F452467

General Info

Members Datasets Scaffolds Average Seq Length
481 254 962 215

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0061575|Ga0439460_0061575_109_849
Length 246
Sequence MYDGTAVRLRECPGELGGLAFHHGLQGEVTVFFDKKTRMPSAADALPGRAERMAVPEHHYVNRGAGLEPPFPAGSERALFGMGCFWGAEKKFWSIPGVYTTAVGYAAGFTPNPTYREVCTGMTGHNEVVLVVFDPAKVSYDTLLKTFWENHDPTQGMRQGNDVGTQYRSGIYYFDDAQRVAAERSRDAFQEPLSKKGFGAITTEIIPAPEFYYAEDYHQQYLAKNPDGYCGLGGTGVSCPVGVEVH

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
164 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2884411467 Dyella sp. AD56 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 7.28
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0061575 3300042461 Bacteria 1146
2 Ga0065714_10103888 3300005288 Bacteria 1595
3 Ga0065712_10122021 3300005290 Bacteria 1657
4 Ga0065712_10190635 3300005290 Bacteria 1150
5 Ga0065715_10007950 3300005293 Bacteria 2905
6 Ga0065715_10014612 3300005293 Bacteria 2268
7 Ga0065715_10046191 3300005293 Bacteria 1218
8 Ga0065715_10172756 3300005293 Bacteria 1534
9 Ga0065715_10288430 3300005293 Bacteria 1069
10 Ga0070690_100009771 3300005330 Bacteria 5565
11 Ga0070690_100019863 3300005330 Bacteria 4087
12 Ga0070670_100010745 3300005331 Bacteria 7820
13 Ga0070670_100015274 3300005331 Bacteria 6591
14 Ga0070670_100052793 3300005331 Bacteria 3490
15 Ga0070670_100218264 3300005331 Bacteria 1659
16 Ga0070670_100397672 3300005331 Bacteria 1216
17 Ga0068869_100099453 3300005334 Bacteria 2198
18 Ga0070666_10115351 3300005335 Bacteria 1860
19 Ga0070666_10205956 3300005335 Bacteria 1384
20 Ga0068868_100346930 3300005338 Bacteria 1271
21 Ga0070689_100310068 3300005340 Bacteria 1316
22 Ga0070691_10006204 3300005341 Bacteria 5454
23 Ga0070691_10077878 3300005341 Bacteria 1619
24 Ga0070687_100052501 3300005343 Bacteria 2116
25 Ga0070692_10280399 3300005345 Bacteria 1010
26 Ga0070669_100028950 3300005353 Bacteria 3991
27 Ga0070669_100059778 3300005353 Bacteria 2798
28 Ga0070675_100050424 3300005354 Bacteria 3417
29 Ga0070675_100320495 3300005354 Bacteria 1369
30 Ga0070675_101001928 3300005354 Bacteria 767
31 Ga0070671_100027366 3300005355 Bacteria 4692
32 Ga0070671_100148119 3300005355 Bacteria 1982
33 Ga0070674_100013797 3300005356 Bacteria 5003
34 Ga0070674_100089310 3300005356 Bacteria 2220
35 Ga0070674_100133160 3300005356 Bacteria 1856
36 Ga0070674_100554675 3300005356 Bacteria 965
37 Ga0070674_100623654 3300005356 Bacteria 914
38 Ga0070673_100000230 3300005364 Bacteria 28084
39 Ga0070673_100045581 3300005364 Bacteria 3401
40 Ga0070673_100616204 3300005364 Bacteria 991
41 Ga0070673_100733397 3300005364 Bacteria 909
42 Ga0070688_100298517 3300005365 Bacteria 1164
43 Ga0070688_100767184 3300005365 Bacteria 752
44 Ga0070659_100167820 3300005366 Bacteria 1797
45 Ga0070667_100401886 3300005367 Bacteria 1247
46 Ga0070714_100037137 3300005435 Bacteria 4092
47 Ga0070700_100072706 3300005441 Bacteria 2199
48 Ga0070700_100169008 3300005441 Bacteria 1513
49 Ga0070694_100212421 3300005444 Bacteria 1448
50 Ga0070694_100669076 3300005444 Bacteria 842
51 Ga0070678_100100045 3300005456 Bacteria 2245
52 Ga0070678_100358061 3300005456 Bacteria 1256
53 Ga0068867_100043138 3300005459 Bacteria 3301
54 Ga0068867_100067132 3300005459 Bacteria 2673
55 Ga0070706_100046377 3300005467 Bacteria 4012
56 Ga0070706_100222233 3300005467 Bacteria 1763
57 Ga0070706_100319171 3300005467 Bacteria 1449
58 Ga0070707_100012329 3300005468 Bacteria 7981
59 Ga0070707_100923184 3300005468 Bacteria 838
60 Ga0070698_100022494 3300005471 Bacteria 6595
61 Ga0070698_100167000 3300005471 Bacteria 2143
62 Ga0070699_100734605 3300005518 Bacteria 902
63 Ga0070684_100009628 3300005535 Bacteria 7617
64 Ga0070684_100468790 3300005535 Bacteria 1165
65 Ga0070697_100020110 3300005536 Bacteria 5276
66 Ga0070672_100003692 3300005543 Bacteria 9953
67 Ga0070672_100099607 3300005543 Bacteria 2356
68 Ga0070672_100126385 3300005543 Bacteria 2097
69 Ga0070686_100003448 3300005544 Bacteria 8672
70 Ga0070686_100032305 3300005544 Bacteria 3208
71 Ga0070695_100081792 3300005545 Bacteria 2138
72 Ga0070695_100786112 3300005545 Bacteria 762
73 Ga0070696_100043118 3300005546 Bacteria 3121
74 Ga0070696_100180178 3300005546 Bacteria 1567
75 Ga0070704_100042339 3300005549 Bacteria 3149
76 Ga0070704_100075514 3300005549 Bacteria 2462
77 Ga0070704_100174055 3300005549 Bacteria 1715
78 Ga0068855_100000020 3300005563 Bacteria 205600
79 Ga0068855_100142094 3300005563 Bacteria 2735
80 Ga0070664_100195724 3300005564 Bacteria 1802
81 Ga0070664_100971397 3300005564 Bacteria 798
