F452588

General Info

Members Datasets Scaffolds Average Seq Length
482 285 470 392

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100115707|Ga0075434_1001157072
Length 442
Sequence MTSKLVIPAKAGIPLPLGRAAKGNEIPAFAGMTKRHGRALPSPADTPIQTGMDVSDLRVALFSGNYNYVRDGANQALNRLAGYLLKKGAAVRVYSPITSTPAFPPTGDLVDLPAVPIPGRPEYRIGVALPWRVRKDLRAFRPNIFHVASPEITGHRAVSLARRWDLPVIASVHTRFETYPRYYGMAFLEPVVLAVLRRFYRRCDAIFAPSDSMAQLLRDQRMNYDVGIWSRGIDREIFNPGARDLEWRRSFGIADDMPVIGFVGRLVMEKGLDVFSDTIDRLARRKVRHKVLVVGDGPARDWFEKRLPDAVFAGFQAGRDLGRAVASMDMLFNPSVTETFGNVTLEAMAAGLPVVAAIATGSQSLVTDGVTGRLVRPGARDRFCDALAFYCDNEEARFAAGLAGFEASQPYGWDEVNQELVDAYLRIIRQHDGGRQRPSPVP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
156 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
240 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
246 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
249 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
250 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
251 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
270 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
278 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
279 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
280 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
281 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
282 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0.21
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.32
Nodule 0
Rhizoplane 2.9
Rhizosphere 72.82
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1598334 2162886007 Bacteria 13028
2 JGI24736J21556_1004017 3300001904 Bacteria 2530
3 JGI24741J21665_1000307 3300001915 Bacteria 14680
4 JGI24741J21665_1009260 3300001915 Bacteria 1817
5 JGI24740J21852_10001337 3300001979 Bacteria 11214
6 JGI24739J22299_10000514 3300001989 Bacteria 13782
7 JGI24739J22299_10010653 3300001989 Bacteria 3410
8 JGI24739J22299_10012450 3300001989 Bacteria 3124
9 JGI24739J22299_10014082 3300001989 Bacteria 2912
10 JGI24737J22298_10000970 3300001990 Bacteria 10180
11 JGI24737J22298_10002852 3300001990 Bacteria 6122
12 JGI24737J22298_10010515 3300001990 Bacteria 3053
13 JGI24735J21928_10001484 3300002067 Bacteria 8299
14 JGI24735J21928_10006017 3300002067 Bacteria 4010
15 JGI24735J21928_10006400 3300002067 Bacteria 3876
16 JGI24735J21928_10028455 3300002067 Bacteria 1669
17 JGI24738J21930_10000862 3300002075 Bacteria 8714
18 JGI24751J29686_10001095 3300002459 Bacteria 5869
19 JGI25165J46597_1000094 3300003214 Bacteria 164674
20 Ga0055542_1002618 3300003762 Bacteria 5679
21 Ga0070658_10000106 3300005327 Bacteria 74827
22 Ga0070658_10009822 3300005327 Bacteria 7688
23 Ga0070658_10019070 3300005327 Bacteria 5494
24 Ga0070658_10094125 3300005327 Bacteria 2472
25 Ga0070676_10000539 3300005328 Bacteria 18309
26 Ga0070676_10040355 3300005328 Bacteria 2703
27 Ga0070690_100044613 3300005330 Bacteria 2815
28 Ga0070666_10105967 3300005335 Bacteria 1942
29 Ga0070680_100001995 3300005336 Bacteria 15024
30 Ga0068868_100000011 3300005338 Bacteria 117273
31 Ga0068868_100000016 3300005338 Bacteria 102357
32 Ga0070660_100004283 3300005339 Bacteria 9859
33 Ga0070660_100012845 3300005339 Bacteria 5989
34 Ga0070660_100021624 3300005339 Bacteria 4747
35 Ga0070660_100024388 3300005339 Bacteria 4485
36 Ga0070660_100070659 3300005339 Bacteria 2725
37 Ga0070660_100093126 3300005339 Bacteria 2379
38 Ga0070660_100186185 3300005339 Bacteria 1681
39 Ga0070689_100282872 3300005340 Bacteria 1376
40 Ga0070661_100000543 3300005344 Bacteria 28903
41 Ga0070668_100000145 3300005347 Bacteria 45376
42 Ga0070668_100057277 3300005347 Bacteria 3011
43 Ga0070668_100065236 3300005347 Bacteria 2824
44 Ga0070669_100001971 3300005353 Bacteria 14835
45 Ga0070669_100098706 3300005353 Bacteria 2200
46 Ga0070669_100188919 3300005353 Bacteria 1615
47 Ga0070675_100006402 3300005354 Bacteria 9037
48 Ga0070671_100000040 3300005355 Bacteria 92357
49 Ga0070674_100010143 3300005356 Bacteria 5677
50 Ga0070673_100000017 3300005364 Bacteria 112829
51 Ga0070659_100000376 3300005366 Bacteria 33719
52 Ga0070659_100036157 3300005366 Bacteria 3848
53 Ga0070659_100310848 3300005366 Bacteria 1316
54 Ga0070667_100000013 3300005367 Bacteria 255674
55 Ga0070667_100000076 3300005367 Bacteria 120555
56 Ga0070667_100200546 3300005367 Bacteria 1770
57 Ga0070663_100000796 3300005455 Bacteria 17138
58 Ga0070678_100006441 3300005456 Bacteria 6892
59 Ga0070662_100020051 3300005457 Bacteria 4550
60 Ga0070662_100020694 3300005457 Bacteria 4485
61 Ga0070662_100030726 3300005457 Bacteria 3763
62 Ga0070662_100246498 3300005457 Bacteria 1435
63 Ga0070681_10073101 3300005458 Bacteria 3391
64 Ga0068867_100000013 3300005459 Bacteria 112835
65 Ga0070679_100000007 3300005530 Bacteria 195373
66 Ga0068853_100018243 3300005539 Bacteria 5805
67 Ga0068853_100068094 3300005539 Bacteria 3094
68 Ga0070672_100174496 3300005543 Bacteria 1789
69 Ga0070686_100001769 3300005544 Bacteria 12073
70 Ga0070665_100210929 3300005548 Bacteria 1943
71 Ga0068855_100001357 3300005563 Bacteria 30331
72 Ga0068855_100012555 3300005563 Bacteria 10226
73 Ga0068855_100068478 3300005563 Bacteria 4132
74 Ga0068855_100163259 3300005563 Bacteria 2527
75 Ga0070664_100002181 3300005564 Bacteria 15727
76 Ga0070664_100299502 3300005564 Bacteria 1453
77 Ga0068857_100031947 3300005577 Bacteria 4653
78 Ga0068857_100100990 3300005577 Bacteria 2588
79 Ga0068854_100004495 3300005578 Bacteria 8794
80 Ga0068854_100006076 3300005578 Bacteria 7658
81 Ga0068854_100015612 3300005578 Bacteria 5036
82 Ga0068856_100066801 3300005614 Bacteria 3553
83 Ga0068856_100109461 3300005614 Bacteria 2759
84 Ga0068856_100157868 3300005614 Bacteria 2278
85 Ga0068852_100009901 3300005616 Bacteria 7095
86 Ga0068859_100003831 3300005617 Bacteria 15369
87 Ga0068864_100043079 3300005618 Bacteria 3864
88 Ga0068864_100124232 3300005618 Bacteria 2311
89 Ga0068863_100000210 3300005841 Bacteria 62419
90 Ga0068863_100080869 3300005841 Bacteria 3078
91 Ga0068863_100114569 3300005841 Bacteria 2568
92 Ga0068858_100000840 3300005842 Bacteria 31805
93 Ga0068860_100000131 3300005843 Bacteria 121109
94 Ga0068860_100113115 3300005843 Bacteria 2595
95 Ga0068862_100004564 3300005844 Bacteria 11673
96 Ga0075368_10000222 3300006042 Bacteria 15948
97 Ga0075368_10002540 3300006042 Bacteria 5970
98 Ga0075363_100001640 3300006048 Bacteria 8636
99 Ga0075364_10007289 3300006051 Bacteria 6561
100 Ga0075364_10045807 3300006051 Bacteria 2846
101 Ga0075362_10000003 3300006177 Bacteria 171099
102 Ga0075362_10110905 3300006177 Bacteria 1291
103 Ga0075367_10000600 3300006178 Bacteria 13828
104 Ga0075367_10010066 3300006178 Bacteria 4957
105 Ga0075369_10008733 3300006186 Bacteria 3913
106 Ga0075369_10010465 3300006186 Bacteria 3628
107 Ga0075369_10029858 3300006186 Bacteria 2293
108 Ga0075366_10000006 3300006195 Bacteria 106522
109 Ga0075366_10002562 3300006195 Bacteria 9346
110 Ga0075366_10124410 3300006195 Bacteria 1555
111 Ga0097621_100042519 3300006237 Bacteria 3660
112 Ga0075370_10000008 3300006353 Bacteria 97966
113 Ga0075370_10065111 3300006353 Bacteria 2079
114 Ga0068871_100046305 3300006358 Bacteria 3503
115 Ga0075434_100115707 3300006871 Bacteria 2694
116 Ga0068865_100000007 3300006881 Bacteria 185316
117 Ga0097620_100003831 3300006931 Bacteria 15369
118 Ga0097620_100052258 3300006931 Bacteria 4108
119 Ga0105240_10001847 3300009093 Bacteria 35457
120 Ga0105240_10032183 3300009093 Bacteria 6792
121 Ga0105240_10038107 3300009093 Bacteria 6170
122 Ga0105240_10117997 3300009093 Bacteria 3198
123 Ga0105240_10133605 3300009093 Bacteria 2973
124 Ga0105245_10001117 3300009098 Bacteria 24272
125 Ga0105245_10069692 3300009098 Bacteria 3189
126 Ga0105245_10158143 3300009098 Bacteria 2148
