F452228

General Info

Members Datasets Scaffolds Average Seq Length
480 262 448 368

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10001081|Ga0182008_100010816
Length 356
Sequence MANTWQAGRRIGLGLTLAAAVLALPAHAQEEKVLNIYNWSDYIGDDTIKNFEKETGIKVRYDVFDNNEILNAKLVAGKSGYDIVVPTAQWARLQIDAGLLRKLDKSKLTNLGNNDYLVDWLWGYTTVGINVNKVKAALGGMPMPDNAWELIFDPKYAAKLKSCGVSFLDSPSEVLPAALQYLGKPAYSKTAADYQEAGKVLQAIRPYVTLFSSSGYINDMANGSVCVALGWSGDINIARQRAIDAKNGNVIQVLVPKTAALMFDTMAIPADAPHPNNAHLFINYILRPQVHASLSNKVFYANPNLASIKYVRKDIGENKAIFLPDADKQRMAAPEATTADIRRLMTRIYTKFKTGV

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543018 Massilia sp. GV045 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2821131069 Duganella sp. 1224 Isolate Unclassified
22 2842711865 Duganella sp. R-73148 Isolate Unclassified
23 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
24 2857553236 Duganella sp. R-74557 Isolate Unclassified
25 2857558681 Duganella sp. R-74565 Isolate Unclassified
26 2857564685 Duganella sp. R-74599 Isolate Unclassified
27 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
28 2904424332 Duganella sp. 1411 Isolate Rhizosphere
29 2919476304 Duganella sp. 3397 Isolate Unclassified
30 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
31 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
235 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
251 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
254 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0.62
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 0.21
Rhizoplane 2.08
Rhizosphere 58.13
Stem 0
Stem Tuber 0
Unclassified 19.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000278 3300002705 Bacteria 34709
2 JGI25156J39149_1000973 3300002705 Bacteria 13642
3 JGI25156J39149_1011021 3300002705 Bacteria 2075
4 JGI25156J39149_1016398 3300002705 Bacteria 1441
5 JGI25154J39366_1000221 3300002738 Bacteria 38916
6 JGI25154J39366_1002307 3300002738 Bacteria 5115
7 JGI25157J39369_1000049 3300002741 Bacteria 115611
8 JGI25164J39214_1002144 3300002772 Bacteria 3312
9 JGI25152J39213_1008298 3300002773 Bacteria 2589
10 JGI25150J39212_1006247 3300002774 Bacteria 2476
11 JGI26128J50194_1000683 3300003347 Bacteria 1969
12 Ga0055539_1000583 3300003752 Bacteria 10242
13 Ga0055539_1001782 3300003752 Bacteria 3705
14 Ga0055533_1000010 3300003756 Bacteria 491196
15 Ga0055525_1000775 3300003759 Bacteria 10334
16 Ga0055535_1000508 3300003761 Bacteria 34490
17 Ga0055535_1000607 3300003761 Bacteria 29519
18 Ga0055535_1000906 3300003761 Bacteria 20145
19 Ga0055535_1004988 3300003761 Bacteria 3036
20 Ga0055529_1000103 3300003763 Bacteria 127175
21 Ga0055529_1000125 3300003763 Bacteria 110810
22 Ga0055529_1000461 3300003763 Bacteria 39448
23 Ga0055529_1000731 3300003763 Bacteria 21383
24 Ga0055526_1000016 3300003771 Bacteria 213710
25 Ga0055526_1000118 3300003771 Bacteria 69508
26 Ga0055526_1000323 3300003771 Bacteria 39660
27 Ga0055526_1001301 3300003771 Bacteria 17893
28 Ga0055530_10010772 3300003791 Bacteria 3343
29 Ga0065165_1000774 3300005262 Bacteria 43046
30 Ga0065704_10116252 3300005289 Bacteria 1857
31 Ga0065715_10133414 3300005293 Bacteria 1973
32 Ga0070658_10040640 3300005327 Bacteria 3752
33 Ga0068869_100053998 3300005334 Bacteria 2923
34 Ga0070687_100011810 3300005343 Bacteria 3835
35 Ga0070687_100035062 3300005343 Bacteria 2488
36 Ga0070687_100041827 3300005343 Bacteria 2318
37 Ga0070687_100046054 3300005343 Bacteria 2231
38 Ga0070675_100108464 3300005354 Bacteria 2345
39 Ga0070673_100108886 3300005364 Bacteria 2295
40 Ga0070673_100150024 3300005364 Bacteria 1974
41 Ga0070678_100111731 3300005456 Bacteria 2139
42 Ga0070678_100227732 3300005456 Bacteria 1552
43 Ga0070662_100015686 3300005457 Bacteria 5079
44 Ga0068867_100042592 3300005459 Bacteria 3322
45 Ga0068867_100171795 3300005459 Bacteria 1717
46 Ga0068853_100008381 3300005539 Bacteria 8302
47 Ga0068855_100052495 3300005563 Bacteria 4799
48 Ga0068857_100024975 3300005577 Bacteria 5263
49 Ga0068854_100022112 3300005578 Bacteria 4326
50 Ga0068856_100039320 3300005614 Bacteria 4644
51 Ga0068861_100040263 3300005719 Bacteria 3493
52 Ga0075367_10135200 3300006178 Bacteria 1525
53 Ga0075369_10049013 3300006186 Bacteria 1824
54 Ga0075366_10006521 3300006195 Bacteria 6399
55 Ga0075366_10011236 3300006195 Bacteria 5052
56 Ga0075366_10042565 3300006195 Bacteria 2689
57 Ga0075366_10056980 3300006195 Bacteria 2322
58 Ga0075370_10016883 3300006353 Bacteria 3936
59 Ga0075370_10049446 3300006353 Bacteria 2384
60 Ga0105244_10018325 3300009036 Bacteria 3929
61 Ga0105244_10023373 3300009036 Bacteria 3389
62 Ga0105240_10001892 3300009093 Bacteria 34765
63 Ga0105240_10180657 3300009093 Bacteria 2490
64 Ga0105241_10335256 3300009174 Bacteria 1309
65 Ga0105248_10527724 3300009177 Bacteria 1331
66 Ga0105237_10000080 3300009545 Bacteria 127788
67 Ga0105237_10000296 3300009545 Bacteria 68633
68 Ga0105238_10000711 3300009551 Bacteria 34783
69 Ga0105238_10009413 3300009551 Bacteria 9781
70 Ga0105239_10000116 3300010375 Bacteria 112811
71 Ga0105239_10000250 3300010375 Bacteria 80439
72 Ga0105239_10025926 3300010375 Bacteria 6455
73 Ga0157369_10043726 3300013105 Bacteria 4881
74 Ga0157378_10086731 3300013297 Bacteria 2838
75 Ga0182008_10001081 3300014497 Bacteria 18801
76 Ga0157379_10069629 3300014968 Bacteria 3147
77 Ga0182006_1000096 3300015261 Bacteria 104597
78 Ga0182006_1000251 3300015261 Bacteria 49986
79 Ga0182007_10000105 3300015262 Bacteria 59619
80 Ga0182005_1000013 3300015265 Bacteria 396391
81 Ga0182005_1000038 3300015265 Bacteria 160030
82 Ga0163161_10042734 3300017792 Bacteria 3261
83 Ga0213872_10000020 3300021361 Bacteria 159607
84 Ga0213872_10002650 3300021361 Bacteria 10379
85 Ga0213872_10007586 3300021361 Bacteria 5320
86 Ga0213872_10036586 3300021361 Bacteria 2243
87 Ga0209674_100003 3300025226 Bacteria 2196646
88 Ga0209672_104405 3300025228 Bacteria 2616
89 Ga0209672_106061 3300025228 Bacteria 2006
90 Ga0209563_100049 3300025230 Bacteria 358472
91 Ga0209563_107585 3300025230 Bacteria 1770
92 Ga0207427_100280 3300025231 Bacteria 37213
93 Ga0209437_104864 3300025233 Bacteria 2332
94 Ga0209258_100080 3300025242 Bacteria 255287
95 Ga0209258_100163 3300025242 Bacteria 149677
96 Ga0209258_100180 3300025242 Bacteria 137306
97 Ga0209258_101256 3300025242 Bacteria 9694
98 Ga0207425_1000170 3300025245 Bacteria 53604
99 Ga0207425_1000435 3300025245 Bacteria 27645
100 Ga0207425_1000624 3300025245 Bacteria 20169
101 Ga0209646_1000072 3300025246 Bacteria 224823
102 Ga0209646_1000138 3300025246 Bacteria 114892
103 Ga0209026_1000021 3300025250 Bacteria 375165
104 Ga0209677_100145 3300025253 Bacteria 65577
105 Ga0209677_100209 3300025253 Bacteria 45370
106 Ga0209759_1000025 3300025256 Bacteria 317082
