F452148

General Info

Members Datasets Scaffolds Average Seq Length
480 274 960 257

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10007545|JGI24740J21852_100075456
Length 304
Sequence MKLILSPWLKKCCPAFFQHAGSGTRPDPASPDQADGLDPRRAIHGPRHPDSEERPDARRRFLRDALALTGAVTLGXCDKLSETDWAPKVLGXATALSHAAQRALSRNAMAREYSEADISPVFRPNGSTDPQSSEYRALAANGFHDYRLNVGGLVAHPLSLSLEQLRALPNRTQITRHDCVEGWSVIGKWTGVQLSRVLEMAQPTKAARYAVFRCYDAMDDGSEYYESLGFDDAYHPQTLLAWELNGKTLPIPNGAPLRLRVPRQLGYKMAKYLRRIDLVDSFKSVEGGQGGYWEDQGYQWYAGI

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
271 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
272 2919404418 Luteibacter sp. 3190 Isolate Unclassified
273 2928963466 Dyella japonica 1073 Isolate Unclassified
274 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 2.08
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 0
Rhizoplane 1.67
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007545 3300001979 Bacteria 4407
2 JGI24741J21665_1000193 3300001915 Bacteria 17926
3 JGI24741J21665_1001971 3300001915 Bacteria 5524
4 JGI24741J21665_1007188 3300001915 Bacteria 2173
5 JGI24740J21852_10000222 3300001979 Bacteria 24091
6 JGI25162J39368_1001917 3300002737 Bacteria 9530
7 JGI25164J39214_1000127 3300002772 Bacteria 73184
8 JGI25164J39214_1000154 3300002772 Bacteria 64762
9 JGI25165J46597_1000212 3300003214 Bacteria 82334
10 Ga0055527_1003589 3300003760 Bacteria 2265
11 Ga0055535_1001529 3300003761 Bacteria 11376
12 Ga0055542_1000010 3300003762 Bacteria 414813
13 Ga0055542_1000141 3300003762 Bacteria 90014
14 Ga0055529_1000164 3300003763 Bacteria 91966
15 Ga0058861_10059377 3300004800 Bacteria 1134
16 Ga0065165_1001169 3300005262 Bacteria 30497
17 Ga0065712_10003376 3300005290 Bacteria 6850
18 Ga0065712_10007520 3300005290 Bacteria 4585
19 Ga0065715_10009106 3300005293 Bacteria 2936
20 Ga0065715_10091129 3300005293 Bacteria 6082
21 Ga0065707_10085325 3300005295 Bacteria 6236
22 Ga0065707_10139563 3300005295 Bacteria 1791
23 Ga0070658_10195301 3300005327 Bacteria 1706
24 Ga0070676_10070825 3300005328 Bacteria 2093
25 Ga0070683_100175006 3300005329 Bacteria 2037
26 Ga0070683_100527034 3300005329 Bacteria 1129
27 Ga0070690_100040046 3300005330 Bacteria 2962
28 Ga0070670_100006588 3300005331 Bacteria 9843
29 Ga0068869_100015508 3300005334 Bacteria 5114
30 Ga0070666_10000022 3300005335 Bacteria 166910
31 Ga0070666_10008936 3300005335 Bacteria 6237
32 Ga0070680_100000301 3300005336 Bacteria 33020
33 Ga0070680_100001972 3300005336 Bacteria 15104
34 Ga0070680_100012272 3300005336 Bacteria 6654
35 Ga0070680_100041677 3300005336 Bacteria 3722
36 Ga0070680_100081379 3300005336 Bacteria 2672
37 Ga0070680_100217134 3300005336 Bacteria 1614
38 Ga0070680_100226543 3300005336 Bacteria 1578
39 Ga0070680_100558785 3300005336 Bacteria 981
40 Ga0070682_100002929 3300005337 Bacteria 9471
41 Ga0070682_100059645 3300005337 Bacteria 2410
42 Ga0068868_100029859 3300005338 Bacteria 4177
43 Ga0070660_100025208 3300005339 Bacteria 4419
44 Ga0070689_100133453 3300005340 Bacteria 1992
45 Ga0070689_100215737 3300005340 Bacteria 1572
46 Ga0070691_10009187 3300005341 Bacteria 4518
47 Ga0070691_10022249 3300005341 Bacteria 2940
48 Ga0070691_10046502 3300005341 Bacteria 2061
49 Ga0070687_100034702 3300005343 Bacteria 2499
50 Ga0070661_100002931 3300005344 Bacteria 11767
51 Ga0070661_100014343 3300005344 Bacteria 5582
52 Ga0070661_100148334 3300005344 Bacteria 1772
53 Ga0070661_100185435 3300005344 Bacteria 1585
54 Ga0070661_100246614 3300005344 Bacteria 1377
55 Ga0070692_10000426 3300005345 Bacteria 12768