127 Ga0105243_10000118 3300009148 Bacteria 91438
128 Ga0105241_10005295 3300009174 Bacteria 9532
129 Ga0105242_10000196 3300009176 Bacteria 46996
130 Ga0105248_10077247 3300009177 Bacteria 3743
131 Ga0105237_10001035 3300009545 Bacteria 37429
132 Ga0105238_10046443 3300009551 Bacteria 4383
133 Ga0105249_10030391 3300009553 Bacteria 4883
134 Ga0105148_100022 3300009978 Bacteria 22988
135 Ga0105239_10000025 3300010375 Bacteria 254049
136 Ga0105239_10081502 3300010375 Bacteria 3562
137 Ga0105239_10332082 3300010375 Bacteria 1715
138 Ga0105246_10000313 3300011119 Bacteria 25771
139 Ga0105246_10191650 3300011119 Bacteria 1583
140 Ga0157373_10031372 3300013100 Bacteria 3826
141 Ga0157373_10061752 3300013100 Bacteria 2654
142 Ga0157371_10075019 3300013102 Bacteria 2395
143 Ga0157370_10000692 3300013104 Bacteria 42084
144 Ga0157370_10054341 3300013104 Bacteria 3817
145 Ga0157369_10249001 3300013105 Bacteria 1855
146 Ga0157374_10000189 3300013296 Bacteria 57356
147 Ga0157378_10000264 3300013297 Bacteria 51230
148 Ga0163162_10071331 3300013306 Bacteria 3526
149 Ga0157372_10282590 3300013307 Bacteria 1930
150 Ga0157375_10000436 3300013308 Bacteria 37738
151 Ga0157375_10002721 3300013308 Bacteria 15280
152 Ga0157375_10058557 3300013308 Bacteria 3812
153 Ga0157377_10006746 3300014745 Bacteria 5499
154 Ga0157376_10000081 3300014969 Bacteria 72584
155 Ga0163161_10005605 3300017792 Bacteria 8705
156 Ga0206356_11637029 3300020070 Bacteria 2016
157 Ga0209147_100977 3300025229 Bacteria 12457
158 Ga0207427_100465 3300025231 Bacteria 22311
159 Ga0209148_1000074 3300025254 Bacteria 314356
160 Ga0209148_1002092 3300025254 Bacteria 7573
161 Ga0209233_1000003 3300025261 Bacteria 1607366
162 Ga0209455_1000852 3300025272 Bacteria 16300
163 Ga0209050_1002950 3300025298 Bacteria 13299
164 Ga0207656_10039678 3300025321 Bacteria 1993
165 Ga0207680_10031503 3300025903 Bacteria 3004
166 Ga0207647_10002587 3300025904 Bacteria 13693
167 Ga0207647_10012237 3300025904 Bacteria 5980
168 Ga0207647_10016178 3300025904 Bacteria 5092
169 Ga0207647_10021047 3300025904 Bacteria 4360
170 Ga0207647_10025797 3300025904 Bacteria 3854
171 Ga0207647_10121026 3300025904 Bacteria 1543
172 Ga0207645_10009653 3300025907 Bacteria 6666
173 Ga0207645_10076059 3300025907 Bacteria 2149
174 Ga0207705_10000078 3300025909 Bacteria 120247
175 Ga0207705_10000110 3300025909 Bacteria 92932
176 Ga0207705_10009992 3300025909 Bacteria 6909
177 Ga0207705_10159254 3300025909 Bacteria 1695
178 Ga0207654_10052755 3300025911 Bacteria 2345
179 Ga0207707_10021232 3300025912 Bacteria 5675
180 Ga0207695_10027264 3300025913 Bacteria 6364
181 Ga0207695_10038786 3300025913 Bacteria 5124
182 Ga0207695_10046400 3300025913 Bacteria 4606
183 Ga0207671_10015085 3300025914 Bacteria 6072
184 Ga0207660_10001628 3300025917 Bacteria 15062
185 Ga0207657_10001650 3300025919 Bacteria 24065
186 Ga0207657_10002766 3300025919 Bacteria 18890
187 Ga0207657_10013560 3300025919 Bacteria 7994
188 Ga0207657_10037723 3300025919 Bacteria 4311
189 Ga0207657_10045189 3300025919 Bacteria 3867
190 Ga0207657_10057666 3300025919 Bacteria 3346
191 Ga0207649_10000074 3300025920 Bacteria 85018
192 Ga0207649_10206360 3300025920 Bacteria 1391
193 Ga0207652_10000001 3300025921 Bacteria 1006643
194 Ga0207681_10131029 3300025923 Bacteria 1854
195 Ga0207694_10066757 3300025924 Bacteria 2807
196 Ga0207659_10010728 3300025926 Bacteria 5762
197 Ga0207687_10001736 3300025927 Bacteria 15019
198 Ga0207687_10048349 3300025927 Bacteria 2953
199 Ga0207687_10052264 3300025927 Bacteria 2851
200 Ga0207644_10000005 3300025931 Bacteria 441948
201 Ga0207644_10040726 3300025931 Bacteria 3284
202 Ga0207690_10000001 3300025932 Bacteria 807539
203 Ga0207690_10000002 3300025932 Bacteria 807473
204 Ga0207690_10000003 3300025932 Bacteria 783011
205 Ga0207690_10000004 3300025932 Bacteria 746138
206 Ga0207690_10011899 3300025932 Bacteria 5203
207 Ga0207690_10031506 3300025932 Bacteria 3394
208 Ga0207690_10108726 3300025932 Bacteria 1993
209 Ga0207706_10006922 3300025933 Bacteria 10484
210 Ga0207706_10030960 3300025933 Bacteria 4770
211 Ga0207706_10041782 3300025933 Bacteria 4064
212 Ga0207706_10195360 3300025933 Bacteria 1775
213 Ga0207686_10000260 3300025934 Bacteria 39872
214 Ga0207709_10000156 3300025935 Bacteria 93099
215 Ga0207670_10086774 3300025936 Bacteria 2203
216 Ga0207704_10000017 3300025938 Bacteria 154190
217 Ga0207691_10050421 3300025940 Bacteria 3811
218 Ga0207691_10218196 3300025940 Bacteria 1655
219 Ga0207711_10019816 3300025941 Bacteria 5606
220 Ga0207711_10045369 3300025941 Bacteria 3756
221 Ga0207689_10001764 3300025942 Bacteria 20406
222 Ga0207667_10000071 3300025949 Bacteria 178355
223 Ga0207667_10013468 3300025949 Bacteria 9359
224 Ga0207667_10098275 3300025949 Bacteria 3021
225 Ga0207651_10000011 3300025960 Bacteria 191950
226 Ga0207651_10127474 3300025960 Bacteria 1942
227 Ga0207712_10061984 3300025961 Bacteria 2656
228 Ga0207668_10000063 3300025972 Bacteria 87944
229 Ga0207640_10000067 3300025981 Bacteria 85026
230 Ga0207640_10007773 3300025981 Bacteria 5921
231 Ga0207658_10000040 3300025986 Bacteria 142099
232 Ga0207658_10000094 3300025986 Bacteria 98638
233 Ga0207677_10000173 3300026023 Bacteria 50916
234 Ga0207677_10000217 3300026023 Bacteria 45841
235 Ga0207703_10020134 3300026035 Bacteria 5216
236 Ga0207703_10283817 3300026035 Bacteria 1505
237 Ga0207639_10002552 3300026041 Bacteria 12218
238 Ga0207639_10014604 3300026041 Bacteria 5530
239 Ga0207678_10000801 3300026067 Bacteria 28842
240 Ga0207678_10006666 3300026067 Bacteria 10234
241 Ga0207678_10113726 3300026067 Bacteria 2309
242 Ga0207678_10337310 3300026067 Bacteria 1299
243 Ga0207702_10064189 3300026078 Bacteria 3142
244 Ga0207702_10126882 3300026078 Bacteria 2292
245 Ga0207641_10000178 3300026088 Bacteria 88066
246 Ga0207641_10012755 3300026088 Bacteria 6890
247 Ga0207641_10025385 3300026088 Bacteria 4886
248 Ga0207648_10000045 3300026089 Bacteria 111963
249 Ga0207676_10109071 3300026095 Bacteria 2312
250 Ga0207674_10045090 3300026116 Bacteria 4538
251 Ga0207674_10111235 3300026116 Bacteria 2713
252 Ga0207674_10193448 3300026116 Bacteria 1984
253 Ga0207683_10002781 3300026121 Bacteria 15279
254 Ga0207698_10014302 3300026142 Bacteria 5271
255 Ga0207698_10028974 3300026142 Bacteria 3958
256 Ga0209813_10000174 3300027866 Bacteria 20909
257 Ga0209813_10000278 3300027866 Bacteria 14405
258 Ga0209974_10009617 3300027876 Bacteria 3280
259 Ga0268266_10052837 3300028379 Bacteria 3490
260 Ga0268265_10009354 3300028380 Bacteria 6623
261 Ga0268264_10000204 3300028381 Bacteria 120959
262 Ga0268264_10084102 3300028381 Bacteria 2727
263 Ga0268264_10281378 3300028381 Bacteria 1558
264 Ga0316176_1002165 3300030732 Bacteria 2442
265 Ga0316180_1083064 3300030736 Bacteria 3410
266 Ga0316182_1074158 3300030745 Bacteria 4099
267 Ga0307408_100016733 3300031548 Bacteria 4900
268 Ga0307408_100107237 3300031548 Bacteria 2138
269 Ga0307508_10006877 3300031616 Bacteria 10637
270 Ga0307405_10002439 3300031731 Bacteria 8198
271 Ga0307405_10032182 3300031731 Bacteria 3097
272 Ga0307405_10052449 3300031731 Bacteria 2536
273 Ga0307413_10004882 3300031824 Bacteria 5898
274 Ga0307413_10028229 3300031824 Bacteria 3122
275 Ga0307410_10008094 3300031852 Bacteria 5808
276 Ga0307406_10004932 3300031901 Bacteria 7271
277 Ga0307406_10144718 3300031901 Bacteria 1687
278 Ga0307407_10026018 3300031903 Bacteria 3093
279 Ga0307407_10124603 3300031903 Bacteria 1639
280 Ga0307412_10013021 3300031911 Bacteria 4862
281 Ga0307412_10077602 3300031911 Bacteria 2285
282 Ga0307412_10088098 3300031911 Bacteria 2164
283 Ga0307409_100001426 3300031995 Bacteria 11737
284 Ga0307409_100064763 3300031995 Bacteria 2873