107 Ga0209759_1000612 3300025256 Bacteria 34434
108 Ga0209759_1000937 3300025256 Bacteria 21027
109 Ga0209759_1001401 3300025256 Bacteria 13807
110 Ga0209759_1002119 3300025256 Bacteria 9190
111 Ga0209759_1011147 3300025256 Bacteria 2578
112 Ga0209759_1022566 3300025256 Bacteria 1404
113 Ga0209129_1000115 3300025258 Bacteria 141048
114 Ga0209129_1007977 3300025258 Bacteria 3025
115 Ga0209455_1000030 3300025272 Bacteria 533479
116 Ga0209455_1000044 3300025272 Bacteria 410787
117 Ga0209455_1000059 3300025272 Bacteria 339995
118 Ga0209455_1000144 3300025272 Bacteria 137313
119 Ga0209673_1005874 3300025273 Bacteria 6071
120 Ga0209673_1007682 3300025273 Bacteria 4915
121 Ga0209025_1005755 3300025294 Bacteria 9953
122 Ga0209025_1009840 3300025294 Bacteria 6588
123 Ga0209564_1000002 3300025295 Bacteria 1636803
124 Ga0209564_1000007 3300025295 Bacteria 1028582
125 Ga0209564_1000053 3300025295 Bacteria 351452
126 Ga0209758_1000089 3300025297 Bacteria 251523
127 Ga0209758_1000225 3300025297 Bacteria 121158
128 Ga0209758_1000228 3300025297 Bacteria 119948
129 Ga0209758_1000394 3300025297 Bacteria 75557
130 Ga0209050_1000374 3300025298 Bacteria 85298
131 Ga0209051_1003155 3300025303 Bacteria 11068
132 Ga0209051_1032655 3300025303 Bacteria 1981
133 Ga0207655_1006318 3300025728 Bacteria 7872
134 Ga0207682_10018586 3300025893 Bacteria 2719
135 Ga0207705_10020837 3300025909 Bacteria 4680
136 Ga0207695_10020992 3300025913 Bacteria 7461
137 Ga0207695_10069535 3300025913 Bacteria 3602
138 Ga0207671_10004679 3300025914 Bacteria 12948
139 Ga0207671_10011972 3300025914 Bacteria 7013
140 Ga0207662_10018335 3300025918 Bacteria 3970
141 Ga0207662_10056746 3300025918 Bacteria 2340
142 Ga0207657_10029841 3300025919 Bacteria 4957
143 Ga0207657_10125281 3300025919 Bacteria 2110
144 Ga0207657_10269356 3300025919 Bacteria 1354
145 Ga0207694_10003638 3300025924 Bacteria 12208
146 Ga0207694_10004090 3300025924 Bacteria 11471
147 Ga0207659_10046435 3300025926 Bacteria 3067
148 Ga0207706_10009625 3300025933 Bacteria 8870
149 Ga0207686_10030856 3300025934 Bacteria 3178
150 Ga0207669_10039796 3300025937 Bacteria 2721
151 Ga0207691_10081286 3300025940 Bacteria 2913
152 Ga0207711_10262713 3300025941 Bacteria 1587
153 Ga0207689_10014227 3300025942 Bacteria 6771
154 Ga0207667_10009539 3300025949 Bacteria 11420
155 Ga0207651_10101672 3300025960 Bacteria 2134
156 Ga0207640_10011003 3300025981 Bacteria 5108
157 Ga0207639_10014781 3300026041 Bacteria 5498
158 Ga0207678_10271161 3300026067 Bacteria 1455
159 Ga0207702_10000800 3300026078 Bacteria 33369
160 Ga0207648_10059840 3300026089 Bacteria 3322
161 Ga0207675_100052490 3300026118 Bacteria 3804
162 Ga0207683_10045373 3300026121 Bacteria 3844
163 Ga0207698_10226282 3300026142 Bacteria 1694
164 Ga0209281_1004417 3300027111 Bacteria 4217
165 Ga0209981_1001531 3300027378 Bacteria 2925
166 Ga0209996_1001584 3300027395 Bacteria 2773
167 Ga0209995_1000303 3300027471 Bacteria 7736
168 Ga0209968_1000359 3300027526 Bacteria 7590
169 Ga0209966_1000031 3300027695 Bacteria 63685
170 Ga0209974_10013101 3300027876 Bacteria 2765
171 Ga0268266_10057246 3300028379 Bacteria 3354
172 Ga0268266_10215598 3300028379 Bacteria 1762
173 Ga0268265_10426394 3300028380 Bacteria 1233
174 Ga0265336_10000006 3300028666 Bacteria 348453
175 Ga0265336_10000032 3300028666 Bacteria 167925
176 Ga0307517_10025872 3300028786 Bacteria 7146
177 Ga0307515_10000006 3300028794 Bacteria 725810
178 Ga0307515_10000013 3300028794 Bacteria 568456
179 Ga0307515_10000043 3300028794 Bacteria 304612
180 Ga0307515_10000291 3300028794 Bacteria 123206
181 Ga0307515_10000652 3300028794 Bacteria 80185
182 Ga0307515_10001063 3300028794 Bacteria 62886
183 Ga0307515_10001678 3300028794 Bacteria 49347
184 Ga0307515_10003883 3300028794 Bacteria 31216
185 Ga0307515_10009632 3300028794 Bacteria 18642
186 Ga0307515_10009637 3300028794 Bacteria 18637
187 Ga0307515_10023444 3300028794 Bacteria 10813
188 Ga0307515_10107197 3300028794 Bacteria 3306
189 Ga0265324_10001596 3300029957 Bacteria 12620
190 Ga0307512_10025065 3300030522 Bacteria 5292
191 Ga0265328_10000063 3300031239 Bacteria 61942
192 Ga0307513_10029768 3300031456 Bacteria 6216
193 Ga0307513_10085509 3300031456 Bacteria 3236
194 Ga0307513_10137698 3300031456 Bacteria 2374
195 Ga0307509_10000120 3300031507 Bacteria 114238
196 Ga0307509_10003007 3300031507 Bacteria 26366
197 Ga0307509_10048180 3300031507 Bacteria 4578
198 Ga0307509_10111171 3300031507 Bacteria 2743
199 Ga0307508_10000163 3300031616 Bacteria 80086
200 Ga0307508_10000248 3300031616 Bacteria 65511
201 Ga0307508_10000254 3300031616 Bacteria 65091
202 Ga0307508_10021341 3300031616 Bacteria 5888
203 Ga0307508_10285463 3300031616 Bacteria 1244
204 Ga0307514_10026508 3300031649 Bacteria 4686
205 Ga0307514_10073484 3300031649 Bacteria 2557
206 Ga0265314_10135247 3300031711 Bacteria 1532
207 Ga0307516_10000381 3300031730 Bacteria 58016
208 Ga0307516_10000402 3300031730 Bacteria 56504
209 Ga0307516_10000860 3300031730 Bacteria 41628
210 Ga0307516_10000878 3300031730 Bacteria 41335
211 Ga0307516_10012872 3300031730 Bacteria 8976
212 Ga0307516_10050466 3300031730 Bacteria 4082
213 Ga0307516_10134101 3300031730 Bacteria 2253
214 Ga0307510_10030745 3300033180 Bacteria 6082
215 Ga0307510_10033981 3300033180 Bacteria 5717
216 Ga0373934_0064307 3300035086 Bacteria 1464
217 Ga0373939_0003667 3300035114 Bacteria 3617
218 Ga0373931_0005337 3300035691 Bacteria 5932
219 Ga0395899_0153161 3300037312 Bacteria 1633
220 Ga0395898_0016172 3300037466 Bacteria 7642
221 Ga0395898_0025134 3300037466 Bacteria 6006
222 Ga0395905_0299998 3300037471 Bacteria 1494
223 Ga0395901_0014533 3300038443 Bacteria 8005
224 Ga0436361_0156868 3300039447 Bacteria 10726
225 Ga0436361_0194657 3300039447 Bacteria 16315
226 Ga0436361_0372225 3300039447 Bacteria 5721
227 Ga0436361_0402949 3300039447 Bacteria 5279
228 Ga0436361_0538733 3300039447 Bacteria 51899
229 Ga0436361_0565164 3300039447 Bacteria 9490
230 Ga0436361_0648806 3300039447 Bacteria 3107
231 Ga0436361_0881810 3300039447 Bacteria 5351
232 Ga0436361_1024184 3300039447 Bacteria 85708
233 Ga0451789_0811653 3300041443 Bacteria 1360
234 Ga0451800_0868808 3300041459 Bacteria 1395
235 Ga0451804_1082106 3300041463 Bacteria 1302
236 Ga0451841_1010115 3300041498 Bacteria 2068
237 Ga0451853_1771620 3300041512 Bacteria 3784
238 Ga0439441_012590 3300042001 Bacteria 1454
239 Ga0450911_000100 3300042115 Bacteria 34941
240 Ga0439446_0045018 3300042156 Bacteria 1307
241 Ga0451577_0001772 3300042876 Bacteria 27758
242 Ga0451577_0003669 3300042876 Bacteria 16820
243 Ga0451577_0009709 3300042876 Bacteria 9227
244 Ga0451577_0056047 3300042876 Bacteria 3515
245 Ga0451577_0090365 3300042876 Bacteria 2733
246 Ga0451577_0133766 3300042876 Bacteria 2226