56 Ga0070692_10003911 3300005345 Bacteria 6141
57 Ga0070668_100020212 3300005347 Bacteria 5022
58 Ga0070669_100023641 3300005353 Bacteria 4401
59 Ga0070675_100027915 3300005354 Bacteria 4538
60 Ga0070671_100060873 3300005355 Bacteria 3143
61 Ga0070671_100061383 3300005355 Bacteria 3130
62 Ga0070671_100189101 3300005355 Bacteria 1745
63 Ga0070674_100013195 3300005356 Bacteria 5100
64 Ga0070659_100012634 3300005366 Bacteria 6262
65 Ga0070659_100068333 3300005366 Bacteria 2818
66 Ga0070667_100034131 3300005367 Bacteria 4254
67 Ga0070667_100036757 3300005367 Bacteria 4106
68 Ga0070705_100039753 3300005440 Bacteria 2671
69 Ga0070700_100260229 3300005441 Bacteria 1249
70 Ga0070694_100027597 3300005444 Bacteria 3689
71 Ga0070694_100125646 3300005444 Bacteria 1846
72 Ga0070663_100008525 3300005455 Bacteria 6311
73 Ga0070663_100012516 3300005455 Bacteria 5371
74 Ga0070663_100090403 3300005455 Bacteria 2267
75 Ga0070678_100005989 3300005456 Bacteria 7086
76 Ga0070662_100018630 3300005457 Bacteria 4700
77 Ga0070662_100062898 3300005457 Bacteria 2713
78 Ga0070681_10000062 3300005458 Bacteria 77779
79 Ga0070681_10004523 3300005458 Bacteria 13270
80 Ga0070681_10009826 3300005458 Bacteria 9424
81 Ga0070681_10020316 3300005458 Bacteria 6657
82 Ga0070681_10152348 3300005458 Bacteria 2238
83 Ga0070681_10282824 3300005458 Bacteria 1569
84 Ga0070685_10375738 3300005466 Bacteria 978
85 Ga0070699_100782794 3300005518 Bacteria 873
86 Ga0070679_100000188 3300005530 Bacteria 49880
87 Ga0070679_100003342 3300005530 Bacteria 14692
88 Ga0070679_100007853 3300005530 Bacteria 10003
89 Ga0070679_100036728 3300005530 Bacteria 4862
90 Ga0070679_100148405 3300005530 Bacteria 2322
91 Ga0070684_100041540 3300005535 Bacteria 3965
92 Ga0068853_100015990 3300005539 Bacteria 6170
93 Ga0068853_100042808 3300005539 Bacteria 3873
94 Ga0070672_100007640 3300005543 Bacteria 7355
95 Ga0070686_100362066 3300005544 Bacteria 1093
96 Ga0070695_100012317 3300005545 Bacteria 5127
97 Ga0070695_100039177 3300005545 Bacteria 2994
98 Ga0070696_100000213 3300005546 Bacteria 34817
99 Ga0070696_100010968 3300005546 Bacteria 6068
100 Ga0070696_100014056 3300005546 Bacteria 5375
101 Ga0070696_100075117 3300005546 Bacteria 2384
102 Ga0070693_100013813 3300005547 Bacteria 4121
103 Ga0070693_100045215 3300005547 Bacteria 2495
104 Ga0070665_100018940 3300005548 Bacteria 6905
105 Ga0070704_100043921 3300005549 Bacteria 3102
106 Ga0068855_100007071 3300005563 Bacteria 13612
107 Ga0068855_100013668 3300005563 Bacteria 9789
108 Ga0068855_100831734 3300005563 Bacteria 979
109 Ga0070664_100001569 3300005564 Bacteria 18267
110 Ga0070664_100088016 3300005564 Bacteria 2685
111 Ga0068857_100128045 3300005577 Bacteria 2288
112 Ga0068854_100007806 3300005578 Bacteria 6845
113 Ga0068854_100034971 3300005578 Bacteria 3515
114 Ga0068854_100558604 3300005578 Bacteria 972
115 Ga0068856_100035856 3300005614 Bacteria 4862
116 Ga0068856_100081417 3300005614 Bacteria 3212
117 Ga0070702_100087741 3300005615 Bacteria 1880
118 Ga0068852_100080126 3300005616 Bacteria 2894
119 Ga0068852_100085796 3300005616 Bacteria 2805
120 Ga0068859_100355012 3300005617 Bacteria 1561
121 Ga0068864_100038943 3300005618 Bacteria 4062
122 Ga0068861_100121843 3300005719 Bacteria 2105
123 Ga0068860_100015053 3300005843 Bacteria 7558
124 Ga0070712_100172159 3300006175 Bacteria 1681
125 Ga0097621_100123733 3300006237 Bacteria 2196
126 Ga0068871_100105607 3300006358 Bacteria 2363
127 Ga0075433_10025211 3300006852 Bacteria 5026
128 Ga0075433_10059288 3300006852 Bacteria 3349
129 Ga0075434_100056075 3300006871 Bacteria 3915