285 Ga0307409_100089144 3300031995 Bacteria 2520
286 Ga0307416_100137072 3300032002 Bacteria 2216
287 Ga0307414_10080724 3300032004 Bacteria 2379
288 Ga0307414_10112254 3300032004 Bacteria 2077
289 Ga0307414_10123466 3300032004 Bacteria 1995
290 Ga0307414_10187562 3300032004 Bacteria 1670
291 Ga0307411_10021320 3300032005 Bacteria 3788
292 Ga0307411_10049133 3300032005 Bacteria 2739
293 Ga0307411_10061224 3300032005 Bacteria 2504
294 Ga0307411_10062328 3300032005 Bacteria 2487
295 Ga0373932_0028928 3300035112 Bacteria 1526
296 Ga0373925_0108116 3300037068 Bacteria 2146
297 Ga0395899_0003161 3300037312 Bacteria 13080
298 Ga0395900_0069180 3300037418 Bacteria 3628
299 Ga0395905_0061106 3300037471 Bacteria 3524
300 Ga0395901_0013811 3300038443 Bacteria 8214
301 Ga0395901_0033334 3300038443 Bacteria 5317
302 Ga0436365_1583798 3300039437 Bacteria 1376
303 Ga0451806_197249 3300041462 Bacteria 5054
304 Ga0439448_0000316 3300042005 Bacteria 10706
305 Ga0439448_0021031 3300042005 Bacteria 2023
306 Ga0439458_0001569 3300042157 Bacteria 5711
307 Ga0466972_0001992 3300044658 Bacteria 9992
308 Ga0466961_0006506 3300044693 Bacteria 7427
309 Ga0466963_0053736 3300044694 Bacteria 2675
310 Ga0466964_0005354 3300044706 Bacteria 4767
311 Ga0466971_0013596 3300044719 Bacteria 3576
312 Ga0466970_0001267 3300044765 Bacteria 12216
313 Ga0466957_0018982 3300044842 Bacteria 4042
314 Ga0466957_0072532 3300044842 Bacteria 2132
315 Ga0466960_0009650 3300044901 Bacteria 3986
316 Ga0466959_0001787 3300045049 Bacteria 13436
317 Ga0466958_0025126 3300045836 Bacteria 3509
318 Ga0466967_0229453 3300045976 Bacteria 1767
319 Ga0495617_009620 3300046452 Bacteria 3316
320 Ga0495627_000079 3300046453 Bacteria 118475
321 Ga0495627_013112 3300046453 Bacteria 2923
322 Ga0495650_0022633 3300046471 Bacteria 3010
323 Ga0495583_0000201 3300046506 Bacteria 100380
324 Ga0495606_0000443 3300046507 Bacteria 67796
325 Ga0495610_0000095 3300046512 Bacteria 104629
326 Ga0495616_0000030 3300046513 Bacteria 132950
327 Ga0495632_0005348 3300046519 Bacteria 8513
328 Ga0495637_0003789 3300046520 Bacteria 7957
329 Ga0495643_0000014 3300046522 Bacteria 314632
330 Ga0495643_0009291 3300046522 Bacteria 6122
331 Ga0495643_0030261 3300046522 Bacteria 3025
332 Ga0495648_0032372 3300046524 Bacteria 3432
333 Ga0495648_0056424 3300046524 Bacteria 2363
334 Ga0495663_0000007 3300046525 Bacteria 262438
335 Ga0495598_0006398 3300046537 Bacteria 2661
336 Ga0495633_0000487 3300046558 Bacteria 40143
337 Ga0495633_0000818 3300046558 Bacteria 27547
338 Ga0495633_0017648 3300046558 Bacteria 3642
339 Ga0495633_0073943 3300046558 Bacteria 1589
340 Ga0495668_0006455 3300046616 Bacteria 7677
341 Ga0495670_0012794 3300046691 Bacteria 4126
342 Ga0495671_0000058 3300046692 Bacteria 113487
343 Ga0495671_0064939 3300046692 Bacteria 1796
344 Ga0495673_0031160 3300047469 Bacteria 2499
345 Ga0495673_0087723 3300047469 Bacteria 1276
346 Ga0495681_0000008 3300047470 Bacteria 215295
347 Ga0495686_0000072 3300047472 Bacteria 216371
348 Ga0495686_0000103 3300047472 Bacteria 176842
349 Ga0495686_0000824 3300047472 Bacteria 39973
350 Ga0495686_0025138 3300047472 Bacteria 3904
351 Ga0495686_0079161 3300047472 Bacteria 2010
352 Ga0495615_0000089 3300048090 Bacteria 27064
353 Ga0496101_0008714 3300048904 Bacteria 6633
354 Ga0496102_0000418 3300048905 Bacteria 49009
355 Ga0496103_0000274 3300048906 Bacteria 49009
356 Ga0496106_0005666 3300048909 Bacteria 9241
357 Ga0496107_0001352 3300048910 Bacteria 15070
358 Ga0496107_0015909 3300048910 Bacteria 5277
359 Ga0496108_0004188 3300048911 Bacteria 11616
360 Ga0496108_0199453 3300048911 Bacteria 1736
361 Ga0496110_0092190 3300048913 Bacteria 2711
362 Ga0496111_0084537 3300048914 Bacteria 2320
363 Ga0496113_0016558 3300048916 Bacteria 5095
364 Ga0496114_0005601 3300048917 Bacteria 9846
365 Ga0496114_0273468 3300048917 Bacteria 1489
366 Ga0496116_0000062 3300048919 Bacteria 271104
367 Ga0496116_0002304 3300048919 Bacteria 20241
368 Ga0496117_0000784 3300048920 Bacteria 49899
369 Ga0496117_0008687 3300048920 Bacteria 9603
370 Ga0496117_0019481 3300048920 Bacteria 5570
371 Ga0496117_0023475 3300048920 Bacteria 4912
372 Ga0496117_0030228 3300048920 Bacteria 4160
373 Ga0496117_0031444 3300048920 Bacteria 4051
374 Ga0496117_0072421 3300048920 Bacteria 2304
375 Ga0496118_0000863 3300048921 Bacteria 47989
376 Ga0496118_0002625 3300048921 Bacteria 23843
377 Ga0496118_0016556 3300048921 Bacteria 6760
378 Ga0496118_0031247 3300048921 Bacteria 4419
379 Ga0496118_0107538 3300048921 Bacteria 1862
380 Ga0496119_0069407 3300048922 Bacteria 2071
381 Ga0496119_0073783 3300048922 Bacteria 1989
382 Ga0496120_0041745 3300048923 Bacteria 2684
383 Ga0496121_0000175 3300048924 Bacteria 142910
384 Ga0496121_0002361 3300048924 Bacteria 29056
385 Ga0496121_0008917 3300048924 Bacteria 11643
386 Ga0496121_0012557 3300048924 Bacteria 9216
387 Ga0496122_0000579 3300048925 Bacteria 75073
388 Ga0496122_0002502 3300048925 Bacteria 25954
389 Ga0496122_0003999 3300048925 Bacteria 18795
390 Ga0496122_0014706 3300048925 Bacteria 7546
391 Ga0496122_0104179 3300048925 Bacteria 1886
392 Ga0496123_0000545 3300048926 Bacteria 64687
393 Ga0496123_0002498 3300048926 Bacteria 22653
394 Ga0496123_0004220 3300048926 Bacteria 15330
395 Ga0496123_0010591 3300048926 Bacteria 8117
396 Ga0496123_0068811 3300048926 Bacteria 2227
397 Ga0496124_0000846 3300048927 Bacteria 49899
398 Ga0496124_0058906 3300048927 Bacteria 3228
399 Ga0496125_0004105 3300048928 Bacteria 17024
400 Ga0496125_0015768 3300048928 Bacteria 7284
401 Ga0496125_0057631 3300048928 Bacteria 3144
402 Ga0496125_0194244 3300048928 Bacteria 1337
403 Ga0496126_0000801 3300048929 Bacteria 56279
404 Ga0496126_0002397 3300048929 Bacteria 25475
405 Ga0496126_0010916 3300048929 Bacteria 9463
406 Ga0496126_0016496 3300048929 Bacteria 7382
407 Ga0496126_0052606 3300048929 Bacteria 3700
408 Ga0495678_019280 3300049459 Bacteria 3047
409 Ga0495682_0054375 3300049460 Bacteria 1453
410 Ga0501290_000266 3300049513 Bacteria 8561
411 Ga0501292_000091 3300049515 Bacteria 16567
412 Ga0501294_001192 3300049517 Bacteria 2689
413 Ga0501047_0135405 3300049581 Bacteria 2344
414 Ga0501206_001364 3300049653 Bacteria 3056
415 Ga0501211_004606 3300049658 Bacteria 1399
416 Ga0501217_009851 3300049661 Bacteria 2085
417 Ga0501222_000240 3300049662 Bacteria 9412
418 Ga0501223_000012 3300049663 Bacteria 75953
419 Ga0501223_001355 3300049663 Bacteria 5669
420 Ga0501224_002628 3300049664 Bacteria 2464
421 Ga0501249_001127 3300049679 Bacteria 5635
422 Ga0501261_000114 3300049690 Bacteria 12152
423 Ga0501225_0000138 3300049705 Bacteria 22142
424 Ga0501279_000013 3300049775 Bacteria 78551
425 Ga0501280_000142 3300049776 Bacteria 18710
426 Ga0501281_00882 3300049777 Bacteria 2533
427 Ga0501282_000979 3300049778 Bacteria 3232
428 Ga0501044_0003279 3300049823 Bacteria 18222
429 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
430 nmdc:mga03n38_10695_c1 3300050490 Bacteria 3388
431 nmdc:mga00v17_1654_c1 3300050491 Bacteria 11615
432 nmdc:mga0yw44_60484_c1 3300050492 Bacteria 2321
433 nmdc:mga0k408_129927_c1 3300050493 Bacteria 1495
434 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
435 nmdc:mga06z11_271_c1 3300050494 Bacteria 20164
436 nmdc:mga04h51_240_c1 3300050495 Bacteria 14405
437 nmdc:mga04h51_86_c1 3300050495 Bacteria 28364
438 nmdc:mga07m45_102238_c1 3300050496 Bacteria 1646
439 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
440 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
441 nmdc:mga0sz30_594_c1 3300050516 Bacteria 13566
442 nmdc:mga0sz30_9847_c1 3300050516 Bacteria 3646
443 Ga0500643_000215 3300053087 Bacteria 54391
444 Ga0500643_000662 3300053087 Bacteria 23037
445 Ga0500643_009143 3300053087 Bacteria 3814
