| 449 | 3300049656 | Ga0501209_013404 | Ga0501209_013404_1024_1626 | 198 |
| 450 | 3300049661 | Ga0501217_013260 | Ga0501217_013260_178_780 | 198 |
| 451 | 3300049663 | Ga0501223_001818 | Ga0501223_001818_212_814 | 198 |
| 452 | 3300049664 | Ga0501224_004485 | Ga0501224_004485_1280_1882 | 198 |
| 453 | 3300049667 | Ga0501230_003470 | Ga0501230_003470_58_660 | 198 |
| 454 | 3300049668 | Ga0501233_009297 | Ga0501233_009297_1256_1858 | 198 |
| 455 | 3300049669 | Ga0501235_004346 | Ga0501235_004346_1945_2547 | 198 |
| 456 | 3300049686 | Ga0501257_008978 | Ga0501257_008978_1633_2235 | 198 |
| 457 | 3300049779 | Ga0501283_021685 | Ga0501283_021685_358_960 | 198 |
| 458 | 3300049851 | Ga0501212_027287 | Ga0501212_027287_181_783 | 198 |
| 459 | 3300050491 | nmdc:mga00v17_7675_c1 | nmdc:mga00v17_7675_c1_2333_2944 | 198 |
| 460 | 3300050492 | nmdc:mga0yw44_214_c1 | nmdc:mga0yw44_214_c1_3485_4096 | 198 |
| 461 | 3300050494 | nmdc:mga06z11_127432_c1 | nmdc:mga06z11_127432_c1_616_1233 | 198 |
| 462 | 3300050507 | nmdc:mga05p37_1012992_c1 | nmdc:mga05p37_1012992_c1_110_706 | 198 |
| 463 | 3300050507 | nmdc:mga05p37_344679_c1 | nmdc:mga05p37_344679_c1_948_1550 | 198 |
| 464 | 3300050507 | nmdc:mga05p37_39878_c1 | nmdc:mga05p37_39878_c1_2154_2750 | 198 |
| 465 | 3300050507 | nmdc:mga05p37_725247_c1 | nmdc:mga05p37_725247_c1_179_778 | 198 |
| 466 | 3300050507 | nmdc:mga05p37_80409_c1 | nmdc:mga05p37_80409_c1_1112_1714 | 198 |
| 467 | 3300050507 | nmdc:mga05p37_833762_c1 | nmdc:mga05p37_833762_c1_306_908 | 198 |
| 468 | 3300050508 | nmdc:mga09592_46270_c2 | nmdc:mga09592_46270_c2_376_972 | 198 |
| 469 | 3300050508 | nmdc:mga09592_552413_c1 | nmdc:mga09592_552413_c1_135_737 | 198 |
| 470 | 3300050508 | nmdc:mga09592_92773_c1 | nmdc:mga09592_92773_c1_1925_2521 | 198 |
| 471 | 3300050510 | nmdc:mga06r32_190839_c1 | nmdc:mga06r32_190839_c1_817_1413 | 198 |
| 472 | 3300050511 | nmdc:mga08y16_59455_c1 | nmdc:mga08y16_59455_c1_2604_3206 | 198 |
| 473 | 3300050512 | nmdc:mga0n895_390590_c1 | nmdc:mga0n895_390590_c1_519_1115 | 198 |
| 474 | 3300050512 | nmdc:mga0n895_458832_c1 | nmdc:mga0n895_458832_c1_262_867 | 198 |
| 475 | 3300050512 | nmdc:mga0n895_62802_c1 | nmdc:mga0n895_62802_c1_756_1358 | 198 |
| 476 | 3300050513 | nmdc:mga0rr50_952_c1 | nmdc:mga0rr50_952_c1_811_1413 | 198 |
| 477 | 3300050514 | nmdc:mga08x19_12_c1 | nmdc:mga08x19_12_c1_276436_277038 | 198 |
| 478 | 3300050514 | nmdc:mga08x19_48925_c1 | nmdc:mga08x19_48925_c1_212_814 | 198 |
| 479 | 3300050515 | nmdc:mga0a205_118561_c1 | nmdc:mga0a205_118561_c1_760_1371 | 198 |
| 480 | 3300050515 | nmdc:mga0a205_279527_c1 | nmdc:mga0a205_279527_c1_816_1418 | 198 |
| 481 | 3300050515 | nmdc:mga0a205_41502_c1 | nmdc:mga0a205_41502_c1_1134_1736 | 198 |
| 482 | 3300054114 | Ga0501084_0080957 | Ga0501084_0080957_1151_1747 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.7685 | 2 | 190 |
| 1vdr-assembly1.cif.gz_B | dihydrofolate reductase | 0.7614 | 3 | 190 |
| 3ix9-assembly1.cif.gz_A | crystal structure of streptococcus pneumoniae dihydrofolate reductase - sp9 mutant | 0.7608 | 1 | 191 |
| 3e0b-assembly1.cif.gz_A | bacillus anthracis dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b) | 0.7593 | 2 | 189 |
| 1vdr-assembly1.cif.gz_B | dihydrofolate reductase | 0.7571 | 3 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7675 | 2 | 187 | 3.40.430.10 |
| 3ix9B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7632 | 1 | 191 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7631 | 2 | 187 | 3.40.430.10 |
| 3ix9B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7591 | 1 | 191 | 3.40.430.10 |
| 1vdrA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7527 | 3 | 190 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520CGX7-F1-model_v4 | Dihydrofolate reductase | 0.929 | 57 | 198 |
GO:0008703
GO:0009231 |
| AF-A0A1Y5U461-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9163 | 55 | 197 |
GO:0008703
GO:0009231 |
| AF-A0A520CGX7-F1-model_v4 | Dihydrofolate reductase | 0.9104 | 57 | 198 |
GO:0008703
GO:0009231 |
| AF-A0A0J7I096-F1-model_v4 | Dihydrofolate reductase | 0.9039 | 1 | 198 |
GO:0008703
GO:0009231 |
| AF-A0A1Q7UMG8-F1-model_v4 | Riboflavin biosynthesis protein RibD | 0.9035 | 18 | 198 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar