F452497

General Info

Members Datasets Scaffolds Average Seq Length
481 274 474 237

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0054068|Ga0496125_0054068_1809_2645
Length 278
Sequence VFCFCTIGLDDGSDNARRPRRLRRSPSPAAKSRTVDFQHPLVRGRLVSRYKRFFADVVLDDGTELTAHCPNPGAMLGLNVAGLPVWLSKSDDPKRKLAHTLELVEADGGLVGINTMHPNRLVAEALAADAIPEVTGYATHRREVKYGAASRVDFLLEHPDRPPCWLEVKNVHLRRSGALAEFPDCVAARSLKHLGELKAMVAEGHRAVMLFVVQRTDCDAFAACADLDPKYAAGLIDAARAGVEVLCYDCDISPSAIRIARPVPWRDAALTEAERVLP

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
187 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.21
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0.21
Rhizoplane 3.12
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1041379 3300003771 Bacteria 1148
2 Ga0055530_10000014 3300003791 Bacteria 151346
3 Ga0055531_10001911 3300003794 Bacteria 14576
4 Ga0055531_10044377 3300003794 Bacteria 1247
5 Ga0055543_1030504 3300004625 Bacteria 943
6 Ga0065165_1000147 3300005262 Bacteria 122698
7 Ga0065165_1053334 3300005262 Bacteria 1138
8 Ga0065712_10069530 3300005290 Bacteria 7108
9 Ga0065712_10203762 3300005290 Bacteria 1098
10 Ga0065715_10091759 3300005293 Bacteria 5567
11 Ga0070658_10623179 3300005327 Bacteria 935
12 Ga0070690_100007974 3300005330 Bacteria 6078
13 Ga0070670_100003443 3300005331 Bacteria 13133
14 Ga0070670_100011098 3300005331 Bacteria 7696
15 Ga0068869_100022003 3300005334 Bacteria 4389
16 Ga0070666_10057948 3300005335 Unclassified 2618
17 Ga0070666_10351890 3300005335 Bacteria 1054
18 Ga0070680_100000322 3300005336 Bacteria 32136
19 Ga0070680_100008132 3300005336 Bacteria 8013
20 Ga0070680_100037839 3300005336 Bacteria 3900
21 Ga0070680_100067045 3300005336 Bacteria 2944
22 Ga0070680_100143397 3300005336 Bacteria 2003
23 Ga0070680_100428611 3300005336 Bacteria 1128
24 Ga0068868_100545730 3300005338 Bacteria 1021
25 Ga0070660_100056562 3300005339 Bacteria 3035
26 Ga0070660_100139324 3300005339 Bacteria 1945
27 Ga0070660_100209452 3300005339 Bacteria 1582
28 Ga0070660_100234756 3300005339 Bacteria 1492
29 Ga0070689_100185607 3300005340 Unclassified 1691
30 Ga0070689_100191487 3300005340 Bacteria 1665
31 Ga0070661_100005345 3300005344 Bacteria 8859
32 Ga0070668_100468849 3300005347 Unclassified 1086
33 Ga0070669_100190152 3300005353 Bacteria 1610
34 Ga0070675_100227211 3300005354 Bacteria 1627
35 Ga0070671_100015615 3300005355 Bacteria 6136
36 Ga0070671_100055126 3300005355 Bacteria 3307
37 Ga0070671_100230246 3300005355 Bacteria 1572
38 Ga0070674_100052133 3300005356 Bacteria 2821
39 Ga0070659_100000110 3300005366 Bacteria 60436
40 Ga0070659_100026952 3300005366 Bacteria 4424
41 Ga0070659_100146819 3300005366 Bacteria 1922
42 Ga0070659_100617720 3300005366 Bacteria 933
43 Ga0070667_100398357 3300005367 Bacteria 1253
44 Ga0070709_10341343 3300005434 Bacteria 1104
45 Ga0070663_100119669 3300005455 Bacteria 1988
46 Ga0070678_100028604 3300005456 Bacteria 3804
47 Ga0070678_100923661 3300005456 Bacteria 799
48 Ga0070662_100105038 3300005457 Bacteria 2144
49 Ga0070662_100149047 3300005457 Unclassified 1819
50 Ga0070681_10001378 3300005458 Bacteria 21303
51 Ga0070681_10023877 3300005458 Bacteria 6155
52 Ga0070681_10089355 3300005458 Bacteria 3032
53 Ga0070698_100237881 3300005471 Unclassified 1754
54 Ga0070698_100253268 3300005471 Bacteria 1693
55 Ga0070699_100287270 3300005518 Unclassified 1474
56 Ga0070679_100020560 3300005530 Bacteria 6437
57 Ga0070679_100163524 3300005530 Bacteria 2199
58 Ga0070697_100506354 3300005536 Unclassified 1056
59 Ga0070697_100603140 3300005536 Bacteria 965
60 Ga0068853_100560580 3300005539 Bacteria 1083
61 Ga0068853_100754684 3300005539 Bacteria 930
62 Ga0070672_100105764 3300005543 Unclassified 2288
63 Ga0070695_100040170 3300005545 Bacteria 2961
64 Ga0070695_100049599 3300005545 Unclassified 2688
65 Ga0070696_100163550 3300005546 Unclassified 1641
66 Ga0070665_100000183 3300005548 Bacteria 111514
67 Ga0070665_100306336 3300005548 Unclassified 1592
68 Ga0068855_100115289 3300005563 Bacteria 3080
69 Ga0068855_100349957 3300005563 Bacteria 1628
70 Ga0068855_100918045 3300005563 Bacteria 924
71 Ga0070664_100001735 3300005564 Bacteria 17446
72 Ga0070664_100008544 3300005564 Bacteria 8282
73 Ga0068857_100150377 3300005577 Unclassified 2109
74 Ga0068854_100410915 3300005578 Bacteria 1122
75 Ga0068854_100505370 3300005578 Bacteria 1018
76 Ga0068856_100018446 3300005614 Bacteria 6763
77 Ga0068859_100000523 3300005617 Bacteria 38137
78 Ga0068859_100781301 3300005617 Bacteria 1043
79 Ga0068864_100064908 3300005618 Bacteria 3167
80 Ga0068864_100346060 3300005618 Bacteria 1402
81 Ga0068861_100078584 3300005719 Bacteria 2577
82 Ga0068861_100301014 3300005719 Unclassified 1389
83 Ga0068861_100317985 3300005719 Bacteria 1355
84 Ga0068863_100001844 3300005841 Bacteria 21053
85 Ga0068863_100436306 3300005841 Bacteria 1284
86 Ga0068863_100605969 3300005841 Unclassified 1084
87 Ga0068858_100000494 3300005842 Bacteria 41195
88 Ga0068858_100089677 3300005842 Bacteria 2861
89 Ga0068860_100000032 3300005843 Bacteria 251624
90 Ga0068860_100034017 3300005843 Bacteria 4889
91 Ga0068862_100082079 3300005844 Bacteria 2797
92 Ga0068862_100229183 3300005844 Bacteria 1685
93 Ga0081539_10013687 3300005985 Bacteria 6092
94 Ga0070715_10069132 3300006163 Bacteria 1573
95 Ga0075362_10151541 3300006177 Bacteria 1112
96 Ga0075367_10012983 3300006178 Bacteria 4464
97 Ga0075428_100001220 3300006844 Bacteria 27537
98 Ga0075430_100159653 3300006846 Bacteria 1877
99 Ga0075430_100253657 3300006846 Bacteria 1457
100 Ga0075431_100000109 3300006847 Bacteria 52399
101 Ga0075431_100019186 3300006847 Bacteria 6969
102 Ga0075431_100220912 3300006847 Bacteria 1933
103 Ga0075433_10022724 3300006852 Bacteria 5269
104 Ga0075433_10716491 3300006852 Bacteria 876
105 Ga0075434_100059035 3300006871 Unclassified 3813
106 Ga0075434_100575408 3300006871 Bacteria 1146
107 Ga0075429_100022955 3300006880 Bacteria 5409
108 Ga0068865_100030237 3300006881 Bacteria 3601
109 Ga0075436_100006683 3300006914 Bacteria 7894
110 Ga0097620_100000523 3300006931 Bacteria 38137
111 Ga0097620_100781359 3300006931 Bacteria 1043
112 Ga0079104_1032941 3300006946 Bacteria 1272
113 Ga0075435_100003709 3300007076 Bacteria 10402
114 Ga0105240_10002309 3300009093 Bacteria 30859
115 Ga0105240_10002875 3300009093 Bacteria 27236
116 Ga0105240_10063413 3300009093 Bacteria 4597
117 Ga0105240_10207218 3300009093 Bacteria 2294
118 Ga0105240_10274455 3300009093 Bacteria 1940
119 Ga0105240_10606928 3300009093 Bacteria 1204
120 Ga0105240_10904327 3300009093 Bacteria 949
121 Ga0111539_10000684 3300009094 Bacteria 43895
122 Ga0111539_10032820 3300009094 Bacteria 6304
123 Ga0111539_10428804 3300009094 Bacteria 1540
124 Ga0111539_10921600 3300009094 Bacteria 1016
125 Ga0105247_10081790 3300009101 Bacteria 2037
126 Ga0105247_10286468 3300009101 Bacteria 1138
127 Ga0114129_10000425 3300009147 Bacteria 50146
128 Ga0114129_10003133 3300009147 Bacteria 23203
129 Ga0114129_10022009 3300009147 Bacteria 9047
130 Ga0114129_10047781 3300009147 Bacteria 6012
131 Ga0114129_10061557 3300009147 Bacteria 5246
132 Ga0105241_10118474 3300009174 Bacteria 2129
133 Ga0105242_10100253 3300009176 Bacteria 2452
134 Ga0105242_10193687 3300009176 Bacteria 1801
135 Ga0105242_11039558 3300009176 Bacteria 829
136 Ga0105248_10000125 3300009177 Bacteria 88470
137 Ga0105248_10022892 3300009177 Bacteria 6937
138 Ga0105248_10140229 3300009177 Bacteria 2727
139 Ga0105238_10076731 3300009551 Bacteria 3333
140 Ga0105238_10229052 3300009551 Bacteria 1835
141 Ga0105249_10415017 3300009553 Bacteria 1379
142 Ga0105249_11326187 3300009553 Bacteria 791