446 Ga0500643_016276 3300053087 Bacteria 2522
447 Ga0500651_0003100 3300053093 Bacteria 9004
448 Ga0500641_0025529 3300053096 Bacteria 2286
449 Ga0500555_000234 3300053103 Bacteria 24803
450 Ga0500562_002188 3300053108 Bacteria 4888
451 Ga0500614_004593 3300053123 Bacteria 2911
452 Ga0500642_0002386 3300053130 Bacteria 5502
453 Ga0500655_000307 3300053133 Bacteria 11138
454 Ga0500564_010219 3300053138 Bacteria 4109
455 Ga0500568_0003001 3300053139 Bacteria 9652
456 Ga0500577_0011973 3300053142 Bacteria 2607
457 Ga0500590_000114 3300053148 Bacteria 21825
458 Ga0500604_0000112 3300053151 Bacteria 24965
459 Ga0500616_0000261 3300053153 Bacteria 80995
460 Ga0500616_0003840 3300053153 Bacteria 11106
461 Ga0500622_0005652 3300053156 Bacteria 7452
462 Ga0500624_000130 3300053157 Bacteria 32645
463 Ga0500624_000208 3300053157 Bacteria 22150
464 Ga0500627_0000783 3300053158 Bacteria 8468
465 Ga0500637_0008262 3300053178 Bacteria 5240
466 Ga0500567_001612 3300053723 Bacteria 9237
467 Ga0500570_000053 3300053724 Bacteria 28643
468 Ga0500625_000009 3300053729 Bacteria 159296
469 Ga0500645_010769 3300053730 Bacteria 3009
470 Ga0466962_0148520 3300061719 Bacteria 1137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048923 Ga0496120_0041745 Ga0496120_0041745_19_1011 329
2 3300061719 Ga0466962_0148520 Ga0466962_0148520_41_1045 333
3 3300031731 Ga0307405_10052449 Ga0307405_100524492 361
4 3300031824 Ga0307413_10004882 Ga0307413_100048822 361
5 3300031995 Ga0307409_100089144 Ga0307409_1000891443 361
6 3300032004 Ga0307414_10112254 Ga0307414_101122541 361
7 3300032005 Ga0307411_10021320 Ga0307411_100213203 361
8 3300047472 Ga0495686_0000072 Ga0495686_0000072_204829_206007 366
9 3300046506 Ga0495583_0000201 Ga0495583_0000201_22801_23979 376
10 3300046691 Ga0495670_0012794 Ga0495670_0012794_1358_2536 376
11 3300046692 Ga0495671_0064939 Ga0495671_0064939_525_1703 376
12 3300047469 Ga0495673_0087723 Ga0495673_0087723_47_1225 376
13 3300048920 Ga0496117_0030228 Ga0496117_0030228_2073_3251 376
14 3300048926 Ga0496123_0068811 Ga0496123_0068811_110_1288 376
15 3300049460 Ga0495682_0054375 Ga0495682_0054375_55_1233 376
16 3300053103 Ga0500555_000234 Ga0500555_000234_5150_6328 376
17 iso_pu_bacteria 2818991438 2819552807 379
18 3300005616 Ga0068852_100009901 Ga0068852_10000990110 381
19 3300005841 Ga0068863_100080869 Ga0068863_1000808693 382
20 3300046537 Ga0495598_0006398 Ga0495598_0006398_912_2060 382
21 3300002459 JGI24751J29686_10001095 JGI24751J29686_100010953 383
22 3300005330 Ga0070690_100044613 Ga0070690_1000446132 383
23 3300005340 Ga0070689_100282872 Ga0070689_1002828721 383
24 3300005353 Ga0070669_100001971 Ga0070669_10000197112 383
25 3300005355 Ga0070671_100000040 Ga0070671_10000004065 383
26 3300005618 Ga0068864_100043079 Ga0068864_1000430793 383
27 3300005618 Ga0068864_100124232 Ga0068864_1001242322 383
28 3300025298 Ga0209050_1002950 Ga0209050_10029507 383
29 3300025931 Ga0207644_10000005 Ga0207644_10000005411 383
30 3300025936 Ga0207670_10086774 Ga0207670_100867743 383
31 3300026095 Ga0207676_10109071 Ga0207676_101090713 383
32 3300027876 Ga0209974_10009617 Ga0209974_100096173 383
33 3300028381 Ga0268264_10084102 Ga0268264_100841022 383
34 3300031548 Ga0307408_100107237 Ga0307408_1001072372 383
35 3300031731 Ga0307405_10002439 Ga0307405_100024399 383
36 3300031901 Ga0307406_10144718 Ga0307406_101447182 383
37 3300031903 Ga0307407_10026018 Ga0307407_100260184 383
38 3300031903 Ga0307407_10124603 Ga0307407_101246032 383
39 3300031911 Ga0307412_10013021 Ga0307412_100130214 383
40 3300031995 Ga0307409_100001426 Ga0307409_1000014267 383
41 3300032004 Ga0307414_10187562 Ga0307414_101875621 383
42 3300032005 Ga0307411_10061224 Ga0307411_100612242 383
43 3300032005 Ga0307411_10062328 Ga0307411_100623282 383
44 3300048090 Ga0495615_0000089 Ga0495615_0000089_16832_17998 383
45 3300048904 Ga0496101_0008714 Ga0496101_0008714_1640_2818 383
46 3300048909 Ga0496106_0005666 Ga0496106_0005666_6702_7880 383
47 3300048910 Ga0496107_0001352 Ga0496107_0001352_586_1764 383
48 3300048911 Ga0496108_0199453 Ga0496108_0199453_523_1701 383
49 3300048916 Ga0496113_0016558 Ga0496113_0016558_569_1747 383
50 3300048917 Ga0496114_0273468 Ga0496114_0273468_64_1242 383
51 3300048919 Ga0496116_0000062 Ga0496116_0000062_251487_252638 383
52 3300048920 Ga0496117_0031444 Ga0496117_0031444_2521_3672 383
53 3300048924 Ga0496121_0008917 Ga0496121_0008917_1492_2643 383
54 3300048925 Ga0496122_0002502 Ga0496122_0002502_15451_16602 383
55 3300048925 Ga0496122_0003999 Ga0496122_0003999_10040_11206 383
56 3300048926 Ga0496123_0000545 Ga0496123_0000545_18483_19634 383
57 3300048926 Ga0496123_0002498 Ga0496123_0002498_18359_19525 383
58 3300048928 Ga0496125_0015768 Ga0496125_0015768_130_1281 383
59 3300048929 Ga0496126_0000801 Ga0496126_0000801_10449_11600 383
60 3300049661 Ga0501217_009851 Ga0501217_009851_264_1415 383
61 3300049679 Ga0501249_001127 Ga0501249_001127_369_1520 383
62 3300053096 Ga0500641_0025529 Ga0500641_0025529_20_1174 383
63 iso_pu_bacteria 8054302542 8054303075 383
64 3300001990 JGI24737J22298_10010515 JGI24737J22298_100105151 384
65 3300005578 Ga0068854_100015612 Ga0068854_1000156123 384
66 3300006042 Ga0075368_10000222 Ga0075368_1000022211 384
67 3300006048 Ga0075363_100001640 Ga0075363_1000016408 384
68 3300006051 Ga0075364_10007289 Ga0075364_100072898 384
69 3300006051 Ga0075364_10045807 Ga0075364_100458072 384
70 3300006177 Ga0075362_10000003 Ga0075362_10000003148 384
71 3300006177 Ga0075362_10110905 Ga0075362_101109051 384
72 3300006178 Ga0075367_10010066 Ga0075367_100100664 384
73 3300006186 Ga0075369_10008733 Ga0075369_100087333 384
74 3300006186 Ga0075369_10010465 Ga0075369_100104654 384
75 3300006186 Ga0075369_10029858 Ga0075369_100298583 384
76 3300006195 Ga0075366_10000006 Ga0075366_1000000624 384
77 3300006195 Ga0075366_10002562 Ga0075366_100025625 384
78 3300006353 Ga0075370_10000008 Ga0075370_1000000868 384
79 3300025981 Ga0207640_10007773 Ga0207640_100077734 384
80 3300026116 Ga0207674_10193448 Ga0207674_101934482 384
81 3300027866 Ga0209813_10000278 Ga0209813_1000027810 384
82 3300050489 nmdc:mga03683_13_c1 nmdc:mga03683_13_c1_63954_65108 384
83 3300050490 nmdc:mga03n38_10695_c1 nmdc:mga03n38_10695_c1_1982_3136 384
84 3300050491 nmdc:mga00v17_1654_c1 nmdc:mga00v17_1654_c1_5168_6337 384
85 3300050492 nmdc:mga0yw44_60484_c1 nmdc:mga0yw44_60484_c1_69_1238 384
86 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_74300_75454 384
87 3300050495 nmdc:mga04h51_240_c1 nmdc:mga04h51_240_c1_7355_8524 384
88 3300050496 nmdc:mga07m45_20_c1 nmdc:mga07m45_20_c1_32602_33756 384
89 3300050496 nmdc:mga07m45_33_c1 nmdc:mga07m45_33_c1_41016_42185 384
90 3300050516 nmdc:mga0sz30_594_c1 nmdc:mga0sz30_594_c1_2186_3355 384
91 3300050516 nmdc:mga0sz30_9847_c1 nmdc:mga0sz30_9847_c1_1980_3134 384
92 3300053138 Ga0500564_010219 Ga0500564_010219_2361_3557 384
93 3300053723 Ga0500567_001612 Ga0500567_001612_6061_7257 384
94 3300053729 Ga0500625_000009 Ga0500625_000009_76172_77368 384
95 3300053730 Ga0500645_010769 Ga0500645_010769_1076_2230 384
96 3300005367 Ga0070667_100200546 Ga0070667_1002005462 385
97 3300005617 Ga0068859_100003831 Ga0068859_10000383113 385
98 3300005842 Ga0068858_100000840 Ga0068858_10000084030 385
99 3300006353 Ga0075370_10065111 Ga0075370_100651112 385
100 3300006931 Ga0097620_100003831 Ga0097620_1000038313 385
101 3300009177 Ga0105248_10077247 Ga0105248_100772473 385
102 3300013306 Ga0163162_10071331 Ga0163162_100713313 385
103 3300025931 Ga0207644_10040726 Ga0207644_100407263 385
104 3300026035 Ga0207703_10020134 Ga0207703_100201344 385
105 3300026035 Ga0207703_10283817 Ga0207703_102838172 385
106 3300031616 Ga0307508_10006877 Ga0307508_100068773 385