82 Ga0068854_100033330 3300005578 Bacteria 3591
83 Ga0068854_100048457 3300005578 Bacteria 3032
84 Ga0068856_100175277 3300005614 Bacteria 2157
85 Ga0070702_100009403 3300005615 Bacteria 4781
86 Ga0068852_100015665 3300005616 Bacteria 5889
87 Ga0068859_100077495 3300005617 Bacteria 3365
88 Ga0068859_100410501 3300005617 Bacteria 1450
89 Ga0068859_100838672 3300005617 Bacteria 1005
90 Ga0068864_100020458 3300005618 Bacteria 5537
91 Ga0068861_100201280 3300005719 Bacteria 1672
92 Ga0068861_100853793 3300005719 Bacteria 858
93 Ga0068863_100009357 3300005841 Bacteria 9560
94 Ga0068863_100257804 3300005841 Bacteria 1685
95 Ga0068858_100059455 3300005842 Bacteria 3532
96 Ga0068860_100124241 3300005843 Bacteria 2473
97 Ga0068860_100144432 3300005843 Bacteria 2289
98 Ga0068860_100956115 3300005843 Bacteria 874
99 Ga0068862_100005804 3300005844 Bacteria 10292
100 Ga0068862_100080805 3300005844 Bacteria 2819
101 Ga0068862_100406639 3300005844 Bacteria 1274
102 Ga0075365_10005483 3300006038 Bacteria 6846
103 Ga0075364_10140284 3300006051 Bacteria 1625
104 Ga0075364_10177499 3300006051 Bacteria 1441
105 Ga0070715_10013503 3300006163 Bacteria 3003
106 Ga0075362_10006371 3300006177 Bacteria 4397
107 Ga0075367_10005567 3300006178 Bacteria 6274
108 Ga0075366_10002867 3300006195 Bacteria 8940
109 Ga0097621_100047215 3300006237 Bacteria 3489
110 Ga0075370_10070070 3300006353 Bacteria 2005
111 Ga0068871_100174405 3300006358 Bacteria 1845
112 Ga0068871_100504690 3300006358 Bacteria 1091
113 Ga0075428_100001268 3300006844 Bacteria 26917
114 Ga0075428_100029543 3300006844 Bacteria 6064
115 Ga0075428_100050665 3300006844 Bacteria 4553
116 Ga0075428_100216628 3300006844 Bacteria 2068
117 Ga0075430_100001374 3300006846 Bacteria 19748
118 Ga0075430_100008268 3300006846 Bacteria 8787
119 Ga0075430_100013436 3300006846 Bacteria 6979
120 Ga0075430_100176791 3300006846 Bacteria 1776
121 Ga0075431_100015249 3300006847 Bacteria 7789
122 Ga0075431_100016233 3300006847 Bacteria 7555
123 Ga0075431_100036925 3300006847 Bacteria 5033
124 Ga0075431_100042367 3300006847 Bacteria 4695
125 Ga0075431_100046244 3300006847 Bacteria 4487
126 Ga0075431_100141821 3300006847 Bacteria 2477
127 Ga0075431_100439836 3300006847 Bacteria 1301
128 Ga0075431_100476074 3300006847 Bacteria 1242
129 Ga0075433_10606504 3300006852 Bacteria 961
130 Ga0075434_100175502 3300006871 Bacteria 2163
131 Ga0075434_100750429 3300006871 Bacteria 993
132 Ga0075429_100000089 3300006880 Bacteria 48621
133 Ga0075429_100121834 3300006880 Bacteria 2280
134 Ga0075429_100179022 3300006880 Bacteria 1858
135 Ga0097620_100077496 3300006931 Bacteria 3365
136 Ga0097620_100410576 3300006931 Bacteria 1450
137 Ga0097620_100838695 3300006931 Bacteria 1005
138 Ga0075435_100000921 3300007076 Bacteria 18545
139 Ga0075435_100001592 3300007076 Bacteria 14638
140 Ga0105244_10017776 3300009036 Bacteria 4008
141 Ga0105240_10001824 3300009093 Bacteria 35727
142 Ga0105240_10001947 3300009093 Bacteria 34195
143 Ga0105240_10150970 3300009093 Bacteria 2767
144 Ga0111539_10015503 3300009094 Bacteria 9475
145 Ga0111539_10038204 3300009094 Bacteria 5791
146 Ga0111539_10059597 3300009094 Bacteria 4526
147 Ga0111539_10274621 3300009094 Bacteria 1961
148 Ga0105247_10359282 3300009101 Bacteria 1026
149 Ga0114129_10000560 3300009147 Bacteria 45696
150 Ga0114129_10001248 3300009147 Bacteria 33903
151 Ga0114129_10006782 3300009147 Bacteria 16257
152 Ga0114129_10011233 3300009147 Bacteria 12767
153 Ga0114129_10013318 3300009147 Bacteria 11721
154 Ga0114129_10041432 3300009147 Bacteria 6488
155 Ga0105243_10015492 3300009148 Bacteria 5764
156 Ga0105241_10928640 3300009174 Bacteria 810
157 Ga0105242_10242237 3300009176 Bacteria 1622
158 Ga0105248_10264033 3300009177 Bacteria 1938
159 Ga0105249_10145529 3300009553 Bacteria 2276
160 Ga0105239_10870421 3300010375 Bacteria 1034
161 Ga0105246_10420552 3300011119 Bacteria 1115
162 Ga0105246_10474373 3300011119 Bacteria 1057
163 Ga0157371_10000508 3300013102 Bacteria 46925
164 Ga0157378_11237796 3300013297 Bacteria 786
165 Ga0163162_10200893 3300013306 Bacteria 2122
166 Ga0157375_10335524 3300013308 Bacteria 1677
167 Ga0157375_11495444 3300013308 Bacteria 797
168 Ga0157380_10106492 3300014326 Bacteria 2346
169 Ga0157380_10208805 3300014326 Bacteria 1738
170 Ga0157380_10721869 3300014326 Bacteria 1004
171 Ga0157377_10393723 3300014745 Bacteria 942
172 Ga0157379_10193797 3300014968 Bacteria 1836
173 Ga0157379_10320899 3300014968 Bacteria 1414
174 Ga0163161_10435694 3300017792 Bacteria 1057
175 Ga0207697_10000977 3300025315 Bacteria 16038