143 Ga0105239_10092122 3300010375 Unclassified 3345
144 Ga0105239_10365047 3300010375 Bacteria 1631
145 Ga0105239_10593293 3300010375 Bacteria 1263
146 Ga0105246_10230379 3300011119 Unclassified 1458
147 Ga0157373_10003448 3300013100 Bacteria 11963
148 Ga0157373_10060849 3300013100 Bacteria 2675
149 Ga0157371_10251473 3300013102 Bacteria 1272
150 Ga0157370_10055373 3300013104 Bacteria 3779
151 Ga0157370_10432694 3300013104 Bacteria 1210
152 Ga0157369_10328489 3300013105 Bacteria 1589
153 Ga0157374_10863770 3300013296 Bacteria 922
154 Ga0157378_10019935 3300013297 Bacteria 5898
155 Ga0157378_10450682 3300013297 Bacteria 1277
156 Ga0163162_10026067 3300013306 Bacteria 5778
157 Ga0157372_11129297 3300013307 Bacteria 906
158 Ga0157375_10499413 3300013308 Unclassified 1381
159 Ga0163163_10036168 3300014325 Bacteria 4795
160 Ga0163163_10045647 3300014325 Bacteria 4302
161 Ga0163163_10486221 3300014325 Bacteria 1296
162 Ga0163163_10557601 3300014325 Bacteria 1208
163 Ga0163163_10576481 3300014325 Bacteria 1188
164 Ga0157380_10056306 3300014326 Bacteria 3126
165 Ga0157377_10151778 3300014745 Unclassified 1433
166 Ga0157379_10007006 3300014968 Bacteria 9745
167 Ga0157379_10016113 3300014968 Bacteria 6574
168 Ga0157376_10403113 3300014969 Bacteria 1323
169 Ga0213876_10000298 3300021384 Bacteria 44938
170 Ga0209148_1009085 3300025254 Bacteria 1958
171 Ga0209564_1001154 3300025295 Bacteria 30904
172 Ga0209758_1001561 3300025297 Bacteria 26266
173 Ga0209050_1000034 3300025298 Bacteria 433906
174 Ga0207426_1026057 3300025302 Bacteria 1963
175 Ga0209257_1000052 3300025304 Bacteria 430947
176 Ga0209257_1000100 3300025304 Bacteria 253399
177 Ga0209257_1001452 3300025304 Bacteria 28026
178 Ga0207697_10006551 3300025315 Bacteria 5256
179 Ga0207697_10025082 3300025315 Unclassified 2438
180 Ga0207680_10198002 3300025903 Bacteria 1367
181 Ga0207645_10003533 3300025907 Bacteria 11825
182 Ga0207705_10082001 3300025909 Bacteria 2351
183 Ga0207707_10001346 3300025912 Bacteria 22877
184 Ga0207707_10063240 3300025912 Bacteria 3221
185 Ga0207707_10069222 3300025912 Bacteria 3076
186 Ga0207707_10105467 3300025912 Unclassified 2464
187 Ga0207707_10254862 3300025912 Bacteria 1524
188 Ga0207707_10319831 3300025912 Bacteria 1340
189 Ga0207695_10001126 3300025913 Bacteria 46415
190 Ga0207695_10009155 3300025913 Bacteria 12286
191 Ga0207695_10020016 3300025913 Bacteria 7680
192 Ga0207695_10028011 3300025913 Bacteria 6259
193 Ga0207695_10072692 3300025913 Bacteria 3507
194 Ga0207695_10206827 3300025913 Bacteria 1875
195 Ga0207695_10324944 3300025913 Bacteria 1428
196 Ga0207695_10581311 3300025913 Bacteria 1001
197 Ga0207695_10927839 3300025913 Bacteria 750
198 Ga0207660_10003732 3300025917 Bacteria 9923
199 Ga0207660_10028957 3300025917 Bacteria 3795
200 Ga0207660_10462917 3300025917 Bacteria 1026
201 Ga0207657_10001886 3300025919 Bacteria 22653
202 Ga0207657_10259585 3300025919 Bacteria 1383
203 Ga0207649_10065709 3300025920 Unclassified 2297
204 Ga0207652_10037569 3300025921 Bacteria 4099
205 Ga0207652_10101330 3300025921 Bacteria 2543
206 Ga0207652_10108355 3300025921 Unclassified 2461
207 Ga0207652_10128269 3300025921 Bacteria 2261
208 Ga0207694_10050093 3300025924 Bacteria 3233
209 Ga0207694_10084657 3300025924 Bacteria 2494
210 Ga0207650_10001846 3300025925 Bacteria 14929
211 Ga0207650_10034780 3300025925 Bacteria 3656
212 Ga0207659_10188711 3300025926 Bacteria 1639
213 Ga0207644_10010291 3300025931 Bacteria 6164
214 Ga0207690_10005622 3300025932 Bacteria 7408
215 Ga0207690_10010905 3300025932 Bacteria 5417
216 Ga0207690_10021664 3300025932 Bacteria 3988
217 Ga0207690_10117975 3300025932 Bacteria 1922
218 Ga0207690_10160324 3300025932 Bacteria 1676
219 Ga0207690_10391958 3300025932 Bacteria 1106
220 Ga0207690_10507241 3300025932 Bacteria 976
221 Ga0207706_10004222 3300025933 Bacteria 13532
222 Ga0207706_10194807 3300025933 Bacteria 1778
223 Ga0207686_10437725 3300025934 Bacteria 1003
224 Ga0207670_10170672 3300025936 Bacteria 1631
225 Ga0207704_10027392 3300025938 Bacteria 3144
226 Ga0207704_10241704 3300025938 Bacteria 1349
227 Ga0207691_10011829 3300025940 Bacteria 8377
228 Ga0207711_10000560 3300025941 Bacteria 37892
229 Ga0207711_10012458 3300025941 Bacteria 7067
230 Ga0207711_10014709 3300025941 Bacteria 6503
231 Ga0207689_10022383 3300025942 Bacteria 5315
232 Ga0207679_10009476 3300025945 Bacteria 6240
233 Ga0207679_10011552 3300025945 Bacteria 5726
234 Ga0207667_10041335 3300025949 Bacteria 4904
235 Ga0207667_10167715 3300025949 Bacteria 2257
236 Ga0207667_10220339 3300025949 Bacteria 1944
237 Ga0207668_10775759 3300025972 Bacteria 847
238 Ga0207640_10330025 3300025981 Bacteria 1218
239 Ga0207658_10174010 3300025986 Bacteria 1776
240 Ga0207658_10420491 3300025986 Bacteria 1178
241 Ga0207703_10000035 3300026035 Bacteria 183082
242 Ga0207639_10146251 3300026041 Bacteria 1974
243 Ga0207639_10419357 3300026041 Bacteria 1210
244 Ga0207678_10017629 3300026067 Bacteria 6268
245 Ga0207678_10236482 3300026067 Bacteria 1564
246 Ga0207708_10070493 3300026075 Bacteria 2676
247 Ga0207641_10003305 3300026088 Bacteria 14345
248 Ga0207676_10077342 3300026095 Bacteria 2692
249 Ga0207676_10201766 3300026095 Bacteria 1758
250 Ga0207676_10496389 3300026095 Bacteria 1158
251 Ga0207674_10156435 3300026116 Unclassified 2235
252 Ga0207675_100079911 3300026118 Bacteria 3065
253 Ga0207675_100116520 3300026118 Bacteria 2525
254 Ga0207675_100295127 3300026118 Bacteria 1577
255 Ga0207683_10003079 3300026121 Bacteria 14576
256 Ga0207698_10250277 3300026142 Bacteria 1621
257 Ga0209984_1004227 3300027424 Bacteria 1683
258 Ga0209995_1014763 3300027471 Bacteria 1281
259 Ga0209982_1009972 3300027552 Bacteria 1405
260 Ga0210002_1002226 3300027617 Bacteria 2802
261 Ga0209971_1005479 3300027682 Bacteria 3013
262 Ga0209966_1004021 3300027695 Archaea 2481
263 Ga0209974_10006877 3300027876 Bacteria 3947
264 Ga0207428_10006066 3300027907 Bacteria 11172
265 Ga0207428_10012301 3300027907 Bacteria 7523
266 Ga0207428_10225823 3300027907 Bacteria 1402
267 Ga0268266_10000062 3300028379 Bacteria 253490
268 Ga0268266_10170760 3300028379 Unclassified 1974
269 Ga0268265_10005382 3300028380 Bacteria 8765
270 Ga0268265_10035709 3300028380 Bacteria 3635
271 Ga0268265_10434871 3300028380 Bacteria 1222
272 Ga0268264_10000045 3300028381 Bacteria 364764
273 Ga0268264_10028220 3300028381 Bacteria 4589
274 Ga0265319_1126081 3300028563 Bacteria 797
275 Ga0307517_10083135 3300028786 Bacteria 2710
276 Ga0265338_10003962 3300028800 Bacteria 20398
277 Ga0265338_10063436 3300028800 Bacteria 3221
278 Ga0265324_10087120 3300029957 Bacteria 1062
279 Ga0307511_10018037 3300030521 Bacteria 6753
280 Ga0265760_10023713 3300031090 Bacteria 1784
281 Ga0265325_10128600 3300031241 Bacteria 1215
282 Ga0265340_10009717 3300031247 Bacteria 5157
283 Ga0265340_10082338 3300031247 Bacteria 1514
284 Ga0265327_10001235 3300031251 Bacteria 34299
285 Ga0265327_10007327 3300031251 Bacteria 8543
286 Ga0265327_10246684 3300031251 Bacteria 796
287 Ga0307513_10005993 3300031456 Bacteria 15963
288 Ga0307513_10308005 3300031456 Bacteria 1347
289 Ga0265314_10032063 3300031711 Bacteria 3871
290 Ga0265342_10114325 3300031712 Bacteria 1525
291 Ga0307516_10000002 3300031730 Bacteria 467851
292 Ga0307414_10045059 3300032004 Bacteria 3018
293 Ga0307510_10210867 3300033180 Bacteria 1465
294 Ga0373926_0002707 3300035083 Bacteria 5651
295 Ga0373932_0029544 3300035112 Bacteria 1514
296 Ga0373936_0000446 3300035113 Bacteria 13812
297 Ga0373936_0014400 3300035113 Bacteria 3023
298 Ga0373946_0031233 3300035171 Unclassified 2131
299 Ga0373946_0046383 3300035171 Bacteria 1801
300 Ga0373961_0025022 3300035241 Unclassified 1620
301 Ga0373931_0001765 3300035691 Bacteria 9393
302 Ga0373935_0087321 3300035692 Bacteria 2036
303 Ga0373927_0007706 3300035695 Bacteria 7286
304 Ga0373927_0308627 3300035695 Bacteria 1041
305 Ga0373933_0326570 3300035724 Bacteria 995
306 Ga0373933_0359201 3300035724 Bacteria 947
307 Ga0373947_0191846 3300035725 Bacteria 1333
308 Ga0373937_0751282 3300036401 Bacteria 923
309 Ga0373925_0013180 3300037068 Bacteria 5984
310 Ga0373925_0040383 3300037068 Bacteria 3454
311 Ga0395899_0001074 3300037312 Bacteria 24644
312 Ga0395899_0086444 3300037312 Bacteria 2277
313 Ga0395899_0095903 3300037312 Bacteria 2145
314 Ga0395900_0000004 3300037418 Bacteria 564908
315 Ga0395900_0263462 3300037418 Bacteria 1720
316 Ga0395900_0542341 3300037418 Bacteria 1109
317 Ga0395898_0097377 3300037466 Bacteria 2825
318 Ga0395898_0113524 3300037466 Bacteria 2596
319 Ga0395898_0295456 3300037466 Bacteria 1545
320 Ga0395905_0001052 3300037471 Bacteria 34866
321 Ga0395905_0002588 3300037471 Bacteria 19901
322 Ga0395905_0019738 3300037471 Bacteria 6390
323 Ga0395905_0024528 3300037471 Bacteria 5691
324 Ga0395905_0121902 3300037471 Bacteria 2451
325 Ga0436364_0307105 3300037853 Bacteria 1016
326 Ga0436364_0967927 3300037853 Bacteria 2282
327 Ga0395901_0000005 3300038443 Bacteria 544998
328 Ga0395901_0054013 3300038443 Bacteria 4175
329 Ga0395901_0100666 3300038443 Bacteria 3031
330 Ga0395901_0225351 3300038443 Bacteria 1958
331 Ga0395901_0320958 3300038443 Bacteria 1602
332 Ga0400490_07094 3300038726 Bacteria 27712
333 Ga0400491_26494 3300038727 Bacteria 2537
334 Ga0400489_05820 3300039093 Bacteria 4866
335 Ga0436365_0142751 3300039437 Bacteria 1862
336 Ga0436365_0749742 3300039437 Bacteria 107056
337 Ga0451797_1381995 3300041453 Bacteria 889
338 Ga0451853_2904541 3300041512 Bacteria 1411
339 Ga0466961_0125621 3300044693 Bacteria 1610
340 Ga0466959_0408588 3300045049 Bacteria 922
341 Ga0451576_0076659 3300045051 Bacteria 3479
342 Ga0451576_0436655 3300045051 Unclassified 1374
343 Ga0495638_0042610 3300046460 Bacteria 2866
344 Ga0495580_0128041 3300046472 Bacteria 1762
345 Ga0495628_0212966 3300046516 Bacteria 1453
346 Ga0495598_0056104 3300046537 Bacteria 1202
347 Ga0495668_0022427 3300046616 Bacteria 3609
348 Ga0495668_0040854 3300046616 Bacteria 2586
349 Ga0495668_0090962 3300046616 Bacteria 1672
350 Ga0495611_0025697 3300046648 Bacteria 2568
351 Ga0495669_0000078 3300046684 Bacteria 64436
352 Ga0495669_0013418 3300046684 Bacteria 3490
353 Ga0495669_0015785 3300046684 Bacteria 3233
354 Ga0495613_0003549 3300046689 Bacteria 11697
355 Ga0495670_0004094 3300046691 Bacteria 7152
356 Ga0495670_0304564 3300046691 Bacteria 854
357 Ga0495674_0179310 3300047319 Bacteria 1765
358 Ga0495672_0062472 3300047320 Bacteria 2142
359 Ga0495677_0031128 3300047445 Bacteria 1942
360 Ga0495677_0079064 3300047445 Bacteria 1231
361 Ga0495686_0017319 3300047472 Bacteria 4858
362 Ga0495602_0426985 3300048088 Bacteria 940
363 Ga0495615_0051919 3300048090 Bacteria 1058
364 Ga0496102_0113873 3300048905 Bacteria 2523
365 Ga0496105_0558476 3300048908 Bacteria 893
366 Ga0496107_0401002 3300048910 Bacteria 1020
367 Ga0496108_0085030 3300048911 Unclassified 2685
368 Ga0496109_0083824 3300048912 Unclassified 2940
369 Ga0496112_0003213 3300048915 Bacteria 13456
370 Ga0496112_0006744 3300048915 Bacteria 10115
371 Ga0496112_0394526 3300048915 Bacteria 1324
372 Ga0496113_0184984 3300048916 Bacteria 1652
373 Ga0496115_0000780 3300048918 Bacteria 23351
374 Ga0496115_0132445 3300048918 Bacteria 2055
375 Ga0496115_0207263 3300048918 Bacteria 1619
376 Ga0496115_0434125 3300048918 Bacteria 1063
377 Ga0496115_0576420 3300048918 Bacteria 897
378 Ga0496117_0054445 3300048920 Bacteria 2803
379 Ga0496119_0023426 3300048922 Bacteria 4378
380 Ga0496119_0135311 3300048922 Bacteria 1337
381 Ga0496121_0000053 3300048924 Bacteria 312611
382 Ga0496121_0074671 3300048924 Bacteria 2711
383 Ga0496121_0298577 3300048924 Bacteria 1094
384 Ga0496123_0317104 3300048926 Unclassified 737
385 Ga0496124_0172386 3300048927 Bacteria 1674
386 Ga0496125_0054068 3300048928 Bacteria 3285
387 Ga0501032_0020243 3300049569 Bacteria 4637
388 Ga0501033_0044222 3300049570 Bacteria 3315
389 Ga0501033_0184312 3300049570 Bacteria 1495
390 Ga0501037_0022797 3300049573 Bacteria 4629
391 Ga0501039_0241057 3300049575 Bacteria 1421
392 Ga0501040_0041119 3300049576 Bacteria 3147
393 Ga0501041_0061355 3300049577 Bacteria 2301
394 Ga0501043_0019570 3300049579 Bacteria 5313
395 Ga0501046_0077359 3300049580 Bacteria 2575
396 Ga0501047_0063971 3300049581 Bacteria 3549
397 Ga0501047_0177221 3300049581 Bacteria 1999
398 Ga0501047_0758140 3300049581 Bacteria 786
399 Ga0501070_0014226 3300049586 Bacteria 6696
400 Ga0501071_0382066 3300049587 Bacteria 1074
401 Ga0501072_0094166 3300049588 Bacteria 2380
402 Ga0501072_0126201 3300049588 Bacteria 2039
403 Ga0501073_0025831 3300049589 Bacteria 4207
404 Ga0501075_0034360 3300049591 Bacteria 3775
405 Ga0501075_0143345 3300049591 Bacteria 1821
406 Ga0501075_0319807 3300049591 Bacteria 1182
407 Ga0501076_0003488 3300049592 Bacteria 11049
408 Ga0501076_0077795 3300049592 Bacteria 2661
409 Ga0501076_0148440 3300049592 Unclassified 1907
410 Ga0501076_0372778 3300049592 Bacteria 1173
411 Ga0501077_0109108 3300049593 Bacteria 1753
412 Ga0501077_0198647 3300049593 Bacteria 1274
413 Ga0501257_001513 3300049686 Bacteria 4850
414 Ga0501079_0202347 3300049741 Bacteria 1551
415 Ga0501080_0069487 3300049742 Bacteria 3275
416 Ga0501080_0315188 3300049742 Bacteria 1417
417 Ga0501081_0016225 3300049743 Bacteria 4921
418 Ga0501083_0009765 3300049744 Bacteria 6776
419 Ga0501035_0041903 3300049822 Bacteria 4132
420 Ga0501035_0084157 3300049822 Bacteria 2805
421 Ga0501044_0011200 3300049823 Bacteria 9725
422 Ga0501044_0013748 3300049823 Bacteria 8747
423 Ga0501044_0032609 3300049823 Bacteria 5475
424 Ga0501044_0145525 3300049823 Bacteria 2356
425 Ga0501044_0823536 3300049823 Bacteria 806
426 nmdc:mga00v17_189669_c1 3300050491 Bacteria 1327
427 nmdc:mga00v17_369519_c1 3300050491 Bacteria 932
428 nmdc:mga0k408_150403_c1 3300050493 Bacteria 1386
429 nmdc:mga06z11_121895_c1 3300050494 Bacteria 1455
430 nmdc:mga05p37_129798_c1 3300050507 Bacteria 3093
431 nmdc:mga05p37_19211_c1 3300050507 Bacteria 8266
432 nmdc:mga05p37_268_c1 3300050507 Bacteria 53897
433 nmdc:mga05p37_464233_c1 3300050507 Bacteria 1462
434 nmdc:mga05p37_59090_c1 3300050507 Bacteria 4723
435 nmdc:mga09592_11852_c1 3300050508 Bacteria 7092
436 nmdc:mga09592_95178_c1 3300050508 Bacteria 2547
437 nmdc:mga0qj67_147564_c1 3300050509 Bacteria 1907
438 nmdc:mga06r32_133_c1 3300050510 Bacteria 53973
439 nmdc:mga06r32_146881_c1 3300050510 Bacteria 2335
440 nmdc:mga06r32_25554_c1 3300050510 Bacteria 5494
441 nmdc:mga06r32_392835_c1 3300050510 Bacteria 1369
442 nmdc:mga08y16_193372_c1 3300050511 Bacteria 2110
443 nmdc:mga08y16_312911_c1 3300050511 Bacteria 1617
444 nmdc:mga08y16_604_c1 3300050511 Bacteria 33484
445 nmdc:mga0n895_155564_c1 3300050512 Unclassified 2317
446 nmdc:mga0n895_387_c1 3300050512 Bacteria 29540
447 nmdc:mga0rr50_3295_c1 3300050513 Bacteria 9268
448 nmdc:mga08x19_223449_c1 3300050514 Unclassified 1294
449 nmdc:mga08x19_4324_c1 3300050514 Bacteria 8415
450 nmdc:mga0a205_11121_c1 3300050515 Bacteria 8282
451 nmdc:mga0a205_438377_c1 3300050515 Bacteria 1167
452 nmdc:mga0a205_68809_c1 3300050515 Unclassified 3419
453 nmdc:mga0a205_94611_c1 3300050515 Bacteria 2886
454 Ga0495612_0062662 3300053078 Bacteria 1542
455 Ga0500643_006902 3300053087 Bacteria 4671
456 Ga0500643_047890 3300053087 Bacteria 1231
457 Ga0500647_0014093 3300053091 Bacteria 3629
458 Ga0500555_001657 3300053103 Bacteria 6723
459 Ga0500556_0119922 3300053104 Bacteria 1025
460 Ga0500562_000465 3300053108 Bacteria 9816
461 Ga0500562_000837 3300053108 Bacteria 7450
462 Ga0500572_000183 3300053111 Bacteria 21954
463 Ga0500595_002232 3300053119 Bacteria 9837
464 Ga0500595_011126 3300053119 Bacteria 3538
465 Ga0500559_0000010 3300053136 Bacteria 165569
466 Ga0500616_0138460 3300053153 Bacteria 1141
467 Ga0500616_0287860 3300053153 Bacteria 687
468 Ga0500619_103754 3300053154 Bacteria 965
469 Ga0500636_0056776 3300053177 Bacteria 2292
470 Ga0500645_004773 3300053730 Bacteria 5131
471 Ga0501084_0206225 3300054114 Bacteria 1659
472 Ga0501082_0741667 3300060353 Bacteria 859
473 Ga0501082_1164931 3300060353 Bacteria 674
474 Ga0530510_0078350 3300061734 Bacteria 2402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0359201 Ga0373933_0359201_292_900 193
2 3300048926 Ga0496123_0317104 Ga0496123_0317104_133_726 197
3 3300050491 nmdc:mga00v17_189669_c1 nmdc:mga00v17_189669_c1_705_1298 197
4 3300053153 Ga0500616_0287860 Ga0500616_0287860_17_610 197
5 3300060353 Ga0501082_1164931 Ga0501082_1164931_51_644 197
6 3300037466 Ga0395898_0295456 Ga0395898_0295456_17_691 211
7 3300009093 Ga0105240_10606928 Ga0105240_106069282 218
8 3300013104 Ga0157370_10432694 Ga0157370_104326942 218
9 3300025913 Ga0207695_10581311 Ga0207695_105813111 218
10 3300005336 Ga0070680_100143397 Ga0070680_1001433972 220
11 3300009093 Ga0105240_10063413 Ga0105240_100634132 220
12 3300013104 Ga0157370_10055373 Ga0157370_100553733 220
13 3300025912 Ga0207707_10069222 Ga0207707_100692222 220
14 3300025913 Ga0207695_10009155 Ga0207695_100091554 220
15 3300025949 Ga0207667_10041335 Ga0207667_100413352 220
16 3300026142 Ga0207698_10250277 Ga0207698_102502772 220
17 3300037312 Ga0395899_0095903 Ga0395899_0095903_66_761 224
18 3300038443 Ga0395901_0100666 Ga0395901_0100666_702_1397 224
19 3300014968 Ga0157379_10016113 Ga0157379_100161136 226
20 3300041512 Ga0451853_2904541 Ga0451853_2904541_365_1060 227
21 3300031241 Ga0265325_10128600 Ga0265325_101286001 229
22 3300053103 Ga0500555_001657 Ga0500555_001657_926_1624 229
23 iso_pu_bacteria 2643221545 2643749960 229
24 iso_pu_bacteria 2643221598 2644000838 229
25 iso_pu_bacteria 2643221691 2644510886 229
26 iso_pu_bacteria 8002745576 8002748144 229
27 3300005290 Ga0065712_10069530 Ga0065712_100695302 230
28 3300005290 Ga0065712_10203762 Ga0065712_102037621 230
29 3300005293 Ga0065715_10091759 Ga0065715_100917592 230
30 3300005330 Ga0070690_100007974 Ga0070690_1000079742 230
31 3300005331 Ga0070670_100003443 Ga0070670_10000344311 230
32 3300005334 Ga0068869_100022003 Ga0068869_1000220032 230
33 3300005335 Ga0070666_10057948 Ga0070666_100579481 230
34 3300005336 Ga0070680_100008132 Ga0070680_1000081322 230
35 3300005336 Ga0070680_100037839 Ga0070680_1000378392 230
36 3300005340 Ga0070689_100185607 Ga0070689_1001856072 230
37 3300005340 Ga0070689_100191487 Ga0070689_1001914872 230
38 3300005344 Ga0070661_100005345 Ga0070661_1000053454 230
39 3300005347 Ga0070668_100468849 Ga0070668_1004688491 230
40 3300005354 Ga0070675_100227211 Ga0070675_1002272112 230
41 3300005356 Ga0070674_100052133 Ga0070674_1000521332 230
42 3300005366 Ga0070659_100146819 Ga0070659_1001468192 230
43 3300005434 Ga0070709_10341343 Ga0070709_103413431 230
44 3300005455 Ga0070663_100119669 Ga0070663_1001196691 230
45 3300005456 Ga0070678_100028604 Ga0070678_1000286041 230
46 3300005456 Ga0070678_100923661 Ga0070678_1009236611 230
47 3300005457 Ga0070662_100105038 Ga0070662_1001050382 230
48 3300005457 Ga0070662_100149047 Ga0070662_1001490472 230
49 3300005458 Ga0070681_10001378 Ga0070681_1000137817 230
50 3300005458 Ga0070681_10089355 Ga0070681_100893552 230
51 3300005471 Ga0070698_100237881 Ga0070698_1002378812 230
52 3300005471 Ga0070698_100253268 Ga0070698_1002532682 230
53 3300005518 Ga0070699_100287270 Ga0070699_1002872702 230
54 3300005530 Ga0070679_100020560 Ga0070679_1000205604 230
55 3300005530 Ga0070679_100163524 Ga0070679_1001635242 230
56 3300005536 Ga0070697_100506354 Ga0070697_1005063541 230
57 3300005536 Ga0070697_100603140 Ga0070697_1006031401 230
58 3300005543 Ga0070672_100105764 Ga0070672_1001057642 230
59 3300005545 Ga0070695_100040170 Ga0070695_1000401702 230
60 3300005545 Ga0070695_100049599 Ga0070695_1000495993 230
61 3300005546 Ga0070696_100163550 Ga0070696_1001635502 230
62 3300005548 Ga0070665_100306336 Ga0070665_1003063361 230
63 3300005564 Ga0070664_100001735 Ga0070664_1000017357 230
64 3300005577 Ga0068857_100150377 Ga0068857_1001503772 230
65 3300005578 Ga0068854_100505370 Ga0068854_1005053701 230
66 3300005614 Ga0068856_100018446 Ga0068856_1000184467 230
67 3300005719 Ga0068861_100301014 Ga0068861_1003010142 230
68 3300005719 Ga0068861_100317985 Ga0068861_1003179852 230
69 3300005841 Ga0068863_100436306 Ga0068863_1004363062 230
70 3300005841 Ga0068863_100605969 Ga0068863_1006059692 230
71 3300005844 Ga0068862_100229183 Ga0068862_1002291832 230
72 3300006163 Ga0070715_10069132 Ga0070715_100691322 230
73 3300006846 Ga0075430_100253657 Ga0075430_1002536571 230
74 3300006847 Ga0075431_100019186 Ga0075431_1000191864 230
75 3300006847 Ga0075431_100220912 Ga0075431_1002209122 230
76 3300006852 Ga0075433_10022724 Ga0075433_100227242 230
77 3300006852 Ga0075433_10716491 Ga0075433_107164911 230
78 3300006871 Ga0075434_100059035 Ga0075434_1000590354 230
79 3300006871 Ga0075434_100575408 Ga0075434_1005754082 230
80 3300006914 Ga0075436_100006683 Ga0075436_1000066833 230
81 3300007076 Ga0075435_100003709 Ga0075435_1000037094 230
82 3300009094 Ga0111539_10032820 Ga0111539_100328203 230
83 3300009094 Ga0111539_10428804 Ga0111539_104288042 230
84 3300009094 Ga0111539_10921600 Ga0111539_109216001 230
85 3300009147 Ga0114129_10003133 Ga0114129_100031334 230
86 3300009147 Ga0114129_10022009 Ga0114129_100220096 230
87 3300009147 Ga0114129_10047781 Ga0114129_100477813 230
88 3300009147 Ga0114129_10061557 Ga0114129_100615572 230
89 3300009174 Ga0105241_10118474 Ga0105241_101184742 230
90 3300009176 Ga0105242_10193687 Ga0105242_101936872 230
91 3300009553 Ga0105249_10415017 Ga0105249_104150172 230
92 3300010375 Ga0105239_10092122 Ga0105239_100921221 230
93 3300011119 Ga0105246_10230379 Ga0105246_102303792 230
94 3300013102 Ga0157371_10251473 Ga0157371_102514732 230
95 3300013297 Ga0157378_10019935 Ga0157378_100199352 230
96 3300013297 Ga0157378_10450682 Ga0157378_104506822 230
97 3300013307 Ga0157372_11129297 Ga0157372_111292971 230
98 3300013308 Ga0157375_10499413 Ga0157375_104994132 230
99 3300014745 Ga0157377_10151778 Ga0157377_101517782 230
100 3300014969 Ga0157376_10403113 Ga0157376_104031131 230
101 3300025315 Ga0207697_10006551 Ga0207697_100065514 230
102 3300025315 Ga0207697_10025082 Ga0207697_100250822 230
103 3300025907 Ga0207645_10003533 Ga0207645_100035337 230
104 3300025912 Ga0207707_10001346 Ga0207707_100013462 230
105 3300025912 Ga0207707_10063240 Ga0207707_100632403 230
106 3300025912 Ga0207707_10105467 Ga0207707_101054673 230
107 3300025917 Ga0207660_10028957 Ga0207660_100289572 230
108 3300025919 Ga0207657_10001886 Ga0207657_1000188610 230
109 3300025920 Ga0207649_10065709 Ga0207649_100657092 230
110 3300025921 Ga0207652_10108355 Ga0207652_101083552 230
111 3300025921 Ga0207652_10128269 Ga0207652_101282692 230
112 3300025925 Ga0207650_10001846 Ga0207650_100018467 230
113 3300025926 Ga0207659_10188711 Ga0207659_101887112 230
114 3300025932 Ga0207690_10021664 Ga0207690_100216643 230
115 3300025932 Ga0207690_10391958 Ga0207690_103919582 230
116 3300025933 Ga0207706_10004222 Ga0207706_100042222 230
117 3300025933 Ga0207706_10194807 Ga0207706_101948072 230
118 3300025934 Ga0207686_10437725 Ga0207686_104377251 230
119 3300025936 Ga0207670_10170672 Ga0207670_101706722 230
120 3300025938 Ga0207704_10241704 Ga0207704_102417042 230
121 3300025940 Ga0207691_10011829 Ga0207691_100118297 230
122 3300025942 Ga0207689_10022383 Ga0207689_100223832 230
123 3300025945 Ga0207679_10011552 Ga0207679_100115523 230
124 3300025986 Ga0207658_10420491 Ga0207658_104204911 230
125 3300026041 Ga0207639_10419357 Ga0207639_104193572 230
126 3300026067 Ga0207678_10017629 Ga0207678_100176295 230
127 3300026075 Ga0207708_10070493 Ga0207708_100704932 230
128 3300026095 Ga0207676_10201766 Ga0207676_102017662 230
129 3300026116 Ga0207674_10156435 Ga0207674_101564352 230
130 3300026118 Ga0207675_100116520 Ga0207675_1001165202 230
131 3300026118 Ga0207675_100295127 Ga0207675_1002951272 230
132 3300026121 Ga0207683_10003079 Ga0207683_1000307911 230
133 3300027424 Ga0209984_1004227 Ga0209984_10042272 230
134 3300027471 Ga0209995_1014763 Ga0209995_10147632 230
135 3300027552 Ga0209982_1009972 Ga0209982_10099722 230
136 3300027617 Ga0210002_1002226 Ga0210002_10022262 230
137 3300027682 Ga0209971_1005479 Ga0209971_10054792 230
138 3300027695 Ga0209966_1004021 Ga0209966_10040212 230
139 3300027876 Ga0209974_10006877 Ga0209974_100068773 230
140 3300027907 Ga0207428_10012301 Ga0207428_100123015 230
141 3300027907 Ga0207428_10225823 Ga0207428_102258231 230
142 3300028379 Ga0268266_10170760 Ga0268266_101707602 230
143 3300028380 Ga0268265_10434871 Ga0268265_104348712 230
144 3300035083 Ga0373926_0002707 Ga0373926_0002707_3709_4404 230
145 3300035112 Ga0373932_0029544 Ga0373932_0029544_260_955 230
146 3300035113 Ga0373936_0014400 Ga0373936_0014400_1068_1763 230
147 3300035171 Ga0373946_0031233 Ga0373946_0031233_1219_1914 230
148 3300035241 Ga0373961_0025022 Ga0373961_0025022_447_1142 230
149 3300035691 Ga0373931_0001765 Ga0373931_0001765_1547_2242 230
150 3300035692 Ga0373935_0087321 Ga0373935_0087321_926_1621 230
151 3300035695 Ga0373927_0308627 Ga0373927_0308627_325_1020 230
152 3300035725 Ga0373947_0191846 Ga0373947_0191846_576_1271 230
153 3300037068 Ga0373925_0040383 Ga0373925_0040383_497_1192 230
154 3300038726 Ga0400490_07094 Ga0400490_07094_20078_20773 230
155 3300038727 Ga0400491_26494 Ga0400491_26494_1526_2221 230
156 3300045051 Ga0451576_0436655 Ga0451576_0436655_642_1337 230
157 3300046472 Ga0495580_0128041 Ga0495580_0128041_1042_1737 230
158 3300046537 Ga0495598_0056104 Ga0495598_0056104_192_887 230
159 3300046691 Ga0495670_0304564 Ga0495670_0304564_67_762 230
160 3300047319 Ga0495674_0179310 Ga0495674_0179310_499_1194 230
161 3300048908 Ga0496105_0558476 Ga0496105_0558476_83_778 230
162 3300048910 Ga0496107_0401002 Ga0496107_0401002_104_799 230
163 3300048911 Ga0496108_0085030 Ga0496108_0085030_1933_2628 230
164 3300048912 Ga0496109_0083824 Ga0496109_0083824_1838_2533 230
165 3300048915 Ga0496112_0003213 Ga0496112_0003213_6297_6992 230
166 3300048915 Ga0496112_0006744 Ga0496112_0006744_4608_5303 230
167 3300048916 Ga0496113_0184984 Ga0496113_0184984_458_1153 230
168 3300049569 Ga0501032_0020243 Ga0501032_0020243_2438_3133 230
169 3300049570 Ga0501033_0044222 Ga0501033_0044222_2102_2797 230
170 3300049573 Ga0501037_0022797 Ga0501037_0022797_507_1202 230
171 3300049575 Ga0501039_0241057 Ga0501039_0241057_130_825 230
172 3300049576 Ga0501040_0041119 Ga0501040_0041119_1378_2073 230
173 3300049577 Ga0501041_0061355 Ga0501041_0061355_1010_1705 230
174 3300049579 Ga0501043_0019570 Ga0501043_0019570_2413_3108 230
175 3300049580 Ga0501046_0077359 Ga0501046_0077359_1466_2161 230
176 3300049581 Ga0501047_0177221 Ga0501047_0177221_915_1610 230
177 3300049586 Ga0501070_0014226 Ga0501070_0014226_3635_4453 230
178 3300049587 Ga0501071_0382066 Ga0501071_0382066_354_1049 230
179 3300049588 Ga0501072_0094166 Ga0501072_0094166_1070_1765 230
180 3300049588 Ga0501072_0126201 Ga0501072_0126201_865_1560 230
181 3300049589 Ga0501073_0025831 Ga0501073_0025831_2792_3487 230
182 3300049591 Ga0501075_0034360 Ga0501075_0034360_2468_3163 230
183 3300049591 Ga0501075_0143345 Ga0501075_0143345_503_1255 230
184 3300049591 Ga0501075_0319807 Ga0501075_0319807_358_1053 230
185 3300049592 Ga0501076_0003488 Ga0501076_0003488_9941_10636 230
186 3300049592 Ga0501076_0077795 Ga0501076_0077795_460_1155 230
187 3300049592 Ga0501076_0148440 Ga0501076_0148440_1019_1714 230
188 3300049592 Ga0501076_0372778 Ga0501076_0372778_122_817 230
189 3300049593 Ga0501077_0109108 Ga0501077_0109108_1009_1704 230
190 3300049593 Ga0501077_0198647 Ga0501077_0198647_426_1121 230
191 3300049741 Ga0501079_0202347 Ga0501079_0202347_700_1395 230
192 3300049742 Ga0501080_0069487 Ga0501080_0069487_597_1292 230
193 3300049742 Ga0501080_0315188 Ga0501080_0315188_601_1296 230
194 3300049743 Ga0501081_0016225 Ga0501081_0016225_2887_3582 230
195 3300049744 Ga0501083_0009765 Ga0501083_0009765_3500_4195 230
196 3300049822 Ga0501035_0084157 Ga0501035_0084157_1893_2588 230
197 3300049823 Ga0501044_0011200 Ga0501044_0011200_2279_3079 230
198 3300050507 nmdc:mga05p37_129798_c1 nmdc:mga05p37_129798_c1_1897_2592 230
199 3300050507 nmdc:mga05p37_19211_c1 nmdc:mga05p37_19211_c1_4907_5602 230
200 3300050507 nmdc:mga05p37_464233_c1 nmdc:mga05p37_464233_c1_323_1018 230
201 3300050507 nmdc:mga05p37_59090_c1 nmdc:mga05p37_59090_c1_2960_3655 230
202 3300050508 nmdc:mga09592_95178_c1 nmdc:mga09592_95178_c1_945_1640 230
203 3300050510 nmdc:mga06r32_146881_c1 nmdc:mga06r32_146881_c1_639_1334 230
204 3300050510 nmdc:mga06r32_25554_c1 nmdc:mga06r32_25554_c1_4182_4883 230
205 3300050511 nmdc:mga08y16_193372_c1 nmdc:mga08y16_193372_c1_262_957 230
206 3300050511 nmdc:mga08y16_312911_c1 nmdc:mga08y16_312911_c1_313_1008 230
207 3300050512 nmdc:mga0n895_155564_c1 nmdc:mga0n895_155564_c1_791_1495 230
208 3300050512 nmdc:mga0n895_387_c1 nmdc:mga0n895_387_c1_92_787 230
209 3300050513 nmdc:mga0rr50_3295_c1 nmdc:mga0rr50_3295_c1_4275_4970 230
210 3300050514 nmdc:mga08x19_223449_c1 nmdc:mga08x19_223449_c1_170_874 230
211 3300050514 nmdc:mga08x19_4324_c1 nmdc:mga08x19_4324_c1_6111_6806 230
212 3300050515 nmdc:mga0a205_11121_c1 nmdc:mga0a205_11121_c1_6720_7415 230
213 3300050515 nmdc:mga0a205_438377_c1 nmdc:mga0a205_438377_c1_389_1087 230
214 3300050515 nmdc:mga0a205_68809_c1 nmdc:mga0a205_68809_c1_1221_1925 230
215 3300050515 nmdc:mga0a205_94611_c1 nmdc:mga0a205_94611_c1_1522_2217 230
216 3300054114 Ga0501084_0206225 Ga0501084_0206225_184_879 230
217 3300060353 Ga0501082_0741667 Ga0501082_0741667_146_841 230
218 3300061734 Ga0530510_0078350 Ga0530510_0078350_865_1560 230
219 3300006946 Ga0079104_1032941 Ga0079104_10329412 231
220 3300025941 Ga0207711_10012458 Ga0207711_100124581 231
221 3300048088 Ga0495602_0426985 Ga0495602_0426985_58_753 231
222 3300048905 Ga0496102_0113873 Ga0496102_0113873_793_1488 231
223 3300048920 Ga0496117_0054445 Ga0496117_0054445_297_992 231
224 3300048922 Ga0496119_0023426 Ga0496119_0023426_1002_1697 231
225 3300048924 Ga0496121_0000053 Ga0496121_0000053_40967_41662 231
226 3300025949 Ga0207667_10167715 Ga0207667_101677152 232
227 3300041453 Ga0451797_1381995 Ga0451797_1381995_111_833 232
228 3300045051 Ga0451576_0076659 Ga0451576_0076659_513_1211 232
229 3300049823 Ga0501044_0032609 Ga0501044_0032609_2426_3127 232
230 3300003791 Ga0055530_10000014 Ga0055530_1000001449 233
231 3300003794 Ga0055531_10001911 Ga0055531_1000191112 233
232 3300003794 Ga0055531_10044377 Ga0055531_100443772 233
233 3300004625 Ga0055543_1030504 Ga0055543_10305041 233
234 3300005262 Ga0065165_1000147 Ga0065165_100014745 233
235 3300005327 Ga0070658_10623179 Ga0070658_106231791 233
236 3300005331 Ga0070670_100011098 Ga0070670_1000110984 233
237 3300005335 Ga0070666_10351890 Ga0070666_103518901 233
238 3300005336 Ga0070680_100000322 Ga0070680_1000003221 233
239 3300005338 Ga0068868_100545730 Ga0068868_1005457301 233
240 3300005339 Ga0070660_100056562 Ga0070660_1000565626 233
241 3300005339 Ga0070660_100139324 Ga0070660_1001393241 233
242 3300005339 Ga0070660_100209452 Ga0070660_1002094523 233
243 3300005339 Ga0070660_100234756 Ga0070660_1002347562 233
244 3300005353 Ga0070669_100190152 Ga0070669_1001901522 233
245 3300005355 Ga0070671_100015615 Ga0070671_1000156152 233
246 3300005355 Ga0070671_100055126 Ga0070671_1000551262 233
247 3300005355 Ga0070671_100230246 Ga0070671_1002302462 233
248 3300005366 Ga0070659_100000110 Ga0070659_10000011058 233
249 3300005366 Ga0070659_100026952 Ga0070659_1000269526 233
250 3300005366 Ga0070659_100617720 Ga0070659_1006177201 233
251 3300005367 Ga0070667_100398357 Ga0070667_1003983571 233
252 3300005539 Ga0068853_100560580 Ga0068853_1005605801 233
253 3300005539 Ga0068853_100754684 Ga0068853_1007546842 233
254 3300005548 Ga0070665_100000183 Ga0070665_10000018343 233
255 3300005563 Ga0068855_100349957 Ga0068855_1003499572 233
256 3300005564 Ga0070664_100008544 Ga0070664_1000085446 233
257 3300005578 Ga0068854_100410915 Ga0068854_1004109152 233
258 3300005617 Ga0068859_100000523 Ga0068859_10000052330 233
259 3300005617 Ga0068859_100781301 Ga0068859_1007813012 233
260 3300005618 Ga0068864_100064908 Ga0068864_1000649084 233
261 3300005618 Ga0068864_100346060 Ga0068864_1003460602 233
262 3300005719 Ga0068861_100078584 Ga0068861_1000785842 233
263 3300005841 Ga0068863_100001844 Ga0068863_10000184413 233
264 3300005842 Ga0068858_100000494 Ga0068858_10000049437 233
265 3300005842 Ga0068858_100089677 Ga0068858_1000896771 233
266 3300005843 Ga0068860_100000032 Ga0068860_10000003257 233
267 3300005843 Ga0068860_100034017 Ga0068860_1000340172 233
268 3300005844 Ga0068862_100082079 Ga0068862_1000820793 233
269 3300006177 Ga0075362_10151541 Ga0075362_101515412 233
270 3300006881 Ga0068865_100030237 Ga0068865_1000302372 233
271 3300006931 Ga0097620_100000523 Ga0097620_1000005238 233
272 3300006931 Ga0097620_100781359 Ga0097620_1007813592 233
273 3300009093 Ga0105240_10002309 Ga0105240_1000230925 233
274 3300009093 Ga0105240_10002875 Ga0105240_1000287526 233
275 3300009093 Ga0105240_10207218 Ga0105240_102072182 233
276 3300009093 Ga0105240_10274455 Ga0105240_102744551 233
277 3300009093 Ga0105240_10904327 Ga0105240_109043271 233
278 3300009101 Ga0105247_10081790 Ga0105247_100817902 233
279 3300009176 Ga0105242_10100253 Ga0105242_101002532 233
280 3300009176 Ga0105242_11039558 Ga0105242_110395581 233
281 3300009177 Ga0105248_10000125 Ga0105248_1000012547 233
282 3300009177 Ga0105248_10022892 Ga0105248_100228922 233
283 3300009177 Ga0105248_10140229 Ga0105248_101402294 233
284 3300009551 Ga0105238_10076731 Ga0105238_100767315 233
285 3300009551 Ga0105238_10229052 Ga0105238_102290523 233
286 3300010375 Ga0105239_10365047 Ga0105239_103650472 233
287 3300010375 Ga0105239_10593293 Ga0105239_105932931 233
288 3300013100 Ga0157373_10003448 Ga0157373_100034489 233
289 3300013100 Ga0157373_10060849 Ga0157373_100608492 233
290 3300013105 Ga0157369_10328489 Ga0157369_103284892 233
291 3300013296 Ga0157374_10863770 Ga0157374_108637701 233
292 3300013306 Ga0163162_10026067 Ga0163162_100260673 233
293 3300014325 Ga0163163_10036168 Ga0163163_100361682 233
294 3300014325 Ga0163163_10045647 Ga0163163_100456478 233
295 3300014325 Ga0163163_10486221 Ga0163163_104862212 233
296 3300014325 Ga0163163_10557601 Ga0163163_105576012 233
297 3300014325 Ga0163163_10576481 Ga0163163_105764811 233
298 3300014968 Ga0157379_10007006 Ga0157379_100070064 233
299 3300021384 Ga0213876_10000298 Ga0213876_1000029816 233
300 3300025254 Ga0209148_1009085 Ga0209148_10090851 233
301 3300025297 Ga0209758_1001561 Ga0209758_100156119 233
302 3300025298 Ga0209050_1000034 Ga0209050_100003497 233
303 3300025304 Ga0209257_1000052 Ga0209257_1000052313 233
304 3300025304 Ga0209257_1000100 Ga0209257_1000100178 233
305 3300025304 Ga0209257_1001452 Ga0209257_10014522 233
306 3300025903 Ga0207680_10198002 Ga0207680_101980022 233
307 3300025909 Ga0207705_10082001 Ga0207705_100820012 233
308 3300025913 Ga0207695_10001126 Ga0207695_1000112622 233
309 3300025913 Ga0207695_10020016 Ga0207695_100200168 233
310 3300025913 Ga0207695_10028011 Ga0207695_100280115 233
311 3300025913 Ga0207695_10072692 Ga0207695_100726924 233
312 3300025913 Ga0207695_10324944 Ga0207695_103249442 233
313 3300025913 Ga0207695_10927839 Ga0207695_109278391 233
314 3300025917 Ga0207660_10003732 Ga0207660_100037329 233
315 3300025919 Ga0207657_10259585 Ga0207657_102595852 233
316 3300025921 Ga0207652_10101330 Ga0207652_101013304 233
317 3300025924 Ga0207694_10050093 Ga0207694_100500931 233
318 3300025924 Ga0207694_10084657 Ga0207694_100846572 233
319 3300025925 Ga0207650_10034780 Ga0207650_100347803 233
320 3300025931 Ga0207644_10010291 Ga0207644_100102918 233
321 3300025932 Ga0207690_10005622 Ga0207690_100056224 233
322 3300025932 Ga0207690_10010905 Ga0207690_100109056 233
323 3300025932 Ga0207690_10117975 Ga0207690_101179752 233
324 3300025932 Ga0207690_10160324 Ga0207690_101603242 233
325 3300025932 Ga0207690_10507241 Ga0207690_105072411 233
326 3300025938 Ga0207704_10027392 Ga0207704_100273922 233
327 3300025941 Ga0207711_10000560 Ga0207711_1000056018 233
328 3300025941 Ga0207711_10014709 Ga0207711_100147093 233
329 3300025945 Ga0207679_10009476 Ga0207679_100094766 233
330 3300025949 Ga0207667_10220339 Ga0207667_102203393 233
331 3300025972 Ga0207668_10775759 Ga0207668_107757591 233
332 3300025981 Ga0207640_10330025 Ga0207640_103300252 233
333 3300025986 Ga0207658_10174010 Ga0207658_101740102 233
334 3300026035 Ga0207703_10000035 Ga0207703_10000035150 233
335 3300026041 Ga0207639_10146251 Ga0207639_101462512 233
336 3300026088 Ga0207641_10003305 Ga0207641_100033059 233
337 3300026095 Ga0207676_10077342 Ga0207676_100773424 233
338 3300026095 Ga0207676_10496389 Ga0207676_104963892 233
339 3300026118 Ga0207675_100079911 Ga0207675_1000799113 233
340 3300028379 Ga0268266_10000062 Ga0268266_10000062173 233
341 3300028380 Ga0268265_10005382 Ga0268265_1000538210 233
342 3300028380 Ga0268265_10035709 Ga0268265_100357093 233
343 3300028381 Ga0268264_10000045 Ga0268264_10000045295 233
344 3300028381 Ga0268264_10028220 Ga0268264_100282202 233
345 3300028800 Ga0265338_10003962 Ga0265338_100039629 233
346 3300028800 Ga0265338_10063436 Ga0265338_100634363 233
347 3300029957 Ga0265324_10087120 Ga0265324_100871202 233
348 3300030521 Ga0307511_10018037 Ga0307511_100180375 233
349 3300031090 Ga0265760_10023713 Ga0265760_100237132 233
350 3300031247 Ga0265340_10082338 Ga0265340_100823382 233
351 3300031251 Ga0265327_10001235 Ga0265327_1000123514 233
352 3300031251 Ga0265327_10007327 Ga0265327_100073276 233
353 3300031251 Ga0265327_10246684 Ga0265327_102466841 233
354 3300031711 Ga0265314_10032063 Ga0265314_100320633 233
355 3300031712 Ga0265342_10114325 Ga0265342_101143253 233
356 3300032004 Ga0307414_10045059 Ga0307414_100450594 233
357 3300033180 Ga0307510_10210867 Ga0307510_102108672 233
358 3300035113 Ga0373936_0000446 Ga0373936_0000446_6023_6751 233
359 3300035171 Ga0373946_0046383 Ga0373946_0046383_14_739 233
360 3300035695 Ga0373927_0007706 Ga0373927_0007706_3874_4599 233
361 3300035724 Ga0373933_0326570 Ga0373933_0326570_237_971 233