107 3300031824 Ga0307413_10028229 Ga0307413_100282293 385
108 3300031995 Ga0307409_100064763 Ga0307409_1000647632 385
109 3300048929 Ga0496126_0002397 Ga0496126_0002397_14978_16153 385
110 3300049581 Ga0501047_0135405 Ga0501047_0135405_904_2061 385
111 3300049658 Ga0501211_004606 Ga0501211_004606_16_1194 385
112 3300049823 Ga0501044_0003279 Ga0501044_0003279_15338_16495 385
113 3300050496 nmdc:mga07m45_102238_c1 nmdc:mga07m45_102238_c1_404_1567 385
114 iso_pu_bacteria 2739367664 2739649341 385
115 iso_pu_bacteria 2739367865 2740027814 385
116 3300001904 JGI24736J21556_1004017 JGI24736J21556_10040172 386
117 3300001915 JGI24741J21665_1000307 JGI24741J21665_10003071 386
118 3300001979 JGI24740J21852_10001337 JGI24740J21852_100013379 386
119 3300001989 JGI24739J22299_10000514 JGI24739J22299_1000051413 386
120 3300001990 JGI24737J22298_10000970 JGI24737J22298_100009704 386
121 3300002067 JGI24735J21928_10001484 JGI24735J21928_100014844 386
122 3300005327 Ga0070658_10094125 Ga0070658_100941253 386
123 3300005339 Ga0070660_100070659 Ga0070660_1000706591 386
124 3300005366 Ga0070659_100036157 Ga0070659_1000361574 386
125 3300005563 Ga0068855_100068478 Ga0068855_1000684781 386
126 3300005564 Ga0070664_100002181 Ga0070664_10000218114 386
127 3300005577 Ga0068857_100100990 Ga0068857_1001009903 386
128 3300005614 Ga0068856_100066801 Ga0068856_1000668014 386
129 3300009093 Ga0105240_10117997 Ga0105240_101179973 386
130 3300009174 Ga0105241_10005295 Ga0105241_100052956 386
131 3300013100 Ga0157373_10031372 Ga0157373_100313724 386
132 3300013102 Ga0157371_10075019 Ga0157371_100750191 386
133 3300013104 Ga0157370_10054341 Ga0157370_100543412 386
134 3300025321 Ga0207656_10039678 Ga0207656_100396782 386
135 3300025904 Ga0207647_10016178 Ga0207647_100161784 386
136 3300025911 Ga0207654_10052755 Ga0207654_100527552 386
137 3300025913 Ga0207695_10046400 Ga0207695_100464005 386
138 3300025919 Ga0207657_10037723 Ga0207657_100377231 386
139 3300025924 Ga0207694_10066757 Ga0207694_100667573 386
140 3300025932 Ga0207690_10108726 Ga0207690_101087263 386
141 3300025933 Ga0207706_10041782 Ga0207706_100417824 386
142 3300026041 Ga0207639_10002552 Ga0207639_100025529 386
143 3300026067 Ga0207678_10000801 Ga0207678_1000080126 386
144 3300026116 Ga0207674_10045090 Ga0207674_100450903 386
145 3300026142 Ga0207698_10028974 Ga0207698_100289743 386
146 3300031852 Ga0307410_10008094 Ga0307410_100080943 386
147 iso_pu_bacteria 2582581305 2585260944 387
148 3300005353 Ga0070669_100188919 Ga0070669_1001889192 388
149 3300005844 Ga0068862_100004564 Ga0068862_1000045649 388
150 3300025923 Ga0207681_10131029 Ga0207681_101310291 388
151 3300025941 Ga0207711_10045369 Ga0207711_100453695 388
152 3300028379 Ga0268266_10052837 Ga0268266_100528371 388
153 3300028380 Ga0268265_10009354 Ga0268265_100093544 388
154 3300031911 Ga0307412_10077602 Ga0307412_100776022 388
155 3300032002 Ga0307416_100137072 Ga0307416_1001370722 388
156 3300032004 Ga0307414_10080724 Ga0307414_100807242 388
157 3300048920 Ga0496117_0072421 Ga0496117_0072421_608_1792 388
158 3300048921 Ga0496118_0000863 Ga0496118_0000863_2166_3350 388
159 iso_pu_bacteria 2512564014 2512641879 388
160 iso_pu_bacteria 2775507255 2778123788 388
161 iso_pu_bacteria 2808606401 2809064673 388
162 iso_pu_bacteria 2808606404 2809080658 388
163 iso_pu_bacteria 2808606405 2809085023 388
164 iso_pu_bacteria 2880518877 2880519565 388
165 iso_pu_bacteria 2919709256 2919711566 388
166 3300005563 Ga0068855_100012555 Ga0068855_1000125552 390
167 3300010375 Ga0105239_10332082 Ga0105239_103320821 390
168 3300025949 Ga0207667_10013468 Ga0207667_1001346810 390
169 3300001915 JGI24741J21665_1009260 JGI24741J21665_10092602 391
170 3300001989 JGI24739J22299_10010653 JGI24739J22299_100106534 391
171 3300001989 JGI24739J22299_10012450 JGI24739J22299_100124503 391
172 3300001989 JGI24739J22299_10014082 JGI24739J22299_100140822 391
173 3300001990 JGI24737J22298_10002852 JGI24737J22298_100028528 391
174 3300002067 JGI24735J21928_10006017 JGI24735J21928_100060175 391
175 3300002067 JGI24735J21928_10006400 JGI24735J21928_100064003 391
176 3300002067 JGI24735J21928_10028455 JGI24735J21928_100284552 391
177 3300002075 JGI24738J21930_10000862 JGI24738J21930_1000086216 391
178 3300003214 JGI25165J46597_1000094 JGI25165J46597_1000094144 391
179 3300003762 Ga0055542_1002618 Ga0055542_10026188 391
180 3300005327 Ga0070658_10000106 Ga0070658_1000010630 391
181 3300005327 Ga0070658_10009822 Ga0070658_100098222 391
182 3300005327 Ga0070658_10019070 Ga0070658_100190708 391
183 3300005328 Ga0070676_10000539 Ga0070676_100005393 391
184 3300005328 Ga0070676_10040355 Ga0070676_100403553 391
185 3300005335 Ga0070666_10105967 Ga0070666_101059671 391
186 3300005338 Ga0068868_100000016 Ga0068868_10000001660 391
187 3300005339 Ga0070660_100012845 Ga0070660_1000128454 391
188 3300005339 Ga0070660_100024388 Ga0070660_1000243882 391
189 3300005339 Ga0070660_100093126 Ga0070660_1000931262 391
190 3300005339 Ga0070660_100186185 Ga0070660_1001861852 391
191 3300005347 Ga0070668_100000145 Ga0070668_10000014510 391
192 3300005353 Ga0070669_100098706 Ga0070669_1000987062 391
193 3300005354 Ga0070675_100006402 Ga0070675_1000064028 391
194 3300005356 Ga0070674_100010143 Ga0070674_1000101432 391
195 3300005364 Ga0070673_100000017 Ga0070673_10000001796 391
196 3300005366 Ga0070659_100310848 Ga0070659_1003108481 391
197 3300005367 Ga0070667_100000013 Ga0070667_100000013190 391
198 3300005455 Ga0070663_100000796 Ga0070663_1000007967 391
199 3300005456 Ga0070678_100006441 Ga0070678_1000064415 391
200 3300005457 Ga0070662_100020051 Ga0070662_1000200515 391
201 3300005457 Ga0070662_100020694 Ga0070662_1000206945 391
202 3300005457 Ga0070662_100030726 Ga0070662_1000307263 391
203 3300005457 Ga0070662_100246498 Ga0070662_1002464981 391
204 3300005459 Ga0068867_100000013 Ga0068867_10000001396 391
205 3300005539 Ga0068853_100018243 Ga0068853_1000182435 391
206 3300005539 Ga0068853_100068094 Ga0068853_1000680942 391
207 3300005544 Ga0070686_100001769 Ga0070686_10000176914 391
208 3300005563 Ga0068855_100001357 Ga0068855_10000135723 391
209 3300005563 Ga0068855_100163259 Ga0068855_1001632592 391
210 3300005564 Ga0070664_100299502 Ga0070664_1002995021 391
211 3300005577 Ga0068857_100031947 Ga0068857_1000319476 391
212 3300005578 Ga0068854_100004495 Ga0068854_10000449511 391
213 3300005614 Ga0068856_100109461 Ga0068856_1001094614 391
214 3300005614 Ga0068856_100157868 Ga0068856_1001578681 391
215 3300005841 Ga0068863_100000210 Ga0068863_10000021057 391
216 3300005843 Ga0068860_100113115 Ga0068860_1001131152 391
217 3300006195 Ga0075366_10124410 Ga0075366_101244102 391
218 3300006237 Ga0097621_100042519 Ga0097621_1000425192 391
219 3300006358 Ga0068871_100046305 Ga0068871_1000463052 391
220 3300006871 Ga0075434_100115707 Ga0075434_1001157072 391
221 3300006881 Ga0068865_100000007 Ga0068865_100000007124 391
222 3300006931 Ga0097620_100052258 Ga0097620_1000522582 391
223 3300009093 Ga0105240_10038107 Ga0105240_100381075 391
224 3300009093 Ga0105240_10133605 Ga0105240_101336053 391
225 3300009098 Ga0105245_10001117 Ga0105245_1000111710 391
226 3300009148 Ga0105243_10000118 Ga0105243_100001189 391
227 3300009176 Ga0105242_10000196 Ga0105242_1000019627 391
228 3300009551 Ga0105238_10046443 Ga0105238_100464434 391
229 3300009553 Ga0105249_10030391 Ga0105249_100303914 391
230 3300010375 Ga0105239_10081502 Ga0105239_100815024 391
231 3300011119 Ga0105246_10000313 Ga0105246_1000031315 391
232 3300011119 Ga0105246_10191650 Ga0105246_101916502 391
233 3300013100 Ga0157373_10061752 Ga0157373_100617522 391
234 3300013104 Ga0157370_10000692 Ga0157370_1000069221 391