176 Ga0207697_10037474 3300025315 Bacteria 1986
177 Ga0207642_10190516 3300025899 Bacteria 1125
178 Ga0207688_10010076 3300025901 Bacteria 5140
179 Ga0207688_10150546 3300025901 Bacteria 1374
180 Ga0207680_10291107 3300025903 Bacteria 1136
181 Ga0207645_10001873 3300025907 Bacteria 16988
182 Ga0207645_10066213 3300025907 Bacteria 2309
183 Ga0207684_10026889 3300025910 Bacteria 4906
184 Ga0207684_10321477 3300025910 Bacteria 1334
185 Ga0207684_10802868 3300025910 Bacteria 795
186 Ga0207695_10001022 3300025913 Bacteria 49260
187 Ga0207695_10001062 3300025913 Bacteria 48136
188 Ga0207695_10162830 3300025913 Bacteria 2161
189 Ga0207663_10330089 3300025916 Bacteria 1149
190 Ga0207662_10010101 3300025918 Bacteria 5202
191 Ga0207662_10091723 3300025918 Bacteria 1869
192 Ga0207681_10011138 3300025923 Bacteria 5523
193 Ga0207681_10035400 3300025923 Bacteria 3290
194 Ga0207681_10145549 3300025923 Bacteria 1770
195 Ga0207681_10167021 3300025923 Bacteria 1664
196 Ga0207681_10206554 3300025923 Bacteria 1511
197 Ga0207650_10040506 3300025925 Bacteria 3409
198 Ga0207650_10051522 3300025925 Bacteria 3046
199 Ga0207650_10144878 3300025925 Bacteria 1870
200 Ga0207650_10443081 3300025925 Bacteria 1080
201 Ga0207659_10040622 3300025926 Bacteria 3254
202 Ga0207659_10204602 3300025926 Bacteria 1579
203 Ga0207659_10311064 3300025926 Bacteria 1297
204 Ga0207687_10147178 3300025927 Bacteria 1793
205 Ga0207687_10215199 3300025927 Bacteria 1509
206 Ga0207664_10087414 3300025929 Bacteria 2548
207 Ga0207644_10014460 3300025931 Bacteria 5278
208 Ga0207706_10024925 3300025933 Bacteria 5362
209 Ga0207686_10025908 3300025934 Bacteria 3418
210 Ga0207709_10181724 3300025935 Bacteria 1486
211 Ga0207670_10117591 3300025936 Bacteria 1927
212 Ga0207669_10010036 3300025937 Bacteria 4542
213 Ga0207669_10044349 3300025937 Bacteria 2612
214 Ga0207669_10168988 3300025937 Bacteria 1554
215 Ga0207669_10176475 3300025937 Bacteria 1527
216 Ga0207691_10024403 3300025940 Bacteria 5687
217 Ga0207691_10028108 3300025940 Bacteria 5267
218 Ga0207691_10067616 3300025940 Bacteria 3230
219 Ga0207691_10079264 3300025940 Bacteria 2956
220 Ga0207711_10016577 3300025941 Bacteria 6118
221 Ga0207711_10035474 3300025941 Bacteria 4227
222 Ga0207711_10483236 3300025941 Bacteria 1154
223 Ga0207661_10045599 3300025944 Bacteria 3471
224 Ga0207679_10291307 3300025945 Bacteria 1403
225 Ga0207679_10444456 3300025945 Bacteria 1149
226 Ga0207679_10554487 3300025945 Bacteria 1031
227 Ga0207667_10000284 3300025949 Bacteria 69687
228 Ga0207667_10013723 3300025949 Bacteria 9260
229 Ga0207651_10029336 3300025960 Bacteria 3484
230 Ga0207651_10071679 3300025960 Bacteria 2457
231 Ga0207651_10381926 3300025960 Bacteria 1194
232 Ga0207640_10036391 3300025981 Bacteria 3090
233 Ga0207640_10198159 3300025981 Bacteria 1519
234 Ga0207658_10119502 3300025986 Bacteria 2098
235 Ga0207677_10087361 3300026023 Bacteria 2257
236 Ga0207703_10825344 3300026035 Bacteria 886
237 Ga0207708_10002994 3300026075 Bacteria 12449
238 Ga0207708_10037080 3300026075 Bacteria 3713
239 Ga0207708_10099170 3300026075 Bacteria 2253
240 Ga0207708_10100235 3300026075 Bacteria 2241
241 Ga0207641_10013460 3300026088 Bacteria 6708
242 Ga0207648_10007515 3300026089 Bacteria 10699
243 Ga0207648_10025765 3300026089 Bacteria 5235
244 Ga0207676_10030014 3300026095 Bacteria 4076
245 Ga0207676_10092628 3300026095 Bacteria 2486
246 Ga0207675_100002479 3300026118 Bacteria 18274
247 Ga0207675_100035133 3300026118 Bacteria 4675
248 Ga0207675_100202374 3300026118 Bacteria 1907
249 Ga0207675_100398449 3300026118 Bacteria 1356
250 Ga0207675_100533647 3300026118 Bacteria 1171
251 Ga0207683_10046610 3300026121 Bacteria 3794
252 Ga0207683_10639990 3300026121 Bacteria 985
253 Ga0207698_10010742 3300026142 Bacteria 5906
254 Ga0207698_10122780 3300026142 Bacteria 2202
255 Ga0207428_10011356 3300027907 Bacteria 7876
256 Ga0207428_10076430 3300027907 Bacteria 2622
257 Ga0207428_10578127 3300027907 Bacteria 811
258 Ga0268266_10232850 3300028379 Bacteria 1697
259 Ga0268265_10029829 3300028380 Bacteria 3922
260 Ga0268265_10202768 3300028380 Bacteria 1722
261 Ga0268265_10364604 3300028380 Bacteria 1324
262 Ga0268265_10911691 3300028380 Bacteria 863
263 Ga0268264_10018040 3300028381 Bacteria 5771
264 Ga0268264_10203030 3300028381 Bacteria 1815
265 Ga0268264_10235514 3300028381 Bacteria 1693
266 Ga0265320_10031588 3300031240 Bacteria 2718
267 Ga0265325_10135235 3300031241 Bacteria 1177
268 Ga0316579_10017307 3300031691 Bacteria 3159
269 Ga0316579_10145744 3300031691 Bacteria 1142