362 3300036401 Ga0373937_0751282 Ga0373937_0751282_10_732 233
363 3300037068 Ga0373925_0013180 Ga0373925_0013180_290_1015 233
364 3300037312 Ga0395899_0001074 Ga0395899_0001074_19954_20670 233
365 3300037312 Ga0395899_0086444 Ga0395899_0086444_463_1164 233
366 3300037418 Ga0395900_0000004 Ga0395900_0000004_484394_485110 233
367 3300037418 Ga0395900_0263462 Ga0395900_0263462_693_1394 233
368 3300037418 Ga0395900_0542341 Ga0395900_0542341_192_896 233
369 3300037466 Ga0395898_0097377 Ga0395898_0097377_1560_2276 233
370 3300037466 Ga0395898_0113524 Ga0395898_0113524_871_1572 233
371 3300037471 Ga0395905_0001052 Ga0395905_0001052_13048_13749 233
372 3300037471 Ga0395905_0002588 Ga0395905_0002588_84_800 233
373 3300037471 Ga0395905_0019738 Ga0395905_0019738_1736_2455 233
374 3300037471 Ga0395905_0024528 Ga0395905_0024528_346_1065 233
375 3300037471 Ga0395905_0121902 Ga0395905_0121902_714_1433 233
376 3300037853 Ga0436364_0307105 Ga0436364_0307105_188_904 233
377 3300037853 Ga0436364_0967927 Ga0436364_0967927_991_1710 233
378 3300038443 Ga0395901_0000005 Ga0395901_0000005_80457_81173 233
379 3300038443 Ga0395901_0054013 Ga0395901_0054013_3051_3773 233
380 3300038443 Ga0395901_0225351 Ga0395901_0225351_400_1101 233
381 3300038443 Ga0395901_0320958 Ga0395901_0320958_67_768 233
382 3300039437 Ga0436365_0142751 Ga0436365_0142751_842_1561 233
383 3300039437 Ga0436365_0749742 Ga0436365_0749742_52272_52988 233
384 3300044693 Ga0466961_0125621 Ga0466961_0125621_792_1511 233
385 3300045049 Ga0466959_0408588 Ga0466959_0408588_12_740 233
386 3300046516 Ga0495628_0212966 Ga0495628_0212966_637_1344 233
387 3300046616 Ga0495668_0022427 Ga0495668_0022427_170_886 233
388 3300046616 Ga0495668_0040854 Ga0495668_0040854_1788_2507 233
389 3300046616 Ga0495668_0090962 Ga0495668_0090962_891_1613 233
390 3300046648 Ga0495611_0025697 Ga0495611_0025697_1101_1820 233
391 3300046684 Ga0495669_0000078 Ga0495669_0000078_19511_20212 233
392 3300046684 Ga0495669_0013418 Ga0495669_0013418_319_1026 233
393 3300046684 Ga0495669_0015785 Ga0495669_0015785_786_1505 233
394 3300046689 Ga0495613_0003549 Ga0495613_0003549_5488_6246 233
395 3300047445 Ga0495677_0031128 Ga0495677_0031128_730_1437 233
396 3300047445 Ga0495677_0079064 Ga0495677_0079064_358_1059 233
397 3300047472 Ga0495686_0017319 Ga0495686_0017319_3380_4099 233
398 3300048090 Ga0495615_0051919 Ga0495615_0051919_288_1019 233
399 3300048915 Ga0496112_0394526 Ga0496112_0394526_354_1073 233
400 3300048918 Ga0496115_0000780 Ga0496115_0000780_1854_2555 233
401 3300048918 Ga0496115_0132445 Ga0496115_0132445_439_1200 233
402 3300048918 Ga0496115_0207263 Ga0496115_0207263_890_1603 233
403 3300048918 Ga0496115_0434125 Ga0496115_0434125_96_800 233
404 3300048918 Ga0496115_0576420 Ga0496115_0576420_140_856 233
405 3300048928 Ga0496125_0054068 Ga0496125_0054068_1809_2645 233
406 3300049581 Ga0501047_0063971 Ga0501047_0063971_356_1087 233
407 3300049581 Ga0501047_0758140 Ga0501047_0758140_72_773 233
408 3300049686 Ga0501257_001513 Ga0501257_001513_2781_3482 233
409 3300049822 Ga0501035_0041903 Ga0501035_0041903_2277_2987 233
410 3300049823 Ga0501044_0013748 Ga0501044_0013748_4094_4804 233
411 3300049823 Ga0501044_0145525 Ga0501044_0145525_1400_2101 233
412 3300049823 Ga0501044_0823536 Ga0501044_0823536_24_737 233
413 3300053078 Ga0495612_0062662 Ga0495612_0062662_26_730 233
414 3300053087 Ga0500643_006902 Ga0500643_006902_2317_3021 233
415 3300053091 Ga0500647_0014093 Ga0500647_0014093_1983_2690 233
416 3300053104 Ga0500556_0119922 Ga0500556_0119922_287_994 233
417 3300053108 Ga0500562_000465 Ga0500562_000465_7437_8138 233
418 3300053108 Ga0500562_000837 Ga0500562_000837_1352_2059 233
419 3300053111 Ga0500572_000183 Ga0500572_000183_5978_6685 233
420 3300053119 Ga0500595_002232 Ga0500595_002232_263_979 233
421 3300053119 Ga0500595_011126 Ga0500595_011126_613_1329 233
422 3300053136 Ga0500559_0000010 Ga0500559_0000010_154207_154914 233
423 3300053153 Ga0500616_0138460 Ga0500616_0138460_315_1016 233
424 3300053154 Ga0500619_103754 Ga0500619_103754_147_854 233
425 3300053730 Ga0500645_004773 Ga0500645_004773_1912_2622 233
426 iso_pu_bacteria 2643221614 2644088141 233
427 iso_pu_bacteria 2643221661 2644343379 233
428 iso_pu_bacteria 2643221666 2644369144 233
429 3300005563 Ga0068855_100115289 Ga0068855_1001152892 235
430 3300025913 Ga0207695_10206827 Ga0207695_102068272 235
431 3300025921 Ga0207652_10037569 Ga0207652_100375695 235
432 3300028563 Ga0265319_1126081 Ga0265319_11260811 235
433 3300028786 Ga0307517_10083135 Ga0307517_100831352 235
434 3300031456 Ga0307513_10308005 Ga0307513_103080052 235
435 3300031730 Ga0307516_10000002 Ga0307516_10000002268 235
436 3300039093 Ga0400489_05820 Ga0400489_05820_260_982 235
437 3300047320 Ga0495672_0062472 Ga0495672_0062472_1028_1750 235
438 3300053177 Ga0500636_0056776 Ga0500636_0056776_598_1347 235
439 3300006178 Ga0075367_10012983 Ga0075367_100129834 236
440 3300031247 Ga0265340_10009717 Ga0265340_100097174 236
441 3300031456 Ga0307513_10005993 Ga0307513_1000599310 236
442 3300050493 nmdc:mga0k408_150403_c1 nmdc:mga0k408_150403_c1_408_1142 236
443 3300050494 nmdc:mga06z11_121895_c1 nmdc:mga06z11_121895_c1_508_1245 236
444 3300053087 Ga0500643_047890 Ga0500643_047890_277_996 236
445 3300003771 Ga0055526_1041379 Ga0055526_10413791 237
446 3300005262 Ga0065165_1053334 Ga0065165_10533342 237
447 3300005336 Ga0070680_100067045 Ga0070680_1000670453 237
448 3300005336 Ga0070680_100428611 Ga0070680_1004286112 237
449 3300005458 Ga0070681_10023877 Ga0070681_100238772 237
450 3300005563 Ga0068855_100918045 Ga0068855_1009180451 237
451 3300005985 Ga0081539_10013687 Ga0081539_100136876 237
452 3300006844 Ga0075428_100001220 Ga0075428_10000122020 237
453 3300006846 Ga0075430_100159653 Ga0075430_1001596531 237
454 3300006847 Ga0075431_100000109 Ga0075431_10000010938 237
455 3300006880 Ga0075429_100022955 Ga0075429_1000229556 237
456 3300009094 Ga0111539_10000684 Ga0111539_1000068424 237
457 3300009101 Ga0105247_10286468 Ga0105247_102864681 237
458 3300009147 Ga0114129_10000425 Ga0114129_1000042534 237
459 3300009553 Ga0105249_11326187 Ga0105249_113261871 237
460 3300014326 Ga0157380_10056306 Ga0157380_100563061 237
461 3300025295 Ga0209564_1001154 Ga0209564_100115420 237
462 3300025302 Ga0207426_1026057 Ga0207426_10260572 237
463 3300025912 Ga0207707_10254862 Ga0207707_102548622 237
464 3300025912 Ga0207707_10319831 Ga0207707_103198311 237
465 3300025917 Ga0207660_10462917 Ga0207660_104629172 237
466 3300026067 Ga0207678_10236482 Ga0207678_102364822 237
467 3300027907 Ga0207428_10006066 Ga0207428_100060665 237
468 3300046460 Ga0495638_0042610 Ga0495638_0042610_562_1275 237
469 3300046691 Ga0495670_0004094 Ga0495670_0004094_3145_3858 237
470 3300048922 Ga0496119_0135311 Ga0496119_0135311_477_1190 237
471 3300048924 Ga0496121_0074671 Ga0496121_0074671_1737_2450 237
472 3300048924 Ga0496121_0298577 Ga0496121_0298577_247_963 237
473 3300048927 Ga0496124_0172386 Ga0496124_0172386_305_1018 237
474 3300049570 Ga0501033_0184312 Ga0501033_0184312_18_749 237
475 3300050491 nmdc:mga00v17_369519_c1 nmdc:mga00v17_369519_c1_107_820 237
476 3300050507 nmdc:mga05p37_268_c1 nmdc:mga05p37_268_c1_36272_36997 237
477 3300050508 nmdc:mga09592_11852_c1 nmdc:mga09592_11852_c1_2719_3444 237
478 3300050509 nmdc:mga0qj67_147564_c1 nmdc:mga0qj67_147564_c1_337_1062 237
479 3300050510 nmdc:mga06r32_133_c1 nmdc:mga06r32_133_c1_15208_15933 237
480 3300050510 nmdc:mga06r32_392835_c1 nmdc:mga06r32_392835_c1_342_1109 237
481 3300050511 nmdc:mga08y16_604_c1 nmdc:mga08y16_604_c1_4800_5525 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03749