247 Ga0451577_0213475 3300042876 Bacteria 1743
248 Ga0466972_0001230 3300044658 Bacteria 12352
249 Ga0466964_0034736 3300044706 Bacteria 2013
250 Ga0453684_0012115 3300044712 Bacteria 14310
251 Ga0453684_0012190 3300044712 Bacteria 14255
252 Ga0453684_0211576 3300044712 Bacteria 2253
253 Ga0451576_0001050 3300045051 Bacteria 50847
254 Ga0451576_0009311 3300045051 Bacteria 11404
255 Ga0451576_0010372 3300045051 Bacteria 10697
256 Ga0451576_0016728 3300045051 Bacteria 8089
257 Ga0451576_0048696 3300045051 Bacteria 4450
258 Ga0451576_0112861 3300045051 Bacteria 2829
259 Ga0495617_000004 3300046452 Bacteria 511274
260 Ga0495617_003868 3300046452 Bacteria 5514
261 Ga0495617_024899 3300046452 Bacteria 2018
262 Ga0495627_000008 3300046453 Bacteria 572150
263 Ga0495592_0000222 3300046454 Bacteria 48902
264 Ga0495590_0000006 3300046457 Bacteria 372949
265 Ga0495638_0000042 3300046460 Bacteria 232752
266 Ga0495638_0004288 3300046460 Bacteria 10819
267 Ga0495638_0047985 3300046460 Bacteria 2675
268 Ga0495638_0048926 3300046460 Bacteria 2645
269 Ga0495638_0052253 3300046460 Bacteria 2546
270 Ga0495651_0231344 3300046462 Bacteria 1273
271 Ga0495653_0000118 3300046463 Bacteria 65731
272 Ga0495650_0000165 3300046471 Bacteria 146945
273 Ga0495650_0000263 3300046471 Bacteria 101749
274 Ga0495650_0000348 3300046471 Bacteria 82107
275 Ga0495650_0000936 3300046471 Bacteria 33895
276 Ga0495650_0003118 3300046471 Bacteria 12429
277 Ga0495650_0004301 3300046471 Bacteria 9827
278 Ga0495650_0005288 3300046471 Bacteria 8449
279 Ga0495650_0006717 3300046471 Bacteria 7120
280 Ga0495605_0000022 3300046474 Bacteria 248321
281 Ga0495605_0008690 3300046474 Bacteria 5735
282 Ga0495639_0002854 3300046475 Bacteria 7518
283 Ga0495639_0005245 3300046475 Bacteria 5570
284 Ga0495584_0002276 3300046491 Bacteria 10942
285 Ga0495585_0000358 3300046492 Bacteria 44242
286 Ga0495607_0001650 3300046501 Bacteria 19320
287 Ga0495607_0004271 3300046501 Bacteria 10574
288 Ga0495607_0011037 3300046501 Bacteria 6034
289 Ga0495583_0000303 3300046506 Bacteria 78395
290 Ga0495583_0000402 3300046506 Bacteria 65718
291 Ga0495583_0000927 3300046506 Bacteria 34448
292 Ga0495583_0000967 3300046506 Bacteria 33114
293 Ga0495606_0000014 3300046507 Bacteria 289347
294 Ga0495606_0000111 3300046507 Bacteria 138144
295 Ga0495606_0000169 3300046507 Bacteria 115434
296 Ga0495606_0000569 3300046507 Bacteria 58510
297 Ga0495606_0000841 3300046507 Bacteria 46218
298 Ga0495606_0000857 3300046507 Bacteria 45724
299 Ga0495606_0001809 3300046507 Bacteria 27190
300 Ga0495606_0002532 3300046507 Bacteria 21024
301 Ga0495606_0003050 3300046507 Bacteria 18259
302 Ga0495606_0003515 3300046507 Bacteria 16548
303 Ga0495606_0008309 3300046507 Bacteria 9050
304 Ga0495608_0194772 3300046511 Bacteria 1279
305 Ga0495610_0000010 3300046512 Bacteria 538821
306 Ga0495610_0002041 3300046512 Bacteria 17239
307 Ga0495610_0006167 3300046512 Bacteria 8337
308 Ga0495610_0009487 3300046512 Bacteria 6147
309 Ga0495620_0031114 3300046515 Bacteria 2449
310 Ga0495632_0007443 3300046519 Bacteria 6876
311 Ga0495632_0048282 3300046519 Bacteria 2108
312 Ga0495637_0018493 3300046520 Bacteria 3231
313 Ga0495643_0000137 3300046522 Bacteria 117968
314 Ga0495643_0000967 3300046522 Bacteria 29428
315 Ga0495644_0001861 3300046523 Bacteria 8507
316 Ga0495644_0005430 3300046523 Bacteria 4979
317 Ga0495644_0005983 3300046523 Bacteria 4739
318 Ga0495648_0000272 3300046524 Bacteria 58140
319 Ga0495648_0002123 3300046524 Bacteria 18676
320 Ga0495648_0003766 3300046524 Bacteria 13191
321 Ga0495648_0005096 3300046524 Bacteria 11022
322 Ga0495648_0029958 3300046524 Bacteria 3605
323 Ga0495648_0107686 3300046524 Bacteria 1523
324 Ga0495642_0003839 3300046528 Bacteria 5890
325 Ga0495642_0017740 3300046528 Bacteria 2781
326 Ga0495654_0000002 3300046530 Bacteria 1021205
327 Ga0495654_0002542 3300046530 Bacteria 11694
328 Ga0495654_0087836 3300046530 Bacteria 1446
329 Ga0495598_0022155 3300046537 Bacteria 1697
330 Ga0495609_0000581 3300046538 Bacteria 28761
331 Ga0495609_0070020 3300046538 Bacteria 1542
332 Ga0495597_0000258 3300046542 Bacteria 48374
333 Ga0495597_0002193 3300046542 Bacteria 12822
334 Ga0495622_0000025 3300046557 Bacteria 146973
335 Ga0495622_0000027 3300046557 Bacteria 135256
336 Ga0495622_0000394 3300046557 Bacteria 29579
337 Ga0495622_0040393 3300046557 Bacteria 2171
338 Ga0495633_0000209 3300046558 Bacteria 74452
339 Ga0495633_0000368 3300046558 Bacteria 48404
340 Ga0495633_0003441 3300046558 Bacteria 10533
341 Ga0495633_0010199 3300046558 Bacteria 5140
342 Ga0495668_0000088 3300046616 Bacteria 151503
343 Ga0495668_0000135 3300046616 Bacteria 111827
344 Ga0495668_0000338 3300046616 Bacteria 62775
345 Ga0495668_0001951 3300046616 Bacteria 18306
346 Ga0495668_0005363 3300046616 Bacteria 8734
347 Ga0495611_0008997 3300046648 Bacteria 4222
348 Ga0495625_0000277 3300046660 Bacteria 79659
349 Ga0495625_0000482 3300046660 Bacteria 59590
350 Ga0495625_0000709 3300046660 Bacteria 47119
351 Ga0495625_0003641 3300046660 Bacteria 15113
352 Ga0495625_0009727 3300046660 Bacteria 8005
353 Ga0495625_0009872 3300046660 Bacteria 7939
354 Ga0495625_0037946 3300046660 Bacteria 3530
355 Ga0495659_0001473 3300046664 Bacteria 7981
356 Ga0495661_0003433 3300046665 Bacteria 11694
357 Ga0495588_0138957 3300046674 Bacteria 1283
358 Ga0495670_0001496 3300046691 Bacteria 11398
359 Ga0495671_0000002 3300046692 Bacteria 1136189
360 Ga0495649_0000464 3300046694 Bacteria 34868
361 Ga0495589_0012850 3300046794 Bacteria 4328
362 Ga0495660_0000641 3300046810 Bacteria 27196
363 Ga0495660_0001221 3300046810 Bacteria 17944
364 Ga0495660_0006960 3300046810 Bacteria 6665
365 Ga0495660_0073482 3300046810 Bacteria 1808
366 Ga0495636_0008718 3300047318 Bacteria 3998
367 Ga0495636_0029138 3300047318 Bacteria 2252
368 Ga0495672_0000031 3300047320 Bacteria 298258
369 Ga0495672_0000241 3300047320 Bacteria 77378
370 Ga0495687_000568 3300047443 Bacteria 43554
371 Ga0495687_033355 3300047443 Bacteria 2336
372 Ga0495677_0004182 3300047445 Bacteria 5565
373 Ga0495679_010746 3300047446 Bacteria 3575
374 Ga0495673_0000005 3300047469 Bacteria 943364
375 Ga0495673_0000026 3300047469 Bacteria 476378
376 Ga0495673_0000028 3300047469 Bacteria 473418
377 Ga0495673_0014677 3300047469 Bacteria 4066
378 Ga0495681_0018255 3300047470 Bacteria 3868
379 Ga0495686_0001652 3300047472 Bacteria 23244
380 Ga0495686_0002781 3300047472 Bacteria 15956
381 Ga0495686_0003059 3300047472 Bacteria 14830
382 Ga0495686_0007740 3300047472 Bacteria 8007
383 Ga0495686_0009665 3300047472 Bacteria 6928
384 Ga0495686_0021886 3300047472 Bacteria 4236
385 Ga0496102_0000166 3300048905 Bacteria 88956
386 Ga0496102_0052393 3300048905 Bacteria 3718
387 Ga0496103_0006861 3300048906 Bacteria 6799
388 Ga0496107_0099228 3300048910 Bacteria 2134
389 Ga0496107_0314723 3300048910 Bacteria 1165
390 Ga0496114_0137422 3300048917 Bacteria 2114
391 Ga0496116_0045732 3300048919 Bacteria 2960
392 Ga0496117_0000132 3300048920 Bacteria 162117
393 Ga0496118_0000099 3300048921 Bacteria 160412
394 Ga0496121_0032149 3300048924 Bacteria 4776
395 Ga0496122_0005859 3300048925 Bacteria 14410
396 Ga0496122_0041901 3300048925 Bacteria 3610
397 Ga0496123_0010542 3300048926 Bacteria 8148
398 Ga0496123_0059830 3300048926 Bacteria 2460
399 Ga0496124_0014925 3300048927 Bacteria 7479
400 Ga0496124_0018474 3300048927 Bacteria 6528
401 Ga0496124_0056867 3300048927 Bacteria 3297
402 Ga0496124_0078436 3300048927 Bacteria 2722
403 Ga0496124_0166415 3300048927 Bacteria 1713
404 Ga0496125_0006005 3300048928 Bacteria 13294
405 Ga0496125_0072395 3300048928 Bacteria 2685
406 Ga0496126_0011221 3300048929 Bacteria 9296
407 Ga0496126_0028250 3300048929 Bacteria 5347
408 Ga0495678_000006 3300049459 Bacteria 463690
409 Ga0495678_000608 3300049459 Bacteria 33616
410 Ga0495678_004127 3300049459 Bacteria 8590
411 Ga0495682_0000813 3300049460 Bacteria 19684
412 Ga0495682_0001927 3300049460 Bacteria 10320
413 Ga0501222_008530 3300049662 Bacteria 1360
414 Ga0501269_000248 3300049766 Bacteria 15561
415 nmdc:mga0k408_1301_c1 3300050493 Bacteria 13499
416 nmdc:mga0k408_28280_c1 3300050493 Bacteria 3187
417 nmdc:mga0k408_50850_c1 3300050493 Bacteria 2399
418 nmdc:mga0k408_90901_c1 3300050493 Bacteria 1793
419 nmdc:mga07m45_14579_c1 3300050496 Bacteria 4191
420 nmdc:mga07m45_87621_c1 3300050496 Bacteria 1782
421 nmdc:mga0sz30_59268_c1 3300050516 Bacteria 1633
422 Ga0500635_0000017 3300053080 Bacteria 113720
423 Ga0500635_0000137 3300053080 Bacteria 42016
424 Ga0500578_0000683 3300053086 Bacteria 40592
425 Ga0500650_0024940 3300053098 Bacteria 2670
426 Ga0500593_000161 3300053117 Bacteria 26877
427 Ga0500594_0002447 3300053118 Bacteria 4045
428 Ga0500594_0017746 3300053118 Bacteria 1745
429 Ga0500594_0026248 3300053118 Bacteria 1499
430 Ga0500618_000174 3300053125 Bacteria 53245
431 Ga0500623_038665 3300053127 Bacteria 2446
432 Ga0500628_000557 3300053129 Bacteria 6809
433 Ga0500642_0025319 3300053130 Bacteria 2408
434 Ga0500652_000930 3300053131 Bacteria 9670
435 Ga0500658_0025750 3300053134 Bacteria 2262
436 Ga0500559_0000011 3300053136 Bacteria 164751
437 Ga0500564_038350 3300053138 Bacteria 2208
438 Ga0500568_0025164 3300053139 Bacteria 2514
439 Ga0500586_000450 3300053145 Bacteria 8201
440 Ga0500619_000022 3300053154 Bacteria 50600
441 Ga0500622_0000028 3300053156 Bacteria 218994
442 Ga0500627_0037590 3300053158 Bacteria 2067
443 Ga0500636_0123081 3300053177 Bacteria 1453
444 Ga0500661_008893 3300055283 Bacteria 1846
445 Ga0590071_002479 3300059421 Bacteria 4646
446 Ga0587083_0011696 3300059505 Bacteria 1455
447 Ga0587067_009106 3300059640 Bacteria 1471
448 Ga0587076_004662 3300059645 Bacteria 1726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0138957 Ga0495588_0138957_99_1250 330
2 3300015262 Ga0182007_10000105 Ga0182007_1000010521 334
3 3300015265 Ga0182005_1000038 Ga0182005_1000038119 334
4 3300017792 Ga0163161_10042734 Ga0163161_100427342 334
5 3300048925 Ga0496122_0005859 Ga0496122_0005859_12178_13299 334
6 3300048926 Ga0496123_0059830 Ga0496123_0059830_1027_2148 334
7 3300048928 Ga0496125_0072395 Ga0496125_0072395_1510_2631 334
8 3300053154 Ga0500619_000022 Ga0500619_000022_31782_32867 336
9 3300031616 Ga0307508_10000248 Ga0307508_1000024856 338
10 3300005457 Ga0070662_100015686 Ga0070662_1000156861 341
11 3300025933 Ga0207706_10009625 Ga0207706_100096256 341
12 3300046538 Ga0495609_0070020 Ga0495609_0070020_20_1096 341
13 3300046507 Ga0495606_0000014 Ga0495606_0000014_109433_110539 342
14 3300046616 Ga0495668_0000088 Ga0495668_0000088_145053_146159 342
15 3300047472 Ga0495686_0021886 Ga0495686_0021886_1743_2849 342
16 3300026142 Ga0207698_10226282 Ga0207698_102262821 344
17 3300046512 Ga0495610_0000010 Ga0495610_0000010_364369_365469 344
18 3300046616 Ga0495668_0001951 Ga0495668_0001951_13046_14146 344
19 3300046692 Ga0495671_0000002 Ga0495671_0000002_408324_409424 344
20 iso_pu_bacteria 2885080285 2885083154 345
21 3300003763 Ga0055529_1000125 Ga0055529_100012570 346
22 3300025245 Ga0207425_1000624 Ga0207425_100062417 346
23 3300025272 Ga0209455_1000044 Ga0209455_1000044243 346
24 3300025294 Ga0209025_1005755 Ga0209025_10057558 346
25 3300025297 Ga0209758_1000228 Ga0209758_100022861 346
26 3300046463 Ga0495653_0000118 Ga0495653_0000118_13199_14308 346
27 3300046507 Ga0495606_0000569 Ga0495606_0000569_47805_48914 346
28 3300046507 Ga0495606_0008309 Ga0495606_0008309_7070_8170 346
29 3300046512 Ga0495610_0006167 Ga0495610_0006167_1117_2217 346
30 3300046542 Ga0495597_0002193 Ga0495597_0002193_6810_7910 346
31 3300046558 Ga0495633_0000209 Ga0495633_0000209_27981_29081 346
32 3300048926 Ga0496123_0010542 Ga0496123_0010542_1188_2297 346
33 3300048929 Ga0496126_0011221 Ga0496126_0011221_6050_7156 346
34 3300046452 Ga0495617_000004 Ga0495617_000004_108086_109195 347
35 3300046492 Ga0495585_0000358 Ga0495585_0000358_39540_40649 347
36 3300046512 Ga0495610_0009487 Ga0495610_0009487_4971_6071 347
37 3300046530 Ga0495654_0002542 Ga0495654_0002542_4868_5977 347
38 3300046810 Ga0495660_0006960 Ga0495660_0006960_2886_3995 347
39 3300047446 Ga0495679_010746 Ga0495679_010746_1151_2260 347
40 3300047469 Ga0495673_0000005 Ga0495673_0000005_251232_252338 347
41 3300047469 Ga0495673_0000026 Ga0495673_0000026_305694_306803 347
42 3300048925 Ga0496122_0041901 Ga0496122_0041901_2397_3506 347
43 3300053118 Ga0500594_0026248 Ga0500594_0026248_52_1158 347
44 3300053125 Ga0500618_000174 Ga0500618_000174_37898_39004 347
45 3300053145 Ga0500586_000450 Ga0500586_000450_4926_6026 347
46 3300009036 Ga0105244_10018325 Ga0105244_100183254 348
47 3300025728 Ga0207655_1006318 Ga0207655_10063187 348
48 3300028794 Ga0307515_10107197 Ga0307515_101071974 348
49 3300046501 Ga0495607_0011037 Ga0495607_0011037_4532_5662 348
50 3300046522 Ga0495643_0000137 Ga0495643_0000137_110077_111177 348
51 3300046524 Ga0495648_0003766 Ga0495648_0003766_5557_6657 348
52 3300046558 Ga0495633_0000368 Ga0495633_0000368_41660_42772 348
53 3300046660 Ga0495625_0009727 Ga0495625_0009727_1717_2829 348
54 3300047320 Ga0495672_0000241 Ga0495672_0000241_25529_26629 348
55 3300048906 Ga0496103_0006861 Ga0496103_0006861_1004_2116 348
56 3300048917 Ga0496114_0137422 Ga0496114_0137422_340_1452 348
57 3300048927 Ga0496124_0078436 Ga0496124_0078436_49_1158 348
58 3300049459 Ga0495678_000608 Ga0495678_000608_25211_26311 348
59 3300049766 Ga0501269_000248 Ga0501269_000248_3502_4614 348
60 3300044658 Ga0466972_0001230 Ga0466972_0001230_7435_8532 349
61 3300044706 Ga0466964_0034736 Ga0466964_0034736_397_1494 349
62 3300046475 Ga0495639_0005245 Ga0495639_0005245_3203_4321 349
63 3300014497 Ga0182008_10001081 Ga0182008_100010816 350
64 3300015261 Ga0182006_1000251 Ga0182006_100025120 350
65 3300046452 Ga0495617_024899 Ga0495617_024899_953_2008 350
66 3300048920 Ga0496117_0000132 Ga0496117_0000132_130244_131359 350
67 3300048921 Ga0496118_0000099 Ga0496118_0000099_130244_131359 350
68 3300048924 Ga0496121_0032149 Ga0496121_0032149_1198_2313 350
69 iso_pu_bacteria 2857547612 2857552933 350
70 3300048927 Ga0496124_0166415 Ga0496124_0166415_536_1651 351
71 3300042876 Ga0451577_0001772 Ga0451577_0001772_8272_9393 352
72 3300047318 Ga0495636_0029138 Ga0495636_0029138_628_1806 352
73 3300031730 Ga0307516_10134101 Ga0307516_101341012 353
74 3300050496 nmdc:mga07m45_14579_c1 nmdc:mga07m45_14579_c1_1713_2816 353
75 3300005293 Ga0065715_10133414 Ga0065715_101334143 354
76 3300047443 Ga0495687_033355 Ga0495687_033355_1179_2279 354
77 3300003763 Ga0055529_1000103 Ga0055529_100010372 355
78 3300009036 Ga0105244_10023373 Ga0105244_100233731 355
79 3300025228 Ga0209672_104405 Ga0209672_1044051 355
80 3300025242 Ga0209258_100080 Ga0209258_100080209 355
81 3300025256 Ga0209759_1000937 Ga0209759_10009374 355
82 3300025272 Ga0209455_1000030 Ga0209455_1000030290 355
83 3300046515 Ga0495620_0031114 Ga0495620_0031114_1087_2220 355
84 3300005364 Ga0070673_100150024 Ga0070673_1001500241 356
85 3300025960 Ga0207651_10101672 Ga0207651_101016722 356
86 3300028794 Ga0307515_10009637 Ga0307515_100096377 356
87 3300031730 Ga0307516_10000381 Ga0307516_1000038121 356
88 3300041498 Ga0451841_1010115 Ga0451841_1010115_797_1912 356
89 3300041512 Ga0451853_1771620 Ga0451853_1771620_732_1847 356
90 3300046457 Ga0495590_0000006 Ga0495590_0000006_335172_336272 356
91 3300046460 Ga0495638_0000042 Ga0495638_0000042_139434_140534 356
92 3300046506 Ga0495583_0000303 Ga0495583_0000303_41484_42584 356
93 3300046519 Ga0495632_0048282 Ga0495632_0048282_548_1663 356
94 3300046522 Ga0495643_0000967 Ga0495643_0000967_4904_6004 356
95 3300046524 Ga0495648_0000272 Ga0495648_0000272_34410_35510 356
96 3300046528 Ga0495642_0003839 Ga0495642_0003839_145_1245 356
97 3300046530 Ga0495654_0087836 Ga0495654_0087836_146_1225 356
98 3300046542 Ga0495597_0000258 Ga0495597_0000258_39926_41026 356
99 3300046557 Ga0495622_0000394 Ga0495622_0000394_5072_6172 356
100 3300046557 Ga0495622_0040393 Ga0495622_0040393_223_1302 356
101 3300046616 Ga0495668_0000338 Ga0495668_0000338_20223_21323 356
102 3300046660 Ga0495625_0000277 Ga0495625_0000277_42409_43509 356
103 3300046660 Ga0495625_0003641 Ga0495625_0003641_11805_12920 356
104 3300048910 Ga0496107_0314723 Ga0496107_0314723_35_1117 356
105 3300053134 Ga0500658_0025750 Ga0500658_0025750_174_1289 356
106 3300005343 Ga0070687_100035062 Ga0070687_1000350622 357
107 3300005456 Ga0070678_100111731 Ga0070678_1001117313 357
108 3300021361 Ga0213872_10007586 Ga0213872_100075864 357
109 3300028794 Ga0307515_10000043 Ga0307515_1000004389 357
110 3300039447 Ga0436361_0402949 Ga0436361_0402949_1338_2444 357
111 3300005327 Ga0070658_10040640 Ga0070658_100406402 358
112 3300025256 Ga0209759_1001401 Ga0209759_10014015 358
113 3300025909 Ga0207705_10020837 Ga0207705_100208373 358
114 3300042001 Ga0439441_012590 Ga0439441_012590_258_1382 358
115 3300046528 Ga0495642_0017740 Ga0495642_0017740_194_1312 358
116 3300046810 Ga0495660_0001221 Ga0495660_0001221_14440_15558 358
117 3300047472 Ga0495686_0002781 Ga0495686_0002781_1035_2153 358
118 iso_pu_bacteria 2585428057 2587729512 358
119 iso_pu_bacteria 2585428058 2587733973 358
120 iso_pu_bacteria 2588253510 2588294592 358
121 iso_pu_bacteria 2738541297 2738828890 358
122 iso_pu_bacteria 2738541357 2739152686 358
123 iso_pu_bacteria 2738543003 2739194606 358
124 iso_pu_bacteria 2738543026 2739321082 358
125 iso_pu_bacteria 2738543029 2739339323 358
126 3300002774 JGI25150J39212_1006247 JGI25150J39212_10062472 359
127 3300009545 Ga0105237_10000080 Ga0105237_1000008020 359
128 3300009551 Ga0105238_10000711 Ga0105238_1000071131 359
129 3300010375 Ga0105239_10000116 Ga0105239_1000011687 359
130 3300025245 Ga0207425_1000170 Ga0207425_100017032 359
131 3300025294 Ga0209025_1009840 Ga0209025_10098404 359
132 3300025297 Ga0209758_1000394 Ga0209758_100039447 359
133 3300039447 Ga0436361_0194657 Ga0436361_0194657_4466_5560 359
134 3300046471 Ga0495650_0000348 Ga0495650_0000348_29258_30355 359
135 3300046501 Ga0495607_0001650 Ga0495607_0001650_8151_9251 359
136 3300046524 Ga0495648_0002123 Ga0495648_0002123_15823_16923 359
137 3300046660 Ga0495625_0000482 Ga0495625_0000482_45211_46308 359
138 3300046665 Ga0495661_0003433 Ga0495661_0003433_9196_10296 359
139 3300048905 Ga0496102_0000166 Ga0496102_0000166_20399_21571 359
140 iso_pu_bacteria 2857553236 2857553248 359
141 iso_pu_bacteria 2919476304 2919479829 359
142 3300025918 Ga0207662_10018335 Ga0207662_100183352 360
143 3300042876 Ga0451577_0133766 Ga0451577_0133766_355_1482 360
144 3300045051 Ga0451576_0112861 Ga0451576_0112861_365_1492 360
145 3300046471 Ga0495650_0004301 Ga0495650_0004301_4817_5923 360
146 3300046506 Ga0495583_0000967 Ga0495583_0000967_20448_21551 360
147 3300046616 Ga0495668_0005363 Ga0495668_0005363_3159_4265 360
148 3300047472 Ga0495686_0001652 Ga0495686_0001652_16311_17459 360
149 iso_pu_bacteria 2585428062 2587755052 360
150 iso_pu_bacteria 2643221592 2643969635 360
151 iso_pu_bacteria 2643221625 2644143935 360
152 iso_pu_bacteria 2643221648 2644276358 360
153 iso_pu_bacteria 2821131069 2821133121 360
154 iso_pu_bacteria 2842711865 2842714800 360
155 iso_pu_bacteria 2857558681 2857563105 360
156 iso_pu_bacteria 2857564685 2857567312 360
157 iso_pu_bacteria 2904424332 2904427317 360
158 3300039447 Ga0436361_0648806 Ga0436361_0648806_1434_2561 361
159 3300039447 Ga0436361_1024184 Ga0436361_1024184_78897_79994 361
160 3300042876 Ga0451577_0090365 Ga0451577_0090365_632_1762 361
161 3300044712 Ga0453684_0211576 Ga0453684_0211576_1002_2132 361
162 3300045051 Ga0451576_0009311 Ga0451576_0009311_4753_5868 361
163 3300046471 Ga0495650_0005288 Ga0495650_0005288_3182_4282 361
164 3300003761 Ga0055535_1000508 Ga0055535_100050814 362
165 3300003763 Ga0055529_1000461 Ga0055529_100046111 362
166 3300005262 Ga0065165_1000774 Ga0065165_100077438 362
167 3300006186 Ga0075369_10049013 Ga0075369_100490132 362
168 3300006195 Ga0075366_10056980 Ga0075366_100569802 362
169 3300006353 Ga0075370_10049446 Ga0075370_100494462 362
170 3300025228 Ga0209672_106061 Ga0209672_1060611 362
171 3300025230 Ga0209563_107585 Ga0209563_1075852 362
172 3300025242 Ga0209258_100180 Ga0209258_10018012 362
173 3300025256 Ga0209759_1000612 Ga0209759_100061212 362