130 Ga0075434_100070867 3300006871 Bacteria 3476
131 Ga0068865_100041734 3300006881 Bacteria 3125
132 Ga0075436_100160199 3300006914 Bacteria 1586
133 Ga0097620_100355008 3300006931 Bacteria 1561
134 Ga0105240_10078058 3300009093 Bacteria 4078
135 Ga0105240_10229165 3300009093 Bacteria 2160
136 Ga0105240_10650242 3300009093 Bacteria 1155
137 Ga0111539_10155326 3300009094 Bacteria 2677
138 Ga0105245_10074247 3300009098 Bacteria 3094
139 Ga0105247_10269939 3300009101 Bacteria 1170
140 Ga0114129_10159709 3300009147 Bacteria 3081
141 Ga0114129_10332848 3300009147 Bacteria 2015
142 Ga0105243_10049829 3300009148 Bacteria 3306
143 Ga0105241_10023116 3300009174 Bacteria 4608
144 Ga0105241_10024621 3300009174 Bacteria 4471
145 Ga0105242_10024690 3300009176 Bacteria 4749
146 Ga0105242_10436028 3300009176 Bacteria 1231
147 Ga0105248_10003765 3300009177 Bacteria 16798
148 Ga0105237_10157666 3300009545 Bacteria 2267
149 Ga0105237_10482945 3300009545 Bacteria 1245
150 Ga0105238_10000266 3300009551 Bacteria 58638
151 Ga0105239_10088711 3300010375 Bacteria 3410
152 Ga0105246_10006591 3300011119 Bacteria 7093
153 Ga0157373_10038105 3300013100 Bacteria 3446
154 Ga0157373_10049718 3300013100 Bacteria 2987
155 Ga0157373_10168534 3300013100 Bacteria 1541
156 Ga0157371_10087870 3300013102 Bacteria 2201
157 Ga0157371_10097115 3300013102 Bacteria 2088
158 Ga0157370_10011351 3300013104 Bacteria 9327
159 Ga0157370_10017334 3300013104 Bacteria 7269
160 Ga0157369_10032774 3300013105 Bacteria 5710
161 Ga0157374_10010790 3300013296 Bacteria 7878
162 Ga0157378_10093220 3300013297 Bacteria 2741
163 Ga0157378_10234888 3300013297 Bacteria 1749
164 Ga0163162_10000249 3300013306 Bacteria 48772
165 Ga0163162_10056978 3300013306 Bacteria 3935
166 Ga0157372_10003444 3300013307 Bacteria 17066
167 Ga0157372_10012179 3300013307 Bacteria 9160
168 Ga0157372_10026893 3300013307 Bacteria 6263
169 Ga0157372_10223629 3300013307 Bacteria 2182
170 Ga0157372_10834705 3300013307 Bacteria 1070
171 Ga0157380_10580763 3300014326 Bacteria 1105
172 Ga0182008_10000262 3300014497 Bacteria 41194
173 Ga0157379_10461899 3300014968 Bacteria 1173
174 Ga0182006_1001950 3300015261 Bacteria 11702
175 Ga0182007_10068105 3300015262 Bacteria 1166
176 Ga0182005_1000434 3300015265 Bacteria 22191
177 Ga0206356_10117691 3300020070 Bacteria 2000
178 Ga0206356_10940428 3300020070 Bacteria 1043
179 Ga0206349_1330366 3300020075 Bacteria 802
180 Ga0206352_10340506 3300020078 Bacteria 1633
181 Ga0206354_10239161 3300020081 Bacteria 5045
182 Ga0206354_10906169 3300020081 Bacteria 3954
183 Ga0206353_10385063 3300020082 Bacteria 4921
184 Ga0206353_11302849 3300020082 Bacteria 1643
185 Ga0154015_1355434 3300020610 Bacteria 3786
186 Ga0209674_102468 3300025226 Bacteria 3952
187 Ga0209672_100177 3300025228 Bacteria 52900
188 Ga0207427_100062 3300025231 Bacteria 178598
189 Ga0207427_101764 3300025231 Bacteria 7033
190 Ga0209437_100180 3300025233 Bacteria 133661
191 Ga0209437_100258 3300025233 Bacteria 82547
192 Ga0209437_101521 3300025233 Bacteria 5486
193 Ga0209258_100088 3300025242 Bacteria 237738
194 Ga0209258_101867 3300025242 Bacteria 6357
195 Ga0209026_1000836 3300025250 Bacteria 16261
196 Ga0209026_1001427 3300025250 Bacteria 10590
197 Ga0209148_1000005 3300025254 Bacteria 1806504
198 Ga0209148_1000024 3300025254 Bacteria 669890
199 Ga0209148_1002951 3300025254 Bacteria 5149
200 Ga0209233_1000023 3300025261 Bacteria 738870
201 Ga0207666_1002521 3300025271 Bacteria 2211
202 Ga0209455_1000025 3300025272 Bacteria 670673
203 Ga0207697_10005087 3300025315 Bacteria 6155
204 Ga0207697_10007364 3300025315 Bacteria 4916