270 Ga0316578_10079624 3300031728 Bacteria 1948
271 Ga0307413_10009208 3300031824 Bacteria 4716
272 Ga0307410_10078543 3300031852 Bacteria 2310
273 Ga0307406_10050687 3300031901 Bacteria 2633
274 Ga0307407_10011116 3300031903 Bacteria 4273
275 Ga0307412_10201577 3300031911 Bacteria 1511
276 Ga0307416_100049637 3300032002 Bacteria 3338
277 Ga0307416_100124121 3300032002 Bacteria 2309
278 Ga0307416_100333612 3300032002 Bacteria 1525
279 Ga0307414_10190762 3300032004 Bacteria 1658
280 Ga0307414_10690570 3300032004 Bacteria 923
281 Ga0307411_10309660 3300032005 Bacteria 1270
282 Ga0316583_10026560 3300032133 Bacteria 2067
283 Ga0316583_10046929 3300032133 Bacteria 1524
284 Ga0316585_10062284 3300032137 Bacteria 1206
285 Ga0316593_10099329 3300032168 Bacteria 1031
286 Ga0373923_0131030 3300035111 Bacteria 1127
287 Ga0373956_0062982 3300035119 Bacteria 1681
288 Ga0373957_0079723 3300035120 Bacteria 1291
289 Ga0316574_0060251 3300035398 Bacteria 2382
290 Ga0373935_0019999 3300035692 Bacteria 4087
291 Ga0373933_0184672 3300035724 Bacteria 1331
292 Ga0373937_0083448 3300036401 Bacteria 2956
293 Ga0373937_0085931 3300036401 Bacteria 2911
294 Ga0316582_0003693 3300036647 Bacteria 7569
295 Ga0316582_0010005 3300036647 Bacteria 5175
296 Ga0316582_0022514 3300036647 Bacteria 3742
297 Ga0316584_0046710 3300036712 Bacteria 3234
298 Ga0373925_0115543 3300037068 Bacteria 2078
299 Ga0395900_0143001 3300037418 Bacteria 2448
300 Ga0395898_0341381 3300037466 Bacteria 1428
301 Ga0316581_0012362 3300037588 Bacteria 2402
302 Ga0395901_0013290 3300038443 Bacteria 8363
303 Ga0395901_0229316 3300038443 Bacteria 1939
304 Ga0451793_1511062 3300041452 Bacteria 1738
305 Ga0451800_0103001 3300041459 Bacteria 2652
306 Ga0451806_368013 3300041462 Bacteria 2761
307 Ga0451807_2416547 3300041486 Bacteria 5797
308 Ga0439450_009275 3300042008 Bacteria 1864
309 Ga0450895_000808 3300042132 Bacteria 1976
310 Ga0450896_000100 3300042133 Bacteria 6155
311 Ga0439435_0165285 3300042436 Bacteria 716
312 Ga0439464_0000036 3300042439 Bacteria 16789
313 Ga0451577_0002652 3300042876 Bacteria 20952
314 Ga0451577_0028088 3300042876 Bacteria 5090
315 Ga0451577_0645008 3300042876 Bacteria 960
316 Ga0453684_0285070 3300044712 Bacteria 1882
317 Ga0495651_0200682 3300046462 Bacteria 1396
318 Ga0495653_0257534 3300046463 Bacteria 1155
319 Ga0495580_0271179 3300046472 Bacteria 1159
320 Ga0495582_0457972 3300046473 Bacteria 737
321 Ga0495664_0078311 3300046477 Bacteria 1980
322 Ga0495608_0230688 3300046511 Bacteria 1159
323 Ga0495652_0086804 3300046529 Bacteria 2568
324 Ga0495652_0204315 3300046529 Bacteria 1497
325 Ga0495586_0080440 3300046535 Bacteria 1790
326 Ga0495645_0027324 3300046543 Bacteria 4145
327 Ga0495667_0114133 3300046559 Bacteria 1746
328 Ga0495634_0106213 3300046642 Bacteria 1809
329 Ga0495635_0268143 3300046663 Bacteria 1149
330 Ga0495599_0246910 3300046678 Bacteria 1087
331 Ga0495674_0038400 3300047319 Bacteria 4298
332 Ga0495674_0118556 3300047319 Bacteria 2238
333 Ga0495672_0097781 3300047320 Bacteria 1598
334 Ga0495684_0082902 3300047471 Bacteria 2432
335 Ga0495602_0164449 3300048088 Bacteria 1729
336 Ga0496100_0015468 3300048903 Bacteria 4457
337 Ga0496100_0403127 3300048903 Bacteria 1042
338 Ga0496100_0535132 3300048903 Bacteria 905
339 Ga0496100_0599385 3300048903 Bacteria 855
340 Ga0496101_0000820 3300048904 Bacteria 18321
341 Ga0496102_0104373 3300048905 Bacteria 2636
342 Ga0496102_0534392 3300048905 Bacteria 1095
343 Ga0496103_0564173 3300048906 Bacteria 726
344 Ga0496104_0250834 3300048907 Bacteria 1682
345 Ga0496105_0170473 3300048908 Bacteria 1784
346 Ga0496106_0138655 3300048909 Bacteria 1912
347 Ga0496106_0235359 3300048909 Bacteria 1463
348 Ga0496106_0245605 3300048909 Bacteria 1430
349 Ga0496107_0025261 3300048910 Bacteria 4205
350 Ga0496107_0050201 3300048910 Bacteria 3007
351 Ga0496107_0096791 3300048910 Bacteria 2160
352 Ga0496108_0256407 3300048911 Bacteria 1522
353 Ga0496109_0153909 3300048912 Bacteria 2154
354 Ga0496109_0434713 3300048912 Bacteria 1240
355 Ga0496109_0953383 3300048912 Bacteria 796
356 Ga0496110_0057895 3300048913 Bacteria 3413
357 Ga0496110_0235101 3300048913 Bacteria 1667
358 Ga0496110_0655333 3300048913 Bacteria 950
359 Ga0496111_0503877 3300048914 Bacteria 891
360 Ga0496112_0071569 3300048915 Bacteria 3427
361 Ga0496112_0166353 3300048915 Bacteria 2171
362 Ga0496112_0373729 3300048915 Bacteria 1367
363 Ga0496113_0162249 3300048916 Bacteria 1767
364 Ga0496114_0000371 3300048917 Bacteria 33092
365 Ga0496114_0074575 3300048917 Bacteria 2856
366 Ga0496114_0519807 3300048917 Bacteria 1053
367 Ga0496117_0053334 3300048920 Bacteria 2842
368 Ga0496118_0001339 3300048921 Bacteria 37382
369 Ga0496119_0003206 3300048922 Bacteria 17141
370 Ga0496120_0000708 3300048923 Bacteria 48913
371 Ga0496121_0005127 3300048924 Bacteria 17063
372 Ga0496121_0026560 3300048924 Bacteria 5449
373 Ga0496121_0029488 3300048924 Bacteria 5072
374 Ga0496125_0174777 3300048928 Bacteria 1438
375 Ga0496126_0000411 3300048929 Bacteria 86952
376 Ga0496126_0029301 3300048929 Bacteria 5231
377 Ga0501031_0219318 3300049568 Bacteria 1239
378 Ga0501033_0193430 3300049570 Bacteria 1455
379 Ga0501034_0026128 3300049571 Bacteria 5946
380 Ga0501034_0191048 3300049571 Bacteria 2010
381 Ga0501036_0234873 3300049572 Bacteria 1538
382 Ga0501037_0158234 3300049573 Bacteria 1616
383 Ga0501038_0141340 3300049574 Bacteria 1969
384 Ga0501039_0104416 3300049575 Bacteria 2212
385 Ga0501039_0245114 3300049575 Bacteria 1409
386 Ga0501040_0025722 3300049576 Bacteria 3959
387 Ga0501041_0181801 3300049577 Bacteria 1316
388 Ga0501042_0109795 3300049578 Bacteria 1986
389 Ga0501042_0222166 3300049578 Bacteria 1362
390 Ga0501042_0375963 3300049578 Bacteria 1028
391 Ga0501048_0081987 3300049582 Bacteria 2275
392 Ga0501048_0158336 3300049582 Bacteria 1602
393 Ga0501048_0292704 3300049582 Bacteria 1158
394 Ga0501068_0294963 3300049584 Bacteria 1037
395 Ga0501071_0021132 3300049587 Bacteria 4533
396 Ga0501071_0196894 3300049587 Bacteria 1513
397 Ga0501071_0669291 3300049587 Bacteria 799
398 Ga0501072_0013302 3300049588 Bacteria 6300
399 Ga0501072_0020149 3300049588 Bacteria 5164
400 Ga0501072_0159578 3300049588 Bacteria 1799
401 Ga0501074_0021602 3300049590 Bacteria 4673
402 Ga0501074_0113265 3300049590 Bacteria 1941
403 Ga0501074_0547752 3300049590 Bacteria 819
404 Ga0501075_0018506 3300049591 Bacteria 5043
405 Ga0501075_0051444 3300049591 Bacteria 3097
406 Ga0501075_0073953 3300049591 Bacteria 2578
407 Ga0501075_0114222 3300049591 Bacteria 2053
408 Ga0501075_0176788 3300049591 Bacteria 1629
409 Ga0501075_0211573 3300049591 Bacteria 1479
410 Ga0501076_0003180 3300049592 Bacteria 11461
411 Ga0501076_0033612 3300049592 Bacteria 4004
412 Ga0501076_0071218 3300049592 Bacteria 2781
413 Ga0501076_0189207 3300049592 Bacteria 1679
414 Ga0501076_0300661 3300049592 Bacteria 1315
415 Ga0501077_0036903 3300049593 Bacteria 3114
416 Ga0501235_075107 3300049669 Bacteria 803
417 Ga0501249_028146 3300049679 Bacteria 1245
418 Ga0501079_0023334 3300049741 Bacteria 4748
419 Ga0501079_0025891 3300049741 Bacteria 4500
420 Ga0501079_0030669 3300049741 Bacteria 4132
421 Ga0501079_0106650 3300049741 Bacteria 2174
422 Ga0501079_0771001 3300049741 Bacteria 757
423 Ga0501080_0223877 3300049742 Bacteria 1721
424 Ga0501081_0012071 3300049743 Bacteria 5661
425 Ga0501081_0188047 3300049743 Bacteria 1495
426 Ga0501083_0144248 3300049744 Bacteria 1559
427 Ga0501044_0766322 3300049823 Bacteria 846
428 Ga0501045_0018246 3300049824 Bacteria 4989
429 Ga0501045_0198841 3300049824 Bacteria 1493
430 Ga0501045_0277910 3300049824 Bacteria 1247
431 nmdc:mga00v17_41801_c1 3300050491 Bacteria 2755
432 nmdc:mga0yw44_9822_c1 3300050492 Bacteria 4859
433 nmdc:mga0k408_78627_c1 3300050493 Bacteria 1930
434 nmdc:mga05p37_181921_c1 3300050507 Bacteria 2557
435 nmdc:mga05p37_4082_c1 3300050507 Bacteria 17066
436 nmdc:mga05p37_41327_c1 3300050507 Bacteria 5661
437 nmdc:mga05p37_7527_c1 3300050507 Bacteria 12837
438 nmdc:mga05p37_7928_c1 3300050507 Bacteria 12534
439 nmdc:mga09592_100242_c1 3300050508 Bacteria 2480
440 nmdc:mga09592_1279_c1 3300050508 Bacteria 20185
441 nmdc:mga09592_1478_c1 3300050508 Bacteria 18879
442 nmdc:mga0qj67_11126_c1 3300050509 Bacteria 6739
443 nmdc:mga0qj67_36569_c1 3300050509 Bacteria 3842
444 nmdc:mga0qj67_370_c1 3300050509 Bacteria 30896
445 nmdc:mga0qj67_49059_c1 3300050509 Bacteria 3337
446 nmdc:mga0qj67_527109_c1 3300050509 Bacteria 948
447 nmdc:mga06r32_39911_c1 3300050510 Bacteria 4456
448 nmdc:mga06r32_41269_c1 3300050510 Bacteria 4383
449 nmdc:mga06r32_42905_c1 3300050510 Bacteria 4303
450 nmdc:mga06r32_473956_c1 3300050510 Bacteria 1230
451 nmdc:mga06r32_612480_c1 3300050510 Bacteria 1059
452 nmdc:mga06r32_840553_c1 3300050510 Bacteria 877
453 nmdc:mga06r32_84447_c1 3300050510 Bacteria 3094
454 nmdc:mga08y16_1824_c1 3300050511 Bacteria 21611
455 nmdc:mga08y16_4174_c1 3300050511 Bacteria 15088
456 nmdc:mga08y16_71729_c1 3300050511 Bacteria 3609
457 nmdc:mga08y16_760926_c1 3300050511 Bacteria 964
458 nmdc:mga0n895_55923_c1 3300050512 Bacteria 3885