235 3300013105 Ga0157369_10249001 Ga0157369_102490011 391
236 3300013296 Ga0157374_10000189 Ga0157374_1000018956 391
237 3300013297 Ga0157378_10000264 Ga0157378_1000026453 391
238 3300013307 Ga0157372_10282590 Ga0157372_102825902 391
239 3300013308 Ga0157375_10000436 Ga0157375_100004369 391
240 3300014745 Ga0157377_10006746 Ga0157377_100067462 391
241 3300014969 Ga0157376_10000081 Ga0157376_1000008127 391
242 3300020070 Ga0206356_11637029 Ga0206356_116370292 391
243 3300025231 Ga0207427_100465 Ga0207427_10046516 391
244 3300025254 Ga0209148_1000074 Ga0209148_1000074113 391
245 3300025254 Ga0209148_1002092 Ga0209148_10020922 391
246 3300025261 Ga0209233_1000003 Ga0209233_10000031423 391
247 3300025272 Ga0209455_1000852 Ga0209455_100085221 391
248 3300025904 Ga0207647_10002587 Ga0207647_1000258722 391
249 3300025904 Ga0207647_10012237 Ga0207647_100122376 391
250 3300025904 Ga0207647_10021047 Ga0207647_100210473 391
251 3300025904 Ga0207647_10025797 Ga0207647_100257975 391
252 3300025904 Ga0207647_10121026 Ga0207647_101210262 391
253 3300025907 Ga0207645_10009653 Ga0207645_100096535 391
254 3300025907 Ga0207645_10076059 Ga0207645_100760592 391
255 3300025909 Ga0207705_10000078 Ga0207705_10000078102 391
256 3300025909 Ga0207705_10000110 Ga0207705_1000011089 391
257 3300025909 Ga0207705_10009992 Ga0207705_100099922 391
258 3300025909 Ga0207705_10159254 Ga0207705_101592541 391
259 3300025913 Ga0207695_10027264 Ga0207695_100272646 391
260 3300025919 Ga0207657_10001650 Ga0207657_100016504 391
261 3300025919 Ga0207657_10002766 Ga0207657_1000276626 391
262 3300025919 Ga0207657_10057666 Ga0207657_100576662 391
263 3300025920 Ga0207649_10206360 Ga0207649_102063601 391
264 3300025926 Ga0207659_10010728 Ga0207659_100107283 391
265 3300025927 Ga0207687_10001736 Ga0207687_100017369 391
266 3300025932 Ga0207690_10011899 Ga0207690_100118996 391
267 3300025932 Ga0207690_10031506 Ga0207690_100315064 391
268 3300025933 Ga0207706_10006922 Ga0207706_100069222 391
269 3300025933 Ga0207706_10030960 Ga0207706_100309603 391
270 3300025933 Ga0207706_10195360 Ga0207706_101953602 391
271 3300025934 Ga0207686_10000260 Ga0207686_1000026026 391
272 3300025935 Ga0207709_10000156 Ga0207709_1000015628 391
273 3300025938 Ga0207704_10000017 Ga0207704_1000001766 391
274 3300025940 Ga0207691_10050421 Ga0207691_100504213 391
275 3300025941 Ga0207711_10019816 Ga0207711_100198167 391
276 3300025942 Ga0207689_10001764 Ga0207689_100017643 391
277 3300025949 Ga0207667_10000071 Ga0207667_1000007136 391
278 3300025949 Ga0207667_10098275 Ga0207667_100982754 391
279 3300025960 Ga0207651_10000011 Ga0207651_1000001168 391
280 3300025961 Ga0207712_10061984 Ga0207712_100619842 391
281 3300025972 Ga0207668_10000063 Ga0207668_1000006380 391
282 3300025981 Ga0207640_10000067 Ga0207640_1000006761 391
283 3300025986 Ga0207658_10000040 Ga0207658_1000004080 391
284 3300026023 Ga0207677_10000173 Ga0207677_1000017335 391
285 3300026041 Ga0207639_10014604 Ga0207639_100146043 391
286 3300026067 Ga0207678_10006666 Ga0207678_100066667 391
287 3300026067 Ga0207678_10113726 Ga0207678_101137262 391
288 3300026067 Ga0207678_10337310 Ga0207678_103373101 391
289 3300026078 Ga0207702_10064189 Ga0207702_100641893 391
290 3300026078 Ga0207702_10126882 Ga0207702_101268821 391
291 3300026088 Ga0207641_10000178 Ga0207641_1000017880 391
292 3300026088 Ga0207641_10012755 Ga0207641_100127554 391
293 3300026089 Ga0207648_10000045 Ga0207648_1000004526 391
294 3300026116 Ga0207674_10111235 Ga0207674_101112353 391
295 3300026121 Ga0207683_10002781 Ga0207683_1000278123 391
296 3300026142 Ga0207698_10014302 Ga0207698_100143026 391
297 3300028381 Ga0268264_10281378 Ga0268264_102813782 391
298 3300035112 Ga0373932_0028928 Ga0373932_0028928_93_1271 391
299 3300037068 Ga0373925_0108116 Ga0373925_0108116_932_2110 391
300 3300037312 Ga0395899_0003161 Ga0395899_0003161_6668_7846 391
301 3300037418 Ga0395900_0069180 Ga0395900_0069180_1388_2566 391
302 3300037471 Ga0395905_0061106 Ga0395905_0061106_1477_2655 391
303 3300038443 Ga0395901_0033334 Ga0395901_0033334_3823_5001 391
304 3300039437 Ga0436365_1583798 Ga0436365_1583798_32_1351 391
305 3300041462 Ga0451806_197249 Ga0451806_197249_11_1189 391
306 3300042005 Ga0439448_0000316 Ga0439448_0000316_522_1700 391
307 3300042005 Ga0439448_0021031 Ga0439448_0021031_278_1456 391
308 3300042157 Ga0439458_0001569 Ga0439458_0001569_1389_2567 391
309 3300044658 Ga0466972_0001992 Ga0466972_0001992_6147_7325 391
310 3300044693 Ga0466961_0006506 Ga0466961_0006506_3857_5035 391
311 3300044694 Ga0466963_0053736 Ga0466963_0053736_1275_2453 391
312 3300044706 Ga0466964_0005354 Ga0466964_0005354_2943_4121 391
313 3300044719 Ga0466971_0013596 Ga0466971_0013596_1768_2946 391
314 3300044765 Ga0466970_0001267 Ga0466970_0001267_3682_4860 391
315 3300044842 Ga0466957_0018982 Ga0466957_0018982_551_1729 391
316 3300044842 Ga0466957_0072532 Ga0466957_0072532_77_1255 391
317 3300044901 Ga0466960_0009650 Ga0466960_0009650_322_1500 391
318 3300045049 Ga0466959_0001787 Ga0466959_0001787_10536_11714 391
319 3300045836 Ga0466958_0025126 Ga0466958_0025126_2128_3306 391
320 3300045976 Ga0466967_0229453 Ga0466967_0229453_290_1468 391
321 3300046471 Ga0495650_0022633 Ga0495650_0022633_767_1945 391
322 3300046507 Ga0495606_0000443 Ga0495606_0000443_36325_37503 391
323 3300046522 Ga0495643_0009291 Ga0495643_0009291_2816_4099 391
324 3300046522 Ga0495643_0030261 Ga0495643_0030261_1251_2474 391
325 3300047472 Ga0495686_0000824 Ga0495686_0000824_30222_31400 391
326 3300047472 Ga0495686_0079161 Ga0495686_0079161_563_1741 391
327 3300048925 Ga0496122_0000579 Ga0496122_0000579_6057_7235 391
328 3300048926 Ga0496123_0004220 Ga0496123_0004220_9476_10654 391
329 3300048928 Ga0496125_0057631 Ga0496125_0057631_1182_2396 391
330 3300048928 Ga0496125_0194244 Ga0496125_0194244_19_1197 391
331 3300050493 nmdc:mga0k408_129927_c1 nmdc:mga0k408_129927_c1_125_1303 391
332 3300053087 Ga0500643_009143 Ga0500643_009143_2000_3214 391
333 3300053093 Ga0500651_0003100 Ga0500651_0003100_1817_3100 391
334 3300053123 Ga0500614_004593 Ga0500614_004593_243_1526 391
335 3300053130 Ga0500642_0002386 Ga0500642_0002386_2419_3702 391
336 3300053133 Ga0500655_000307 Ga0500655_000307_4896_6179 391
337 3300053142 Ga0500577_0011973 Ga0500577_0011973_589_1872 391
338 3300053148 Ga0500590_000114 Ga0500590_000114_16592_17875 391
339 3300053153 Ga0500616_0003840 Ga0500616_0003840_7235_8413 391
340 3300053156 Ga0500622_0005652 Ga0500622_0005652_2748_4031 391
341 3300053724 Ga0500570_000053 Ga0500570_000053_10934_12217 391
342 2162886007 SwRhRL2b_contig_1598334 SwRhRL2b_0713.00005530 392
343 3300005336 Ga0070680_100001995 Ga0070680_10000199513 392
344 3300005338 Ga0068868_100000011 Ga0068868_10000001136 392
345 3300005339 Ga0070660_100004283 Ga0070660_1000042838 392
346 3300005339 Ga0070660_100021624 Ga0070660_1000216242 392
347 3300005344 Ga0070661_100000543 Ga0070661_1000005433 392
348 3300005347 Ga0070668_100057277 Ga0070668_1000572772 392
349 3300005347 Ga0070668_100065236 Ga0070668_1000652363 392
350 3300005366 Ga0070659_100000376 Ga0070659_10000037636 392
351 3300005367 Ga0070667_100000076 Ga0070667_10000007661 392
352 3300005458 Ga0070681_10073101 Ga0070681_100731012 392
353 3300005530 Ga0070679_100000007 Ga0070679_100000007162 392
354 3300005543 Ga0070672_100174496 Ga0070672_1001744962 392
355 3300005548 Ga0070665_100210929 Ga0070665_1002109293 392
356 3300005578 Ga0068854_100006076 Ga0068854_1000060768 392
357 3300005841 Ga0068863_100114569 Ga0068863_1001145692 392
358 3300005843 Ga0068860_100000131 Ga0068860_10000013146 392
359 3300006042 Ga0075368_10002540 Ga0075368_100025408 392
360 3300006178 Ga0075367_10000600 Ga0075367_1000060017 392