205 Ga0207680_10000001 3300025903 Bacteria 1091453
206 Ga0207680_10095345 3300025903 Bacteria 1901
207 Ga0207647_10002262 3300025904 Bacteria 14671
208 Ga0207647_10025506 3300025904 Bacteria 3882
209 Ga0207647_10161689 3300025904 Bacteria 1306
210 Ga0207645_10016094 3300025907 Bacteria 4952
211 Ga0207705_10000097 3300025909 Bacteria 105579
212 Ga0207705_10000860 3300025909 Bacteria 24893
213 Ga0207705_10002152 3300025909 Bacteria 15280
214 Ga0207705_10010347 3300025909 Bacteria 6785
215 Ga0207705_10019909 3300025909 Bacteria 4800
216 Ga0207654_10195684 3300025911 Bacteria 1328
217 Ga0207707_10000065 3300025912 Bacteria 106546
218 Ga0207707_10000084 3300025912 Bacteria 95228
219 Ga0207707_10000144 3300025912 Bacteria 73715
220 Ga0207707_10000949 3300025912 Bacteria 27923
221 Ga0207707_10002017 3300025912 Bacteria 18436
222 Ga0207707_10002311 3300025912 Bacteria 17183
223 Ga0207707_10020735 3300025912 Bacteria 5741
224 Ga0207707_10118277 3300025912 Bacteria 2316
225 Ga0207707_10274640 3300025912 Bacteria 1460
226 Ga0207695_10011149 3300025913 Bacteria 10908
227 Ga0207695_10015102 3300025913 Bacteria 9111
228 Ga0207695_10031699 3300025913 Bacteria 5793
229 Ga0207695_10061182 3300025913 Bacteria 3893
230 Ga0207695_10225025 3300025913 Bacteria 1782
231 Ga0207671_10153593 3300025914 Bacteria 1779
232 Ga0207660_10000368 3300025917 Bacteria 29401
233 Ga0207660_10000420 3300025917 Bacteria 28018
234 Ga0207660_10000561 3300025917 Bacteria 24996
235 Ga0207660_10019410 3300025917 Bacteria 4544
236 Ga0207660_10033468 3300025917 Bacteria 3556
237 Ga0207660_10049509 3300025917 Bacteria 2979
238 Ga0207660_10090506 3300025917 Bacteria 2267
239 Ga0207660_10097799 3300025917 Bacteria 2188
240 Ga0207660_10550542 3300025917 Bacteria 938
241 Ga0207662_10220788 3300025918 Bacteria 1234
242 Ga0207657_10001354 3300025919 Bacteria 26098
243 Ga0207657_10005703 3300025919 Bacteria 12996
244 Ga0207657_10008784 3300025919 Bacteria 10225
245 Ga0207657_10075053 3300025919 Bacteria 2854
246 Ga0207649_10000984 3300025920 Bacteria 17640
247 Ga0207649_10012386 3300025920 Bacteria 4730
248 Ga0207649_10022872 3300025920 Bacteria 3612
249 Ga0207649_10044932 3300025920 Bacteria 2706
250 Ga0207652_10000076 3300025921 Bacteria 107686
251 Ga0207652_10000082 3300025921 Bacteria 103057
252 Ga0207652_10000339 3300025921 Bacteria 48658
253 Ga0207652_10001827 3300025921 Bacteria 18463
254 Ga0207652_10023885 3300025921 Bacteria 5070
255 Ga0207652_10028275 3300025921 Bacteria 4677
256 Ga0207652_10045114 3300025921 Bacteria 3757
257 Ga0207652_10483432 3300025921 Bacteria 1115
258 Ga0207681_10021357 3300025923 Bacteria 4114
259 Ga0207694_10006377 3300025924 Bacteria 8994
260 Ga0207694_10009516 3300025924 Bacteria 7329
261 Ga0207650_10000894 3300025925 Bacteria 22547
262 Ga0207690_10000621 3300025932 Bacteria 22927
263 Ga0207690_10000739 3300025932 Bacteria 21062
264 Ga0207690_10013299 3300025932 Bacteria 4943
265 Ga0207690_10133429 3300025932 Bacteria 1820
266 Ga0207706_10003080 3300025933 Bacteria 16024
267 Ga0207706_10003682 3300025933 Bacteria 14626
268 Ga0207686_10020490 3300025934 Bacteria 3779
269 Ga0207709_10225124 3300025935 Bacteria 1355
270 Ga0207670_10134644 3300025936 Bacteria 1815
271 Ga0207704_10082464 3300025938 Bacteria 2083
272 Ga0207691_10008980 3300025940 Bacteria 9587
273 Ga0207661_10009364 3300025944 Bacteria 7020
274 Ga0207661_10065732 3300025944 Bacteria 2944
275 Ga0207679_10005533 3300025945 Bacteria 7916
276 Ga0207679_10233257 3300025945 Bacteria 1555
277 Ga0207679_10653098 3300025945 Bacteria 951
278 Ga0207667_10010147 3300025949 Bacteria 11031
279 Ga0207667_10011653 3300025949 Bacteria 10204
280 Ga0207667_10023369 3300025949 Bacteria 6807
281 Ga0207667_10032214 3300025949 Bacteria 5651
282 Ga0207667_10053764 3300025949 Bacteria 4236
283 Ga0207667_10061006 3300025949 Bacteria 3946
284 Ga0207651_10383344 3300025960 Bacteria 1192
285 Ga0207640_10002811 3300025981 Bacteria 9330
286 Ga0207640_10005324 3300025981 Bacteria 7010
287 Ga0207640_10099076 3300025981 Bacteria 2039
288 Ga0207640_10512578 3300025981 Bacteria 1001
289 Ga0207640_10676498 3300025981 Bacteria 882
290 Ga0207658_10155337 3300025986 Bacteria 1869
291 Ga0207658_10679311 3300025986 Bacteria 929
292 Ga0207677_10099562 3300026023 Bacteria 2135
293 Ga0207639_10001518 3300026041 Bacteria 15596
294 Ga0207639_10029049 3300026041 Bacteria 4044
295 Ga0207639_10340267 3300026041 Bacteria 1337
296 Ga0207678_10000886 3300026067 Bacteria 27527
297 Ga0207678_10004889 3300026067 Bacteria 12039
298 Ga0207678_10020950 3300026067 Bacteria 5730
299 Ga0207678_10044321 3300026067 Bacteria 3848
300 Ga0207708_10018093 3300026075 Bacteria 5302
301 Ga0207702_10007519 3300026078 Bacteria 9288
302 Ga0207702_10227796 3300026078 Bacteria 1740
303 Ga0207676_10034269 3300026095 Bacteria 3844
304 Ga0207674_10001405 3300026116 Bacteria 31074
305 Ga0207674_10074014 3300026116 Bacteria 3419
306 Ga0207674_10078688 3300026116 Bacteria 3302
307 Ga0207683_10004470 3300026121 Bacteria 12073
308 Ga0207698_10001395 3300026142 Bacteria 14029
309 Ga0207698_10007721 3300026142 Bacteria 6749
310 Ga0207698_10012116 3300026142 Bacteria 5627
311 Ga0209984_1007378 3300027424 Bacteria 1365
312 Ga0209982_1001370 3300027552 Bacteria 3312
313 Ga0210002_1022253 3300027617 Bacteria 1027
314 Ga0209983_1020611 3300027665 Bacteria 1375
315 Ga0209998_10005805 3300027717 Bacteria 2571
316 Ga0209974_10010926 3300027876 Bacteria 3056
317 Ga0209974_10070393 3300027876 Bacteria 1193
318 Ga0207428_10535590 3300027907 Bacteria 848
319 Ga0268266_10000091 3300028379 Bacteria 195002
320 Ga0268266_10510649 3300028379 Bacteria 1148
321 Ga0268264_10022376 3300028381 Bacteria 5163
322 Ga0265334_10089537 3300028573 Bacteria 1124
323 Ga0265338_10000782 3300028800 Bacteria 53947
324 Ga0265332_10004064 3300031238 Bacteria 6950
325 Ga0265325_10000090 3300031241 Bacteria 64219
326 Ga0265329_10040565 3300031242 Bacteria 1494
327 Ga0265340_10081503 3300031247 Bacteria 1523
328 Ga0265339_10098761 3300031249 Bacteria 1522
329 Ga0265313_10000178 3300031595 Bacteria 67583
330 Ga0265342_10002396 3300031712 Bacteria 16243
331 Ga0307405_10129049 3300031731 Bacteria 1744
332 Ga0307412_10000608 3300031911 Bacteria 21074
333 Ga0307510_10001702 3300033180 Bacteria 24446
334 Ga0373945_0003451 3300035116 Bacteria 4971
335 Ga0373931_0006821 3300035691 Bacteria 5367
336 Ga0373925_0202981 3300037068 Bacteria 1577
337 Ga0395899_0000905 3300037312 Bacteria 27909
338 Ga0395899_0013830 3300037312 Bacteria 6167
339 Ga0395899_0036111 3300037312 Bacteria 3709
340 Ga0395900_0000189 3300037418 Bacteria 98932
341 Ga0395900_0001663 3300037418 Bacteria 26026
342 Ga0395900_0025280 3300037418 Bacteria 6079
343 Ga0395900_0191772 3300037418 Bacteria 2072
344 Ga0395898_0000605 3300037466 Bacteria 66501
345 Ga0395898_0025812 3300037466 Bacteria 5917
346 Ga0395898_0112713 3300037466 Bacteria 2606
347 Ga0395898_0125856 3300037466 Bacteria 2455
348 Ga0395898_0255691 3300037466 Bacteria 1670
349 Ga0395905_0283636 3300037471 Bacteria 1542
350 Ga0395905_0403744 3300037471 Bacteria 1261
351 Ga0395905_0575693 3300037471 Bacteria 1027
352 Ga0395901_0029754 3300038443 Bacteria 5624
353 Ga0436361_0192686 3300039447 Bacteria 1152
354 Ga0439436_0000022 3300041404 Bacteria 60408
355 Ga0439465_0000154 3300041413 Bacteria 17032
356 Ga0439445_0013477 3300042004 Bacteria 1979
357 Ga0450908_000055 3300042184 Bacteria 22398
358 Ga0451577_0479248 3300042876 Bacteria 1129
359 Ga0466957_0261927 3300044842 Bacteria 1152
360 Ga0451576_0615234 3300045051 Bacteria 1141
361 Ga0495590_0000028 3300046457 Bacteria 152333
362 Ga0495590_0000219 3300046457 Bacteria 31359
363 Ga0495653_0002045 3300046463 Bacteria 15849
364 Ga0495653_0042385 3300046463 Bacteria 3545
365 Ga0495653_0098093 3300046463 Bacteria 2128
366 Ga0495650_0000469 3300046471 Bacteria 62135
367 Ga0495580_0012147 3300046472 Bacteria 6623
368 Ga0495580_0306634 3300046472 Bacteria 1081
369 Ga0495605_0039141 3300046474 Bacteria 2376
370 Ga0495605_0040955 3300046474 Bacteria 2309
371 Ga0495584_0067331 3300046491 Bacteria 1800
372 Ga0495584_0207783 3300046491 Bacteria 995
373 Ga0495585_0000746 3300046492 Bacteria 28843
374 Ga0495594_0072363 3300046499 Bacteria 1917
375 Ga0495596_0015096 3300046500 Bacteria 3243
376 Ga0495606_0006832 3300046507 Bacteria 10417
377 Ga0495606_0044883 3300046507 Bacteria 2936
378 Ga0495606_0090199 3300046507 Bacteria 1887
379 Ga0495606_0112238 3300046507 Bacteria 1643
380 Ga0495606_0202954 3300046507 Bacteria 1128
381 Ga0495610_0001156 3300046512 Bacteria 24006
382 Ga0495616_0000095 3300046513 Bacteria 74912
383 Ga0495630_0002928 3300046517 Bacteria 11862
384 Ga0495631_0006043 3300046518 Bacteria 6293
385 Ga0495631_0010642 3300046518 Bacteria 4549
386 Ga0495637_0004951 3300046520 Bacteria 6857
387 Ga0495666_0002391 3300046526 Bacteria 9345
388 Ga0495642_0011224 3300046528 Bacteria 3436
389 Ga0495652_0050731 3300046529 Bacteria 3546
390 Ga0495665_0004500 3300046531 Bacteria 7522
391 Ga0495665_0004677 3300046531 Bacteria 7385
392 Ga0495640_0025994 3300046533 Bacteria 4239
393 Ga0495609_0000926 3300046538 Bacteria 21252
394 Ga0495597_0000178 3300046542 Bacteria 56443
395 Ga0495597_0014326 3300046542 Bacteria 3778
396 Ga0495633_0089346 3300046558 Bacteria 1432
397 Ga0495633_0124056 3300046558 Bacteria 1196
398 Ga0495668_0016739 3300046616 Bacteria 4261
399 Ga0495634_0012741 3300046642 Bacteria 6087
400 Ga0495611_0060920 3300046648 Bacteria 1714
401 Ga0495661_0004816 3300046665 Bacteria 9676
402 Ga0495623_0017956 3300046679 Bacteria 4571
403 Ga0495623_0029123 3300046679 Bacteria 3555
404 Ga0495623_0067108 3300046679 Bacteria 2240
405 Ga0495646_0368443 3300046680 Bacteria 750
406 Ga0495670_0002619 3300046691 Bacteria 8884
407 Ga0495671_0034421 3300046692 Bacteria 2575
408 Ga0495649_0015184 3300046694 Bacteria 4384
409 Ga0495600_0036917 3300046809 Bacteria 3176
410 Ga0495660_0038311 3300046810 Bacteria 2665
411 Ga0495604_0030141 3300047317 Bacteria 4311
412 Ga0495636_0017920 3300047318 Bacteria 2838
413 Ga0495672_0000150 3300047320 Bacteria 101026
414 Ga0495680_0080993 3300047322 Bacteria 2452
415 Ga0495675_0046342 3300047444 Bacteria 2767
416 Ga0495679_051387 3300047446 Bacteria 1236
417 Ga0495602_0007516 3300048088 Bacteria 11397
418 Ga0495626_0000364 3300048091 Bacteria 47517
419 Ga0495626_0042184 3300048091 Bacteria 2144
420 Ga0495626_0126596 3300048091 Bacteria 1094
421 Ga0496102_0174682 3300048905 Bacteria 2023
422 Ga0496102_0576614 3300048905 Bacteria 1048
423 Ga0496105_0110632 3300048908 Bacteria 2268
424 Ga0496106_0065882 3300048909 Bacteria 2758
425 Ga0496108_0033502 3300048911 Bacteria 4268
426 Ga0496112_0005233 3300048915 Bacteria 11168
427 Ga0496112_0084826 3300048915 Bacteria 3133