459 nmdc:mga0rr50_13460_c1 3300050513 Bacteria 5327
460 nmdc:mga0rr50_8970_c1 3300050513 Bacteria 6255
461 nmdc:mga0a205_17314_c2 3300050515 Bacteria 4725
462 nmdc:mga0a205_951261_c1 3300050515 Bacteria 706
463 Ga0495601_0032631 3300053077 Bacteria 3242
464 Ga0495601_0094229 3300053077 Bacteria 1930
465 Ga0495595_0112847 3300053084 Bacteria 1319
466 Ga0495619_0048528 3300053085 Bacteria 2798
467 Ga0495619_0061953 3300053085 Bacteria 2490
468 Ga0501084_0014358 3300054114 Bacteria 6563
469 Ga0501084_0021984 3300054114 Bacteria 5321
470 Ga0590074_001367 3300059423 Bacteria 3909
471 Ga0590075_004474 3300059424 Bacteria 3310
472 Ga0590077_007481 3300059426 Bacteria 2234
473 Ga0501082_0014839 3300060353 Bacteria 6712
474 Ga0501082_0039643 3300060353 Bacteria 4063
475 Ga0501082_0454400 3300060353 Bacteria 1119
476 Ga0501082_0856971 3300060353 Bacteria 795
477 Ga0530510_0028667 3300061734 Bacteria 3992
478 Ga0530510_0095235 3300061734 Bacteria 2175
479 Ga0530510_0257873 3300061734 Bacteria 1300
480 Ga0530510_0369948 3300061734 Bacteria 1078
481 2884411629 2884411467 Bacteria 5246714
482 Ga0439460_0061575
483 Ga0065714_10103888
484 Ga0065712_10122021
485 Ga0065712_10190635
486 Ga0065715_10007950
487 Ga0065715_10014612
488 Ga0065715_10046191
489 Ga0065715_10172756
490 Ga0065715_10288430
491 Ga0070690_100009771
492 Ga0070690_100019863
493 Ga0070670_100010745
494 Ga0070670_100015274
495 Ga0070670_100052793
496 Ga0070670_100218264
497 Ga0070670_100397672
498 Ga0068869_100099453
499 Ga0070666_10115351
500 Ga0070666_10205956
501 Ga0068868_100346930
502 Ga0070689_100310068
503 Ga0070691_10006204
504 Ga0070691_10077878
505 Ga0070687_100052501
506 Ga0070692_10280399
507 Ga0070669_100028950
508 Ga0070669_100059778
509 Ga0070675_100050424
510 Ga0070675_100320495
511 Ga0070675_101001928
512 Ga0070671_100027366
513 Ga0070671_100148119
514 Ga0070674_100013797
515 Ga0070674_100089310
516 Ga0070674_100133160
517 Ga0070674_100554675
518 Ga0070674_100623654
519 Ga0070673_100000230
520 Ga0070673_100045581
521 Ga0070673_100616204
522 Ga0070673_100733397
523 Ga0070688_100298517
524 Ga0070688_100767184
525 Ga0070659_100167820
526 Ga0070667_100401886
527 Ga0070714_100037137
528 Ga0070700_100072706
529 Ga0070700_100169008
530 Ga0070694_100212421
531 Ga0070694_100669076
532 Ga0070678_100100045
533 Ga0070678_100358061
534 Ga0068867_100043138
535 Ga0068867_100067132
536 Ga0070706_100046377
537 Ga0070706_100222233
538 Ga0070706_100319171
539 Ga0070707_100012329
540 Ga0070707_100923184
541 Ga0070698_100022494
542 Ga0070698_100167000
543 Ga0070699_100734605
544 Ga0070684_100009628
545 Ga0070684_100468790
546 Ga0070697_100020110
547 Ga0070672_100003692
548 Ga0070672_100099607
549 Ga0070672_100126385
550 Ga0070686_100003448
551 Ga0070686_100032305
552 Ga0070695_100081792
553 Ga0070695_100786112
554 Ga0070696_100043118
555 Ga0070696_100180178
556 Ga0070704_100042339
557 Ga0070704_100075514
558 Ga0070704_100174055
559 Ga0068855_100000020
560 Ga0068855_100142094
561 Ga0070664_100195724
562 Ga0070664_100971397
563 Ga0068854_100033330
564 Ga0068854_100048457
565 Ga0068856_100175277
566 Ga0070702_100009403
567 Ga0068852_100015665
568 Ga0068859_100077495
569 Ga0068859_100410501
570 Ga0068859_100838672
571 Ga0068864_100020458
572 Ga0068861_100201280
573 Ga0068861_100853793
574 Ga0068863_100009357
575 Ga0068863_100257804
576 Ga0068858_100059455
577 Ga0068860_100124241
578 Ga0068860_100144432
579 Ga0068860_100956115
580 Ga0068862_100005804
581 Ga0068862_100080805
582 Ga0068862_100406639
583 Ga0075365_10005483
584 Ga0075364_10140284
585 Ga0075364_10177499
586 Ga0070715_10013503
587 Ga0075362_10006371
588 Ga0075367_10005567
589 Ga0075366_10002867
590 Ga0097621_100047215
591 Ga0075370_10070070
592 Ga0068871_100174405
593 Ga0068871_100504690
594 Ga0075428_100001268
595 Ga0075428_100029543
596 Ga0075428_100050665
597 Ga0075428_100216628
598 Ga0075430_100001374
599 Ga0075430_100008268
600 Ga0075430_100013436
601 Ga0075430_100176791
602 Ga0075431_100015249
603 Ga0075431_100016233
604 Ga0075431_100036925
605 Ga0075431_100042367
606 Ga0075431_100046244
607 Ga0075431_100141821
608 Ga0075431_100439836
609 Ga0075431_100476074
610 Ga0075433_10606504
611 Ga0075434_100175502
612 Ga0075434_100750429
613 Ga0075429_100000089
614 Ga0075429_100121834
615 Ga0075429_100179022
616 Ga0097620_100077496
617 Ga0097620_100410576
618 Ga0097620_100838695
619 Ga0075435_100000921
620 Ga0075435_100001592
621 Ga0105244_10017776
622 Ga0105240_10001824
623 Ga0105240_10001947
624 Ga0105240_10150970
625 Ga0111539_10015503
626 Ga0111539_10038204