SfsA

Sugar fermentation stimulation protein RE domain

116

256

0.97

PF17746

SfsA_N

SfsA N-terminal OB domain

47

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dap-assembly1.cif.gz_A the structure of escherichia coli sfsa 0.954 1 237
4dap-assembly1.cif.gz_A the structure of escherichia coli sfsa 0.9501 1 237
4da2-assembly1.cif.gz_A the structure of pyrococcus furiosus sfsa in complex with ca2+ 0.933 1 237
4da2-assembly1.cif.gz_A the structure of pyrococcus furiosus sfsa in complex with ca2+ 0.9138 1 237
2wg6-assembly2.cif.gz_L proteasome-activating nucleotidase (pan) n-domain (57-134) from archaeoglobus fulgidus fused to gcn4, p61a mutant 0.7857 4 53
ID Description Score Start End Superfamily
4dapA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9715 84 237 3.40.1350.60
4dapA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9652 84 237 3.40.1350.60
4dapA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9233 1 83 2.40.50.580
af_A0A0R4IJY6_29_78_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.9191 10 34 2.30.30.360
4davA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9168 94 237 3.40.1350.60
ID Description Score Start End GO Terms
AF-A0A363TTX0-F1-model_v4 Sugar fermentation stimulation protein homolog 0.9945 1 237 GO:0003677
AF-A0A7V0WM14-F1-model_v4 DNA/RNA nuclease SfsA 0.9928 90 237 GO:0003677
AF-A0A7C6WC17-F1-model_v4 Sugar fermentation stimulation protein SfsA 0.9919 151 236 GO:0003677
AF-A0A7G2M2S4-F1-model_v4 DNA/RNA nuclease SfsA 0.9917 129 237 GO:0003677
AF-A0A2T1HRV5-F1-model_v4 Sugar fermentation stimulation protein homolog 0.99 1 237 GO:0003677

Feature Viewer

pLDDT pTM Quality
95.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map