428 Ga0496113_0039580 3300048916 Bacteria 3470
429 Ga0496119_0025219 3300048922 Bacteria 4158
430 Ga0496121_0091531 3300048924 Bacteria 2374
431 Ga0496124_0063535 3300048927 Bacteria 3084
432 Ga0496126_0222362 3300048929 Bacteria 1585
433 Ga0501031_0481327 3300049568 Bacteria 801
434 Ga0501033_0041796 3300049570 Bacteria 3419
435 Ga0501034_0070716 3300049571 Bacteria 3501
436 Ga0501036_0199553 3300049572 Bacteria 1683
437 Ga0501037_0002238 3300049573 Bacteria 13979
438 Ga0501038_0033363 3300049574 Bacteria 4536
439 Ga0501047_0001702 3300049581 Bacteria 21390
440 Ga0501047_0414273 3300049581 Bacteria 1179
441 Ga0501069_0000180 3300049585 Bacteria 28489
442 Ga0501069_0016089 3300049585 Bacteria 4013
443 Ga0501070_0000728 3300049586 Bacteria 30077
444 Ga0501070_0009118 3300049586 Bacteria 8390
445 Ga0501070_0017441 3300049586 Bacteria 6027
446 Ga0501070_0031209 3300049586 Bacteria 4464
447 Ga0501070_0139347 3300049586 Bacteria 2003
448 Ga0501070_0228097 3300049586 Bacteria 1526
449 Ga0501071_0005004 3300049587 Bacteria 8471
450 Ga0501071_0386168 3300049587 Bacteria 1068
451 Ga0501073_0001721 3300049589 Bacteria 16256
452 Ga0501073_0192631 3300049589 Bacteria 1411
453 Ga0501074_0000200 3300049590 Bacteria 32565
454 Ga0501074_0334725 3300049590 Bacteria 1074
455 Ga0501076_0459851 3300049592 Bacteria 1048
456 Ga0501080_0006034 3300049742 Bacteria 10856
457 Ga0501080_0137592 3300049742 Bacteria 2259
458 Ga0501080_0304229 3300049742 Bacteria 1445
459 Ga0501035_0010205 3300049822 Bacteria 8715
460 Ga0501035_0022665 3300049822 Bacteria 5768
461 Ga0501035_0055003 3300049822 Bacteria 3554
462 Ga0501044_0003083 3300049823 Bacteria 18866
463 Ga0501044_0005818 3300049823 Bacteria 13658
464 Ga0501044_0386790 3300049823 Bacteria 1313
465 nmdc:mga05p37_392494_c1 3300050507 Bacteria 1623
466 nmdc:mga05p37_98259_c1 3300050507 Bacteria 3606
467 nmdc:mga08y16_183878_c1 3300050511 Bacteria 2169
468 nmdc:mga08y16_223217_c1 3300050511 Bacteria 1950
469 nmdc:mga0n895_117436_c1 3300050512 Bacteria 2680
470 nmdc:mga0rr50_406713_c1 3300050513 Bacteria 1150
471 nmdc:mga08x19_270384_c1 3300050514 Bacteria 1176
472 nmdc:mga08x19_444523_c1 3300050514 Bacteria 912
473 nmdc:mga0a205_233030_c1 3300050515 Bacteria 1724
474 nmdc:mga0a205_34083_c1 3300050515 Bacteria 4885
475 nmdc:mga0sz30_73392_c1 3300050516 Bacteria 1475
476 2595447140 2593339238 Bacteria 4182970
477 2842920197 2842918807 Bacteria 4289178
478 2919406447 2919404418 Bacteria 4232372
479 2928963712 2928963466 Bacteria 5165703
480 2953995491 2953994433 Bacteria 4303959
481 JGI24740J21852_10007545
482 JGI24741J21665_1000193
483 JGI24741J21665_1001971
484 JGI24741J21665_1007188
485 JGI24740J21852_10000222
486 JGI25162J39368_1001917
487 JGI25164J39214_1000127
488 JGI25164J39214_1000154
489 JGI25165J46597_1000212
490 Ga0055527_1003589
491 Ga0055535_1001529
492 Ga0055542_1000010
493 Ga0055542_1000141
494 Ga0055529_1000164
495 Ga0058861_10059377
496 Ga0065165_1001169
497 Ga0065712_10003376
498 Ga0065712_10007520
499 Ga0065715_10009106
500 Ga0065715_10091129
501 Ga0065707_10085325
502 Ga0065707_10139563
503 Ga0070658_10195301
504 Ga0070676_10070825
505 Ga0070683_100175006
506 Ga0070683_100527034
507 Ga0070690_100040046
508 Ga0070670_100006588
509 Ga0068869_100015508
510 Ga0070666_10000022
511 Ga0070666_10008936
512 Ga0070680_100000301
513 Ga0070680_100001972
514 Ga0070680_100012272
515 Ga0070680_100041677
516 Ga0070680_100081379
517 Ga0070680_100217134
518 Ga0070680_100226543
519 Ga0070680_100558785
520 Ga0070682_100002929
521 Ga0070682_100059645
522 Ga0068868_100029859
523 Ga0070660_100025208