627 Ga0111539_10059597
628 Ga0111539_10274621
629 Ga0105247_10359282
630 Ga0114129_10000560
631 Ga0114129_10001248
632 Ga0114129_10006782
633 Ga0114129_10011233
634 Ga0114129_10013318
635 Ga0114129_10041432
636 Ga0105243_10015492
637 Ga0105241_10928640
638 Ga0105242_10242237
639 Ga0105248_10264033
640 Ga0105249_10145529
641 Ga0105239_10870421
642 Ga0105246_10420552
643 Ga0105246_10474373
644 Ga0157371_10000508
645 Ga0157378_11237796
646 Ga0163162_10200893
647 Ga0157375_10335524
648 Ga0157375_11495444
649 Ga0157380_10106492
650 Ga0157380_10208805
651 Ga0157380_10721869
652 Ga0157377_10393723
653 Ga0157379_10193797
654 Ga0157379_10320899
655 Ga0163161_10435694
656 Ga0207697_10000977
657 Ga0207697_10037474
658 Ga0207642_10190516
659 Ga0207688_10010076
660 Ga0207688_10150546
661 Ga0207680_10291107
662 Ga0207645_10001873
663 Ga0207645_10066213
664 Ga0207684_10026889
665 Ga0207684_10321477
666 Ga0207684_10802868
667 Ga0207695_10001022
668 Ga0207695_10001062
669 Ga0207695_10162830
670 Ga0207663_10330089
671 Ga0207662_10010101
672 Ga0207662_10091723
673 Ga0207681_10011138
674 Ga0207681_10035400
675 Ga0207681_10145549
676 Ga0207681_10167021
677 Ga0207681_10206554
678 Ga0207650_10040506
679 Ga0207650_10051522
680 Ga0207650_10144878
681 Ga0207650_10443081
682 Ga0207659_10040622
683 Ga0207659_10204602
684 Ga0207659_10311064
685 Ga0207687_10147178
686 Ga0207687_10215199
687 Ga0207664_10087414
688 Ga0207644_10014460
689 Ga0207706_10024925
690 Ga0207686_10025908
691 Ga0207709_10181724
692 Ga0207670_10117591
693 Ga0207669_10010036
694 Ga0207669_10044349
695 Ga0207669_10168988
696 Ga0207669_10176475
697 Ga0207691_10024403
698 Ga0207691_10028108
699 Ga0207691_10067616
700 Ga0207691_10079264
701 Ga0207711_10016577
702 Ga0207711_10035474
703 Ga0207711_10483236
704 Ga0207661_10045599
705 Ga0207679_10291307
706 Ga0207679_10444456
707 Ga0207679_10554487
708 Ga0207667_10000284
709 Ga0207667_10013723
710 Ga0207651_10029336
711 Ga0207651_10071679
712 Ga0207651_10381926
713 Ga0207640_10036391
714 Ga0207640_10198159
715 Ga0207658_10119502
716 Ga0207677_10087361
717 Ga0207703_10825344
718 Ga0207708_10002994
719 Ga0207708_10037080
720 Ga0207708_10099170
721 Ga0207708_10100235
722 Ga0207641_10013460
723 Ga0207648_10007515
724 Ga0207648_10025765
725 Ga0207676_10030014
726 Ga0207676_10092628
727 Ga0207675_100002479
728 Ga0207675_100035133
729 Ga0207675_100202374
730 Ga0207675_100398449
731 Ga0207675_100533647
732 Ga0207683_10046610
733 Ga0207683_10639990
734 Ga0207698_10010742
735 Ga0207698_10122780
736 Ga0207428_10011356
737 Ga0207428_10076430
738 Ga0207428_10578127
739 Ga0268266_10232850
740 Ga0268265_10029829
741 Ga0268265_10202768
742 Ga0268265_10364604
743 Ga0268265_10911691
744 Ga0268264_10018040
745 Ga0268264_10203030
746 Ga0268264_10235514
747 Ga0265320_10031588
748 Ga0265325_10135235
749 Ga0316579_10017307
750 Ga0316579_10145744
751 Ga0316578_10079624
752 Ga0307413_10009208
753 Ga0307410_10078543
754 Ga0307406_10050687
755 Ga0307407_10011116
756 Ga0307412_10201577
757 Ga0307416_100049637
758 Ga0307416_100124121
759 Ga0307416_100333612
760 Ga0307414_10190762
761 Ga0307414_10690570
762 Ga0307411_10309660
763 Ga0316583_10026560
764 Ga0316583_10046929
765 Ga0316585_10062284
766 Ga0316593_10099329
767 Ga0373923_0131030
768 Ga0373956_0062982
769 Ga0373957_0079723
770 Ga0316574_0060251
771 Ga0373935_0019999
772 Ga0373933_0184672
773 Ga0373937_0083448
774 Ga0373937_0085931
775 Ga0316582_0003693
776 Ga0316582_0010005
777 Ga0316582_0022514
778 Ga0316584_0046710
779 Ga0373925_0115543
780 Ga0395900_0143001
781 Ga0395898_0341381
782 Ga0316581_0012362
783 Ga0395901_0013290
784 Ga0395901_0229316
785 Ga0451793_1511062
786 Ga0451800_0103001
787 Ga0451806_368013
788 Ga0451807_2416547
789 Ga0439450_009275
790 Ga0450895_000808
791 Ga0450896_000100
792 Ga0439435_0165285
793 Ga0439464_0000036
794 Ga0451577_0002652
795 Ga0451577_0028088
796 Ga0451577_0645008
797 Ga0453684_0285070
798 Ga0495651_0200682
799 Ga0495653_0257534
800 Ga0495580_0271179
801 Ga0495582_0457972
802 Ga0495664_0078311
803 Ga0495608_0230688
804 Ga0495652_0086804
805 Ga0495652_0204315
806 Ga0495586_0080440
807 Ga0495645_0027324
808 Ga0495667_0114133
809 Ga0495634_0106213
810 Ga0495635_0268143
811 Ga0495599_0246910
812 Ga0495674_0038400
813 Ga0495674_0118556
814 Ga0495672_0097781
815 Ga0495684_0082902
816 Ga0495602_0164449
817 Ga0496100_0015468
818 Ga0496100_0403127
819 Ga0496100_0535132
820 Ga0496100_0599385
821 Ga0496101_0000820
822 Ga0496102_0104373
823 Ga0496102_0534392
824 Ga0496103_0564173
825 Ga0496104_0250834
826 Ga0496105_0170473