174 3300025272 Ga0209455_1000144 Ga0209455_100014412 362
175 3300025273 Ga0209673_1005874 Ga0209673_10058742 362
176 3300028794 Ga0307515_10000006 Ga0307515_10000006255 362
177 3300028794 Ga0307515_10000013 Ga0307515_10000013354 362
178 3300028794 Ga0307515_10001678 Ga0307515_1000167816 362
179 3300041443 Ga0451789_0811653 Ga0451789_0811653_66_1178 362
180 3300041459 Ga0451800_0868808 Ga0451800_0868808_261_1373 362
181 3300041463 Ga0451804_1082106 Ga0451804_1082106_28_1149 362
182 3300042876 Ga0451577_0056047 Ga0451577_0056047_1738_2853 362
183 3300045051 Ga0451576_0010372 Ga0451576_0010372_8921_10036 362
184 3300046460 Ga0495638_0048926 Ga0495638_0048926_647_1768 362
185 3300046471 Ga0495650_0000263 Ga0495650_0000263_89166_90299 362
186 3300046507 Ga0495606_0000857 Ga0495606_0000857_32861_33994 362
187 3300048910 Ga0496107_0099228 Ga0496107_0099228_68_1177 362
188 3300050516 nmdc:mga0sz30_59268_c1 nmdc:mga0sz30_59268_c1_462_1568 362
189 3300053098 Ga0500650_0024940 Ga0500650_0024940_653_1774 362
190 3300053127 Ga0500623_038665 Ga0500623_038665_103_1224 362
191 3300053129 Ga0500628_000557 Ga0500628_000557_4850_5962 362
192 3300053130 Ga0500642_0025319 Ga0500642_0025319_645_1757 362
193 3300053131 Ga0500652_000930 Ga0500652_000930_4733_5845 362
194 3300053156 Ga0500622_0000028 Ga0500622_0000028_190136_191257 362
195 3300002773 JGI25152J39213_1008298 JGI25152J39213_10082981 363
196 3300003771 Ga0055526_1000118 Ga0055526_100011843 363
197 3300003771 Ga0055526_1000323 Ga0055526_100032331 363
198 3300003771 Ga0055526_1001301 Ga0055526_10013012 363
199 3300005459 Ga0068867_100042592 Ga0068867_1000425922 363
200 3300006178 Ga0075367_10135200 Ga0075367_101352002 363
201 3300009093 Ga0105240_10001892 Ga0105240_100018924 363
202 3300009545 Ga0105237_10000296 Ga0105237_1000029621 363
203 3300009551 Ga0105238_10009413 Ga0105238_100094135 363
204 3300010375 Ga0105239_10000250 Ga0105239_1000025032 363
205 3300025245 Ga0207425_1000435 Ga0207425_100043514 363
206 3300025258 Ga0209129_1000115 Ga0209129_100011570 363
207 3300025273 Ga0209673_1007682 Ga0209673_10076822 363
208 3300025295 Ga0209564_1000007 Ga0209564_1000007677 363
209 3300025295 Ga0209564_1000053 Ga0209564_100005364 363
210 3300025297 Ga0209758_1000225 Ga0209758_100022564 363
211 3300025914 Ga0207671_10004679 Ga0207671_100046794 363
212 3300025924 Ga0207694_10003638 Ga0207694_100036387 363
213 3300026089 Ga0207648_10059840 Ga0207648_100598402 363
214 3300031649 Ga0307514_10026508 Ga0307514_100265084 363
215 3300035114 Ga0373939_0003667 Ga0373939_0003667_48_1154 363
216 3300042876 Ga0451577_0009709 Ga0451577_0009709_3537_4667 363
217 3300044712 Ga0453684_0012115 Ga0453684_0012115_6569_7699 363
218 3300045051 Ga0451576_0048696 Ga0451576_0048696_1932_3062 363
219 3300046454 Ga0495592_0000222 Ga0495592_0000222_22363_23475 363
220 3300046460 Ga0495638_0047985 Ga0495638_0047985_1435_2532 363
221 3300046471 Ga0495650_0003118 Ga0495650_0003118_7448_8545 363
222 3300046524 Ga0495648_0107686 Ga0495648_0107686_208_1317 363
223 3300046660 Ga0495625_0000709 Ga0495625_0000709_11465_12562 363
224 3300046810 Ga0495660_0000641 Ga0495660_0000641_20964_22067 363
225 3300047470 Ga0495681_0018255 Ga0495681_0018255_573_1676 363
226 3300048927 Ga0496124_0056867 Ga0496124_0056867_2183_3286 363
227 3300049459 Ga0495678_000006 Ga0495678_000006_354398_355501 363
228 3300053177 Ga0500636_0123081 Ga0500636_0123081_290_1402 363
229 iso_pu_bacteria 2932410948 2932413599 363
230 iso_pu_bacteria 2932416698 2932417659 363
231 3300002738 JGI25154J39366_1002307 JGI25154J39366_10023073 364
232 3300003771 Ga0055526_1000016 Ga0055526_1000016152 364
233 3300003791 Ga0055530_10010772 Ga0055530_100107722 364
234 3300015261 Ga0182006_1000096 Ga0182006_100009667 364
235 3300015265 Ga0182005_1000013 Ga0182005_1000013287 364
236 3300021361 Ga0213872_10000020 Ga0213872_1000002086 364
237 3300021361 Ga0213872_10002650 Ga0213872_100026508 364
238 3300021361 Ga0213872_10036586 Ga0213872_100365862 364
239 3300025233 Ga0209437_104864 Ga0209437_1048642 364
240 3300025246 Ga0209646_1000072 Ga0209646_1000072194 364
241 3300025258 Ga0209129_1007977 Ga0209129_10079772 364
242 3300025295 Ga0209564_1000002 Ga0209564_10000021257 364
243 3300025297 Ga0209758_1000089 Ga0209758_1000089188 364
244 3300025298 Ga0209050_1000374 Ga0209050_100037424 364
245 3300025303 Ga0209051_1032655 Ga0209051_10326552 364
246 3300026067 Ga0207678_10271161 Ga0207678_102711611 364
247 3300027111 Ga0209281_1004417 Ga0209281_10044173 364
248 3300027876 Ga0209974_10013101 Ga0209974_100131012 364
249 3300028794 Ga0307515_10000652 Ga0307515_1000065262 364
250 3300030522 Ga0307512_10025065 Ga0307512_100250651 364
251 3300031456 Ga0307513_10137698 Ga0307513_101376982 364
252 3300031616 Ga0307508_10000254 Ga0307508_1000025416 364
253 3300035691 Ga0373931_0005337 Ga0373931_0005337_3662_4768 364
254 3300039447 Ga0436361_0156868 Ga0436361_0156868_4700_5806 364
255 3300039447 Ga0436361_0538733 Ga0436361_0538733_4026_5138 364
256 3300039447 Ga0436361_0565164 Ga0436361_0565164_6256_7383 364
257 3300039447 Ga0436361_0881810 Ga0436361_0881810_1767_2879 364
258 3300042156 Ga0439446_0045018 Ga0439446_0045018_111_1256 364
259 3300046453 Ga0495627_000008 Ga0495627_000008_414142_415248 364
260 3300046471 Ga0495650_0000936 Ga0495650_0000936_15104_16231 364
261 3300046471 Ga0495650_0006717 Ga0495650_0006717_4293_5393 364
262 3300046474 Ga0495605_0000022 Ga0495605_0000022_54300_55400 364
263 3300046501 Ga0495607_0004271 Ga0495607_0004271_8563_9663 364
264 3300046507 Ga0495606_0000169 Ga0495606_0000169_91401_92528 364
265 3300046507 Ga0495606_0000841 Ga0495606_0000841_16653_17753 364
266 3300046507 Ga0495606_0001809 Ga0495606_0001809_5008_6108 364
267 3300046507 Ga0495606_0002532 Ga0495606_0002532_6922_8034 364
268 3300046512 Ga0495610_0002041 Ga0495610_0002041_3151_4278 364
269 3300046520 Ga0495637_0018493 Ga0495637_0018493_525_1625 364
270 3300046523 Ga0495644_0005983 Ga0495644_0005983_1731_2837 364
271 3300046524 Ga0495648_0029958 Ga0495648_0029958_1429_2529 364
272 3300046530 Ga0495654_0000002 Ga0495654_0000002_357187_358287 364
273 3300046538 Ga0495609_0000581 Ga0495609_0000581_20589_21695 364
274 3300046558 Ga0495633_0010199 Ga0495633_0010199_3978_5105 364
275 3300046616 Ga0495668_0000135 Ga0495668_0000135_62537_63664 364
276 3300046810 Ga0495660_0073482 Ga0495660_0073482_302_1477 364
277 3300047320 Ga0495672_0000031 Ga0495672_0000031_128145_129320 364
278 3300047469 Ga0495673_0000028 Ga0495673_0000028_99908_101008 364
279 3300047472 Ga0495686_0003059 Ga0495686_0003059_3335_4465 364
280 3300047472 Ga0495686_0009665 Ga0495686_0009665_5627_6754 364
281 3300048919 Ga0496116_0045732 Ga0496116_0045732_312_1418 364
282 3300048927 Ga0496124_0018474 Ga0496124_0018474_3280_4407 364