361 3300009093 Ga0105240_10001847 Ga0105240_100018473 392
362 3300009093 Ga0105240_10032183 Ga0105240_100321835 392
363 3300009098 Ga0105245_10069692 Ga0105245_100696923 392
364 3300009098 Ga0105245_10158143 Ga0105245_101581432 392
365 3300009545 Ga0105237_10001035 Ga0105237_1000103528 392
366 3300009978 Ga0105148_100022 Ga0105148_10002210 392
367 3300010375 Ga0105239_10000025 Ga0105239_1000002572 392
368 3300013308 Ga0157375_10002721 Ga0157375_1000272113 392
369 3300013308 Ga0157375_10058557 Ga0157375_100585574 392
370 3300017792 Ga0163161_10005605 Ga0163161_100056058 392
371 3300025229 Ga0209147_100977 Ga0209147_1009779 392
372 3300025903 Ga0207680_10031503 Ga0207680_100315033 392
373 3300025912 Ga0207707_10021232 Ga0207707_100212325 392
374 3300025913 Ga0207695_10038786 Ga0207695_100387864 392
375 3300025914 Ga0207671_10015085 Ga0207671_100150855 392
376 3300025917 Ga0207660_10001628 Ga0207660_1000162813 392
377 3300025919 Ga0207657_10013560 Ga0207657_100135602 392
378 3300025919 Ga0207657_10045189 Ga0207657_100451893 392
379 3300025920 Ga0207649_10000074 Ga0207649_100000744 392
380 3300025921 Ga0207652_10000001 Ga0207652_10000001749 392
381 3300025927 Ga0207687_10048349 Ga0207687_100483492 392
382 3300025927 Ga0207687_10052264 Ga0207687_100522643 392
383 3300025932 Ga0207690_10000001 Ga0207690_10000001582 392
384 3300025932 Ga0207690_10000002 Ga0207690_10000002582 392
385 3300025932 Ga0207690_10000003 Ga0207690_10000003582 392
386 3300025932 Ga0207690_10000004 Ga0207690_10000004582 392
387 3300025940 Ga0207691_10218196 Ga0207691_102181962 392
388 3300025960 Ga0207651_10127474 Ga0207651_101274742 392
389 3300025986 Ga0207658_10000094 Ga0207658_1000009444 392
390 3300026023 Ga0207677_10000217 Ga0207677_1000021710 392
391 3300026088 Ga0207641_10025385 Ga0207641_100253851 392
392 3300027866 Ga0209813_10000174 Ga0209813_1000017417 392
393 3300028381 Ga0268264_10000204 Ga0268264_1000020444 392
394 3300030732 Ga0316176_1002165 Ga0316176_10021652 392
395 3300030736 Ga0316180_1083064 Ga0316180_10830643 392
396 3300030745 Ga0316182_1074158 Ga0316182_10741582 392
397 3300031548 Ga0307408_100016733 Ga0307408_1000167333 392
398 3300031731 Ga0307405_10032182 Ga0307405_100321822 392
399 3300031901 Ga0307406_10004932 Ga0307406_100049322 392
400 3300031911 Ga0307412_10088098 Ga0307412_100880982 392
401 3300032004 Ga0307414_10123466 Ga0307414_101234663 392
402 3300032005 Ga0307411_10049133 Ga0307411_100491332 392
403 3300038443 Ga0395901_0013811 Ga0395901_0013811_6731_7912 392
404 3300046452 Ga0495617_009620 Ga0495617_009620_602_1780 392
405 3300046453 Ga0495627_000079 Ga0495627_000079_21646_22824 392
406 3300046453 Ga0495627_013112 Ga0495627_013112_759_1937 392
407 3300046512 Ga0495610_0000095 Ga0495610_0000095_59260_60438 392
408 3300046513 Ga0495616_0000030 Ga0495616_0000030_104523_105701 392
409 3300046519 Ga0495632_0005348 Ga0495632_0005348_688_1866 392
410 3300046520 Ga0495637_0003789 Ga0495637_0003789_5412_6590 392
411 3300046522 Ga0495643_0000014 Ga0495643_0000014_40264_41442 392
412 3300046524 Ga0495648_0032372 Ga0495648_0032372_177_1355 392
413 3300046524 Ga0495648_0056424 Ga0495648_0056424_1159_2337 392
414 3300046525 Ga0495663_0000007 Ga0495663_0000007_41033_42211 392
415 3300046558 Ga0495633_0000487 Ga0495633_0000487_16312_17490 392
416 3300046558 Ga0495633_0000818 Ga0495633_0000818_1540_2718 392
417 3300046558 Ga0495633_0017648 Ga0495633_0017648_907_2085 392
418 3300046558 Ga0495633_0073943 Ga0495633_0073943_114_1292 392
419 3300046616 Ga0495668_0006455 Ga0495668_0006455_4924_6102 392
420 3300046692 Ga0495671_0000058 Ga0495671_0000058_40264_41442 392
421 3300047469 Ga0495673_0031160 Ga0495673_0031160_856_2034 392
422 3300047470 Ga0495681_0000008 Ga0495681_0000008_134114_135292 392
423 3300047472 Ga0495686_0000103 Ga0495686_0000103_170653_171876 392
424 3300047472 Ga0495686_0025138 Ga0495686_0025138_981_2159 392
425 3300048905 Ga0496102_0000418 Ga0496102_0000418_18338_19519 392
426 3300048906 Ga0496103_0000274 Ga0496103_0000274_18338_19519 392
427 3300048910 Ga0496107_0015909 Ga0496107_0015909_28_1242 392
428 3300048911 Ga0496108_0004188 Ga0496108_0004188_6198_7376 392
429 3300048913 Ga0496110_0092190 Ga0496110_0092190_1199_2377 392
430 3300048914 Ga0496111_0084537 Ga0496111_0084537_344_1522 392
431 3300048917 Ga0496114_0005601 Ga0496114_0005601_7006_8220 392
432 3300048919 Ga0496116_0002304 Ga0496116_0002304_18338_19519 392
433 3300048920 Ga0496117_0000784 Ga0496117_0000784_29491_30672 392
434 3300048920 Ga0496117_0008687 Ga0496117_0008687_7431_8609 392
435 3300048920 Ga0496117_0019481 Ga0496117_0019481_3481_4662 392
436 3300048920 Ga0496117_0023475 Ga0496117_0023475_2436_3644 392
437 3300048921 Ga0496118_0002625 Ga0496118_0002625_4325_5506 392
438 3300048921 Ga0496118_0016556 Ga0496118_0016556_2313_3521 392
439 3300048921 Ga0496118_0031247 Ga0496118_0031247_2235_3413 392
440 3300048921 Ga0496118_0107538 Ga0496118_0107538_33_1214 392
441 3300048922 Ga0496119_0069407 Ga0496119_0069407_52_1233 392
442 3300048922 Ga0496119_0073783 Ga0496119_0073783_177_1400 392
443 3300048924 Ga0496121_0000175 Ga0496121_0000175_43088_44266 392
444 3300048924 Ga0496121_0002361 Ga0496121_0002361_4941_6152 392
445 3300048924 Ga0496121_0012557 Ga0496121_0012557_5370_6581 392
446 3300048925 Ga0496122_0014706 Ga0496122_0014706_5044_6225 392
447 3300048925 Ga0496122_0104179 Ga0496122_0104179_233_1411 392
448 3300048926 Ga0496123_0010591 Ga0496123_0010591_3067_4248 392
449 3300048927 Ga0496124_0000846 Ga0496124_0000846_29491_30672 392
450 3300048927 Ga0496124_0058906 Ga0496124_0058906_1183_2361 392
451 3300048928 Ga0496125_0004105 Ga0496125_0004105_13513_14694 392
452 3300048929 Ga0496126_0010916 Ga0496126_0010916_1887_3098 392
453 3300048929 Ga0496126_0016496 Ga0496126_0016496_2981_4159 392
454 3300048929 Ga0496126_0052606 Ga0496126_0052606_1409_2590 392
455 3300049459 Ga0495678_019280 Ga0495678_019280_286_1464 392
456 3300049513 Ga0501290_000266 Ga0501290_000266_6429_7610 392
457 3300049515 Ga0501292_000091 Ga0501292_000091_7301_8482 392
458 3300049517 Ga0501294_001192 Ga0501294_001192_453_1634 392
459 3300049653 Ga0501206_001364 Ga0501206_001364_1040_2221 392
460 3300049662 Ga0501222_000240 Ga0501222_000240_959_2140 392
461 3300049663 Ga0501223_000012 Ga0501223_000012_40979_42157 392
462 3300049663 Ga0501223_001355 Ga0501223_001355_1141_2322 392
463 3300049664 Ga0501224_002628 Ga0501224_002628_130_1311 392
464 3300049690 Ga0501261_000114 Ga0501261_000114_2867_4048 392
465 3300049705 Ga0501225_0000138 Ga0501225_0000138_8059_9237 392
466 3300049775 Ga0501279_000013 Ga0501279_000013_72792_73973 392
467 3300049776 Ga0501280_000142 Ga0501280_000142_7531_8712 392
468 3300049777 Ga0501281_00882 Ga0501281_00882_946_2127 392
469 3300049778 Ga0501282_000979 Ga0501282_000979_1123_2304 392
470 3300050494 nmdc:mga06z11_271_c1 nmdc:mga06z11_271_c1_16282_17460 392
471 3300050495 nmdc:mga04h51_86_c1 nmdc:mga04h51_86_c1_16283_17461 392
472 3300053087 Ga0500643_000215 Ga0500643_000215_49570_50751 392
473 3300053087 Ga0500643_000662 Ga0500643_000662_16012_17226 392
474 3300053087 Ga0500643_016276 Ga0500643_016276_1026_2207 392
475 3300053108 Ga0500562_002188 Ga0500562_002188_269_1447 392
476 3300053139 Ga0500568_0003001 Ga0500568_0003001_7628_8944 392
477 3300053151 Ga0500604_0000112 Ga0500604_0000112_6882_8156 392
478 3300053153 Ga0500616_0000261 Ga0500616_0000261_8147_9463 392
479 3300053157 Ga0500624_000130 Ga0500624_000130_11257_12435 392
480 3300053157 Ga0500624_000208 Ga0500624_000208_17049_18230 392
481 3300053158 Ga0500627_0000783 Ga0500627_0000783_1037_2215 392
482 3300053178 Ga0500637_0008262 Ga0500637_0008262_139_1320 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