827 Ga0496106_0138655
828 Ga0496106_0235359
829 Ga0496106_0245605
830 Ga0496107_0025261
831 Ga0496107_0050201
832 Ga0496107_0096791
833 Ga0496108_0256407
834 Ga0496109_0153909
835 Ga0496109_0434713
836 Ga0496109_0953383
837 Ga0496110_0057895
838 Ga0496110_0235101
839 Ga0496110_0655333
840 Ga0496111_0503877
841 Ga0496112_0071569
842 Ga0496112_0166353
843 Ga0496112_0373729
844 Ga0496113_0162249
845 Ga0496114_0000371
846 Ga0496114_0074575
847 Ga0496114_0519807
848 Ga0496117_0053334
849 Ga0496118_0001339
850 Ga0496119_0003206
851 Ga0496120_0000708
852 Ga0496121_0005127
853 Ga0496121_0026560
854 Ga0496121_0029488
855 Ga0496125_0174777
856 Ga0496126_0000411
857 Ga0496126_0029301
858 Ga0501031_0219318
859 Ga0501033_0193430
860 Ga0501034_0026128
861 Ga0501034_0191048
862 Ga0501036_0234873
863 Ga0501037_0158234
864 Ga0501038_0141340
865 Ga0501039_0104416
866 Ga0501039_0245114
867 Ga0501040_0025722
868 Ga0501041_0181801
869 Ga0501042_0109795
870 Ga0501042_0222166
871 Ga0501042_0375963
872 Ga0501048_0081987
873 Ga0501048_0158336
874 Ga0501048_0292704
875 Ga0501068_0294963
876 Ga0501071_0021132
877 Ga0501071_0196894
878 Ga0501071_0669291
879 Ga0501072_0013302
880 Ga0501072_0020149
881 Ga0501072_0159578
882 Ga0501074_0021602
883 Ga0501074_0113265
884 Ga0501074_0547752
885 Ga0501075_0018506
886 Ga0501075_0051444
887 Ga0501075_0073953
888 Ga0501075_0114222
889 Ga0501075_0176788
890 Ga0501075_0211573
891 Ga0501076_0003180
892 Ga0501076_0033612
893 Ga0501076_0071218
894 Ga0501076_0189207
895 Ga0501076_0300661
896 Ga0501077_0036903
897 Ga0501235_075107
898 Ga0501249_028146
899 Ga0501079_0023334
900 Ga0501079_0025891
901 Ga0501079_0030669
902 Ga0501079_0106650
903 Ga0501079_0771001
904 Ga0501080_0223877
905 Ga0501081_0012071
906 Ga0501081_0188047
907 Ga0501083_0144248
908 Ga0501044_0766322
909 Ga0501045_0018246
910 Ga0501045_0198841
911 Ga0501045_0277910
912 nmdc:mga00v17_41801_c1
913 nmdc:mga0yw44_9822_c1
914 nmdc:mga0k408_78627_c1
915 nmdc:mga05p37_181921_c1
916 nmdc:mga05p37_4082_c1
917 nmdc:mga05p37_41327_c1
918 nmdc:mga05p37_7527_c1
919 nmdc:mga05p37_7928_c1
920 nmdc:mga09592_100242_c1
921 nmdc:mga09592_1279_c1
922 nmdc:mga09592_1478_c1
923 nmdc:mga0qj67_11126_c1
924 nmdc:mga0qj67_36569_c1
925 nmdc:mga0qj67_370_c1
926 nmdc:mga0qj67_49059_c1
927 nmdc:mga0qj67_527109_c1
928 nmdc:mga06r32_39911_c1
929 nmdc:mga06r32_41269_c1
930 nmdc:mga06r32_42905_c1
931 nmdc:mga06r32_473956_c1
932 nmdc:mga06r32_612480_c1
933 nmdc:mga06r32_840553_c1
934 nmdc:mga06r32_84447_c1
935 nmdc:mga08y16_1824_c1
936 nmdc:mga08y16_4174_c1
937 nmdc:mga08y16_71729_c1
938 nmdc:mga08y16_760926_c1
939 nmdc:mga0n895_55923_c1
940 nmdc:mga0rr50_13460_c1
941 nmdc:mga0rr50_8970_c1
942 nmdc:mga0a205_17314_c2
943 nmdc:mga0a205_951261_c1
944 Ga0495601_0032631
945 Ga0495601_0094229
946 Ga0495595_0112847
947 Ga0495619_0048528
948 Ga0495619_0061953
949 Ga0501084_0014358
950 Ga0501084_0021984
951 Ga0590074_001367
952 Ga0590075_004474
953 Ga0590077_007481
954 Ga0501082_0014839
955 Ga0501082_0039643
956 Ga0501082_0454400
957 Ga0501082_0856971
958 Ga0530510_0028667
959 Ga0530510_0095235
960 Ga0530510_0257873
961 Ga0530510_0369948
962 2884411629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

77

231

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9622 9 207
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9618 6 195
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9568 6 195
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9554 7 204
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9515 7 190
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9513 43 191 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9439 41 194 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9324 43 191 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.93 2 193 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9209 43 201 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A356IAZ5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9705 21 196 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-H1G068-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9702 4 207 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A3B1ABR2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.969 5 206 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A669QJA2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9684 6 210 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A444TXS8-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.968 24 209 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map