283 3300053086 Ga0500578_0000683 Ga0500578_0000683_1367_2485 364
284 3300053117 Ga0500593_000161 Ga0500593_000161_5387_6499 364
285 3300053118 Ga0500594_0002447 Ga0500594_0002447_1170_2270 364
286 3300005343 Ga0070687_100046054 Ga0070687_1000460542 365
287 3300028794 Ga0307515_10000291 Ga0307515_1000029157 365
288 3300031456 Ga0307513_10029768 Ga0307513_100297687 365
289 3300045051 Ga0451576_0016728 Ga0451576_0016728_6771_7889 365
290 3300046507 Ga0495606_0000111 Ga0495606_0000111_125446_126567 365
291 3300046557 Ga0495622_0000025 Ga0495622_0000025_128856_129971 365
292 3300046557 Ga0495622_0000027 Ga0495622_0000027_11650_12768 365
293 3300047472 Ga0495686_0007740 Ga0495686_0007740_1748_2875 365
294 iso_pu_bacteria 2600255292 2601670090 365
295 3300003347 JGI26128J50194_1000683 JGI26128J50194_10006832 366
296 3300005343 Ga0070687_100011810 Ga0070687_1000118103 366
297 3300005343 Ga0070687_100041827 Ga0070687_1000418272 366
298 3300005354 Ga0070675_100108464 Ga0070675_1001084642 366
299 3300005364 Ga0070673_100108886 Ga0070673_1001088862 366
300 3300005456 Ga0070678_100227732 Ga0070678_1002277321 366
301 3300006195 Ga0075366_10011236 Ga0075366_100112362 366
302 3300009177 Ga0105248_10527724 Ga0105248_105277241 366
303 3300025893 Ga0207682_10018586 Ga0207682_100185862 366
304 3300025918 Ga0207662_10056746 Ga0207662_100567462 366
305 3300025926 Ga0207659_10046435 Ga0207659_100464352 366
306 3300025937 Ga0207669_10039796 Ga0207669_100397962 366
307 3300025940 Ga0207691_10081286 Ga0207691_100812862 366
308 3300025941 Ga0207711_10262713 Ga0207711_102627132 366
309 3300027378 Ga0209981_1001531 Ga0209981_10015312 366
310 3300027395 Ga0209996_1001584 Ga0209996_10015842 366
311 3300027471 Ga0209995_1000303 Ga0209995_10003034 366
312 3300027526 Ga0209968_1000359 Ga0209968_10003592 366
313 3300027695 Ga0209966_1000031 Ga0209966_100003149 366
314 3300028379 Ga0268266_10057246 Ga0268266_100572462 366
315 3300028380 Ga0268265_10426394 Ga0268265_104263941 366
316 3300028666 Ga0265336_10000032 Ga0265336_1000003297 366
317 3300028786 Ga0307517_10025872 Ga0307517_100258725 366
318 3300028794 Ga0307515_10001063 Ga0307515_1000106341 366
319 3300029957 Ga0265324_10001596 Ga0265324_100015968 366
320 3300031239 Ga0265328_10000063 Ga0265328_1000006311 366
321 3300031456 Ga0307513_10085509 Ga0307513_100855092 366
322 3300031507 Ga0307509_10000120 Ga0307509_1000012045 366
323 3300031507 Ga0307509_10003007 Ga0307509_100030078 366
324 3300031507 Ga0307509_10048180 Ga0307509_100481803 366
325 3300031616 Ga0307508_10000163 Ga0307508_1000016360 366
326 3300031616 Ga0307508_10021341 Ga0307508_100213413 366
327 3300031711 Ga0265314_10135247 Ga0265314_101352472 366
328 3300031730 Ga0307516_10000860 Ga0307516_1000086014 366
329 3300031730 Ga0307516_10012872 Ga0307516_100128725 366
330 3300033180 Ga0307510_10030745 Ga0307510_100307454 366
331 3300033180 Ga0307510_10033981 Ga0307510_100339812 366
332 3300042876 Ga0451577_0213475 Ga0451577_0213475_225_1361 366
333 3300044712 Ga0453684_0012190 Ga0453684_0012190_2259_3380 366
334 3300046460 Ga0495638_0052253 Ga0495638_0052253_838_1959 366
335 3300046475 Ga0495639_0002854 Ga0495639_0002854_3986_5101 366
336 3300046511 Ga0495608_0194772 Ga0495608_0194772_13_1128 366
337 3300046537 Ga0495598_0022155 Ga0495598_0022155_216_1340 366
338 3300050493 nmdc:mga0k408_28280_c1 nmdc:mga0k408_28280_c1_848_2071 366
339 3300053080 Ga0500635_0000137 Ga0500635_0000137_13479_14594 366
340 3300053118 Ga0500594_0017746 Ga0500594_0017746_52_1173 366
341 3300053136 Ga0500559_0000011 Ga0500559_0000011_30130_31251 366
342 iso_pu_bacteria 2585428062 2587754264 366
343 iso_pu_bacteria 2643221645 2644251927 366
344 iso_pu_bacteria 2643221664 2644360576 366
345 iso_pu_bacteria 2738541280 2738740369 366
346 iso_pu_bacteria 2738541300 2738843380 366
347 iso_pu_bacteria 2738543018 2739275547 366
348 iso_pu_bacteria 2738543030 2739344591 366
349 3300002705 JGI25156J39149_1016398 JGI25156J39149_10163981 367
350 3300005459 Ga0068867_100171795 Ga0068867_1001717952 367
351 3300005539 Ga0068853_100008381 Ga0068853_1000083816 367
352 3300025256 Ga0209759_1022566 Ga0209759_10225662 367
353 3300025913 Ga0207695_10069535 Ga0207695_100695352 367
354 3300025914 Ga0207671_10011972 Ga0207671_100119727 367
355 3300025919 Ga0207657_10125281 Ga0207657_101252812 367
356 3300025924 Ga0207694_10004090 Ga0207694_100040906 367
357 3300026041 Ga0207639_10014781 Ga0207639_100147812 367
358 3300026121 Ga0207683_10045373 Ga0207683_100453733 367
359 3300028379 Ga0268266_10215598 Ga0268266_102155981 367
360 3300028794 Ga0307515_10023444 Ga0307515_100234446 367
361 3300031730 Ga0307516_10000878 Ga0307516_100008783 367
362 3300037312 Ga0395899_0153161 Ga0395899_0153161_163_1281 367
363 3300037466 Ga0395898_0025134 Ga0395898_0025134_1934_3052 367
364 3300039447 Ga0436361_0372225 Ga0436361_0372225_1767_2984 367
365 3300042876 Ga0451577_0003669 Ga0451577_0003669_6039_7166 367
366 3300046452 Ga0495617_003868 Ga0495617_003868_988_2205 367
367 3300046460 Ga0495638_0004288 Ga0495638_0004288_7195_8412 367
368 3300046471 Ga0495650_0000165 Ga0495650_0000165_37104_38216 367
369 3300046474 Ga0495605_0008690 Ga0495605_0008690_594_1811 367
370 3300046491 Ga0495584_0002276 Ga0495584_0002276_459_1742 367
371 3300046506 Ga0495583_0000402 Ga0495583_0000402_41527_42744 367
372 3300046507 Ga0495606_0003515 Ga0495606_0003515_1243_2355 367
373 3300046523 Ga0495644_0001861 Ga0495644_0001861_2385_3602 367
374 3300046523 Ga0495644_0005430 Ga0495644_0005430_1423_2595 367
375 3300046524 Ga0495648_0005096 Ga0495648_0005096_6759_7976 367
376 3300046558 Ga0495633_0003441 Ga0495633_0003441_4563_5735 367
377 3300046648 Ga0495611_0008997 Ga0495611_0008997_2986_4158 367
378 3300046664 Ga0495659_0001473 Ga0495659_0001473_3718_4935 367
379 3300046691 Ga0495670_0001496 Ga0495670_0001496_9441_10556 367
380 3300047318 Ga0495636_0008718 Ga0495636_0008718_376_1593 367
381 3300047443 Ga0495687_000568 Ga0495687_000568_10125_11342 367
382 3300047445 Ga0495677_0004182 Ga0495677_0004182_2581_3798 367
383 3300047469 Ga0495673_0014677 Ga0495673_0014677_865_2082 367
384 3300049459 Ga0495678_004127 Ga0495678_004127_2582_3799 367
385 3300049460 Ga0495682_0000813 Ga0495682_0000813_5779_6996 367
386 3300049460 Ga0495682_0001927 Ga0495682_0001927_6727_7899 367
387 3300050493 nmdc:mga0k408_1301_c1 nmdc:mga0k408_1301_c1_3575_4699 367
388 3300059421 Ga0590071_002479 Ga0590071_002479_2204_3346 367
389 iso_pu_bacteria 2643221660 2644337816 367
390 3300005289 Ga0065704_10116252 Ga0065704_101162522 368
391 3300006195 Ga0075366_10006521 Ga0075366_100065215 368
392 3300014968 Ga0157379_10069629 Ga0157379_100696292 368
393 3300031507 Ga0307509_10111171 Ga0307509_101111712 368