70

237

0.97

PF00534

Glycos_transf_1

Glycosyl transferases group 1

244

405

0.95

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

71

225

0.92

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

276

421

0.91

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

257

393

0.91

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

236

420

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8512 207 360
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.8303 6 376
5d00-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.8285 5 376
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.8274 6 379
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.824 6 376
ID Description Score Start End Superfamily
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9147 193 356 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9114 206 358 3.40.50.2000
af_Q9SSP6_536_651_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9099 274 358 3.40.50.2000
af_A0A0R0J9M2_157_335_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8977 187 364 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8975 197 356 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7C3D0H1-F1-model_v4 Glycosyltransferase family 1 protein 0.9268 198 378 GO:0016757
AF-A0A3C0DUB0-F1-model_v4 Glycosyl transferase group 1 0.9259 136 377 GO:0016757
AF-A0A2S8M679-F1-model_v4 deleted 0.9227 265 380
AF-A0A7X6A563-F1-model_v4 Phosphatidylinositol alpha 1,6-mannosyltransferase (EC 2.4.1.-) 0.9212 6 383 GO:0009058
GO:0016758
AF-A0A7C6JGE3-F1-model_v4 Glycosyltransferase family 4 protein 0.9162 8 383 GO:0016757

Feature Viewer

pLDDT pTM Quality
87.86 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map