394 3300042115 Ga0450911_000100 Ga0450911_000100_23481_24617 368
395 3300046519 Ga0495632_0007443 Ga0495632_0007443_3813_4943 368
396 3300048927 Ga0496124_0014925 Ga0496124_0014925_753_1889 368
397 3300048928 Ga0496125_0006005 Ga0496125_0006005_2676_3812 368
398 3300048929 Ga0496126_0028250 Ga0496126_0028250_1459_2595 368
399 3300049662 Ga0501222_008530 Ga0501222_008530_98_1228 368
400 3300050493 nmdc:mga0k408_90901_c1 nmdc:mga0k408_90901_c1_471_1595 368
401 3300053139 Ga0500568_0025164 Ga0500568_0025164_503_1633 368
402 3300028794 Ga0307515_10003883 Ga0307515_100038836 369
403 3300028794 Ga0307515_10009632 Ga0307515_1000963214 369
404 3300031649 Ga0307514_10073484 Ga0307514_100734843 369
405 3300031730 Ga0307516_10000402 Ga0307516_1000040248 369
406 3300031730 Ga0307516_10050466 Ga0307516_100504661 369
407 3300046660 Ga0495625_0009872 Ga0495625_0009872_5049_6182 369
408 3300048905 Ga0496102_0052393 Ga0496102_0052393_1959_3086 369
409 3300050496 nmdc:mga07m45_87621_c1 nmdc:mga07m45_87621_c1_97_1230 369
410 3300053158 Ga0500627_0037590 Ga0500627_0037590_123_1277 369
411 3300009093 Ga0105240_10180657 Ga0105240_101806572 370
412 3300025256 Ga0209759_1011147 Ga0209759_10111472 370
413 3300025919 Ga0207657_10029841 Ga0207657_100298413 370
414 3300025303 Ga0209051_1003155 Ga0209051_10031557 371
415 3300045051 Ga0451576_0001050 Ga0451576_0001050_27507_28676 371
416 3300002705 JGI25156J39149_1000278 JGI25156J39149_100027825 372
417 3300002705 JGI25156J39149_1000973 JGI25156J39149_10009739 372
418 3300002705 JGI25156J39149_1011021 JGI25156J39149_10110212 372
419 3300002738 JGI25154J39366_1000221 JGI25154J39366_10002218 372
420 3300002741 JGI25157J39369_1000049 JGI25157J39369_100004934 372
421 3300002772 JGI25164J39214_1002144 JGI25164J39214_10021442 372
422 3300003752 Ga0055539_1000583 Ga0055539_10005839 372
423 3300003752 Ga0055539_1001782 Ga0055539_10017823 372
424 3300003756 Ga0055533_1000010 Ga0055533_1000010210 372
425 3300003759 Ga0055525_1000775 Ga0055525_10007753 372
426 3300003761 Ga0055535_1000607 Ga0055535_10006079 372
427 3300003761 Ga0055535_1000906 Ga0055535_10009069 372
428 3300003761 Ga0055535_1004988 Ga0055535_10049882 372
429 3300003763 Ga0055529_1000731 Ga0055529_100073110 372
430 3300005334 Ga0068869_100053998 Ga0068869_1000539982 372
431 3300005563 Ga0068855_100052495 Ga0068855_1000524952 372
432 3300005577 Ga0068857_100024975 Ga0068857_1000249754 372
433 3300005578 Ga0068854_100022112 Ga0068854_1000221123 372
434 3300005614 Ga0068856_100039320 Ga0068856_1000393202 372
435 3300005719 Ga0068861_100040263 Ga0068861_1000402632 372
436 3300006195 Ga0075366_10042565 Ga0075366_100425652 372
437 3300006353 Ga0075370_10016883 Ga0075370_100168832 372
438 3300009174 Ga0105241_10335256 Ga0105241_103352561 372
439 3300010375 Ga0105239_10025926 Ga0105239_100259265 372
440 3300013105 Ga0157369_10043726 Ga0157369_100437263 372
441 3300013297 Ga0157378_10086731 Ga0157378_100867312 372
442 3300025226 Ga0209674_100003 Ga0209674_1000031546 372
443 3300025230 Ga0209563_100049 Ga0209563_1000498 372
444 3300025231 Ga0207427_100280 Ga0207427_10028020 372
445 3300025242 Ga0209258_100163 Ga0209258_10016310 372
446 3300025242 Ga0209258_101256 Ga0209258_1012567 372
447 3300025246 Ga0209646_1000138 Ga0209646_100013875 372
448 3300025250 Ga0209026_1000021 Ga0209026_1000021234 372
449 3300025253 Ga0209677_100145 Ga0209677_10014523 372
450 3300025253 Ga0209677_100209 Ga0209677_10020926 372
451 3300025256 Ga0209759_1000025 Ga0209759_1000025234 372
452 3300025256 Ga0209759_1002119 Ga0209759_10021193 372
453 3300025272 Ga0209455_1000059 Ga0209455_1000059284 372
454 3300025913 Ga0207695_10020992 Ga0207695_100209926 372
455 3300025919 Ga0207657_10269356 Ga0207657_102693562 372
456 3300025934 Ga0207686_10030856 Ga0207686_100308562 372
457 3300025942 Ga0207689_10014227 Ga0207689_100142273 372
458 3300025949 Ga0207667_10009539 Ga0207667_100095399 372
459 3300025981 Ga0207640_10011003 Ga0207640_100110034 372
460 3300026078 Ga0207702_10000800 Ga0207702_100008004 372
461 3300026118 Ga0207675_100052490 Ga0207675_1000524902 372
462 3300028666 Ga0265336_10000006 Ga0265336_1000000638 372
463 3300031616 Ga0307508_10285463 Ga0307508_102854631 372
464 3300035086 Ga0373934_0064307 Ga0373934_0064307_266_1384 372
465 3300037466 Ga0395898_0016172 Ga0395898_0016172_5688_6806 372
466 3300037471 Ga0395905_0299998 Ga0395905_0299998_194_1312 372
467 3300038443 Ga0395901_0014533 Ga0395901_0014533_1778_2896 372
468 3300046462 Ga0495651_0231344 Ga0495651_0231344_136_1254 372
469 3300046506 Ga0495583_0000927 Ga0495583_0000927_23321_24439 372
470 3300046507 Ga0495606_0003050 Ga0495606_0003050_6303_7421 372
471 3300046660 Ga0495625_0037946 Ga0495625_0037946_506_1624 372
472 3300046694 Ga0495649_0000464 Ga0495649_0000464_23746_24864 372
473 3300046794 Ga0495589_0012850 Ga0495589_0012850_1495_2613 372
474 3300050493 nmdc:mga0k408_50850_c1 nmdc:mga0k408_50850_c1_725_1843 372
475 3300053080 Ga0500635_0000017 Ga0500635_0000017_94298_95416 372
476 3300053138 Ga0500564_038350 Ga0500564_038350_315_1433 372
477 3300055283 Ga0500661_008893 Ga0500661_008893_175_1293 372
478 3300059505 Ga0587083_0011696 Ga0587083_0011696_160_1278 372
479 3300059640 Ga0587067_009106 Ga0587067_009106_156_1274 372
480 3300059645 Ga0587076_004662 Ga0587076_004662_295_1413 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

46

322

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

36

292

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9675 32 371
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.967 32 371
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9637 32 371
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9625 29 371
6ye0-assembly1.cif.gz_B e.coli's putrescine receptor potf complexed with putrescine 0.962 32 371
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9777 33 137 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9729 33 337 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9687 33 137 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9669 33 337 3.40.190.10
af_P31133_137_369_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9617 139 371 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X2IIX7-F1-model_v4 Putrescine-binding periplasmic protein 0.9841 24 372 GO:0015846
GO:0019808
GO:0042597
AF-A0A1J5PTY2-F1-model_v4 Putrescine-binding periplasmic protein 0.9821 59 372 GO:0015846
GO:0019808
GO:0042597
AF-A0A3M4DHW7-F1-model_v4 deleted 0.9801 75 372
AF-A0A6N8T8T4-F1-model_v4 deleted 0.9797 83 339
AF-A0A3S4IZZ6-F1-model_v4 Putrescine-binding periplasmic protein 0.9764 74 372 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
91.52 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map