524 Ga0070689_100133453
525 Ga0070689_100215737
526 Ga0070691_10009187
527 Ga0070691_10022249
528 Ga0070691_10046502
529 Ga0070687_100034702
530 Ga0070661_100002931
531 Ga0070661_100014343
532 Ga0070661_100148334
533 Ga0070661_100185435
534 Ga0070661_100246614
535 Ga0070692_10000426
536 Ga0070692_10003911
537 Ga0070668_100020212
538 Ga0070669_100023641
539 Ga0070675_100027915
540 Ga0070671_100060873
541 Ga0070671_100061383
542 Ga0070671_100189101
543 Ga0070674_100013195
544 Ga0070659_100012634
545 Ga0070659_100068333
546 Ga0070667_100034131
547 Ga0070667_100036757
548 Ga0070705_100039753
549 Ga0070700_100260229
550 Ga0070694_100027597
551 Ga0070694_100125646
552 Ga0070663_100008525
553 Ga0070663_100012516
554 Ga0070663_100090403
555 Ga0070678_100005989
556 Ga0070662_100018630
557 Ga0070662_100062898
558 Ga0070681_10000062
559 Ga0070681_10004523
560 Ga0070681_10009826
561 Ga0070681_10020316
562 Ga0070681_10152348
563 Ga0070681_10282824
564 Ga0070685_10375738
565 Ga0070699_100782794
566 Ga0070679_100000188
567 Ga0070679_100003342
568 Ga0070679_100007853
569 Ga0070679_100036728
570 Ga0070679_100148405
571 Ga0070684_100041540
572 Ga0068853_100015990
573 Ga0068853_100042808
574 Ga0070672_100007640
575 Ga0070686_100362066
576 Ga0070695_100012317
577 Ga0070695_100039177
578 Ga0070696_100000213
579 Ga0070696_100010968
580 Ga0070696_100014056
581 Ga0070696_100075117
582 Ga0070693_100013813
583 Ga0070693_100045215
584 Ga0070665_100018940
585 Ga0070704_100043921
586 Ga0068855_100007071
587 Ga0068855_100013668
588 Ga0068855_100831734
589 Ga0070664_100001569
590 Ga0070664_100088016
591 Ga0068857_100128045
592 Ga0068854_100007806
593 Ga0068854_100034971
594 Ga0068854_100558604
595 Ga0068856_100035856
596 Ga0068856_100081417
597 Ga0070702_100087741
598 Ga0068852_100080126
599 Ga0068852_100085796
600 Ga0068859_100355012
601 Ga0068864_100038943
602 Ga0068861_100121843
603 Ga0068860_100015053
604 Ga0070712_100172159
605 Ga0097621_100123733
606 Ga0068871_100105607
607 Ga0075433_10025211
608 Ga0075433_10059288
609 Ga0075434_100056075
610 Ga0075434_100070867
611 Ga0068865_100041734
612 Ga0075436_100160199
613 Ga0097620_100355008
614 Ga0105240_10078058
615 Ga0105240_10229165
616 Ga0105240_10650242
617 Ga0111539_10155326
618 Ga0105245_10074247
619 Ga0105247_10269939
620 Ga0114129_10159709
621 Ga0114129_10332848
622 Ga0105243_10049829
623 Ga0105241_10023116
624 Ga0105241_10024621
625 Ga0105242_10024690
626 Ga0105242_10436028
627 Ga0105248_10003765
628 Ga0105237_10157666
629 Ga0105237_10482945
630 Ga0105238_10000266
631 Ga0105239_10088711
632 Ga0105246_10006591
633 Ga0157373_10038105
634 Ga0157373_10049718
635 Ga0157373_10168534
636 Ga0157371_10087870
637 Ga0157371_10097115
638 Ga0157370_10011351
639 Ga0157370_10017334
640 Ga0157369_10032774
641 Ga0157374_10010790
642 Ga0157378_10093220
643 Ga0157378_10234888
644 Ga0163162_10000249
645 Ga0163162_10056978
646 Ga0157372_10003444
647 Ga0157372_10012179
648 Ga0157372_10026893
649 Ga0157372_10223629
650 Ga0157372_10834705
651 Ga0157380_10580763
652 Ga0182008_10000262
653 Ga0157379_10461899
654 Ga0182006_1001950
655 Ga0182007_10068105
656 Ga0182005_1000434
657 Ga0206356_10117691
658 Ga0206356_10940428
659 Ga0206349_1330366
660 Ga0206352_10340506
661 Ga0206354_10239161
662 Ga0206354_10906169
663 Ga0206353_10385063
664 Ga0206353_11302849
665 Ga0154015_1355434
666 Ga0209674_102468
667 Ga0209672_100177
668 Ga0207427_100062
669 Ga0207427_101764
670 Ga0209437_100180
671 Ga0209437_100258
672 Ga0209437_101521
673 Ga0209258_100088
674 Ga0209258_101867
675 Ga0209026_1000836
676 Ga0209026_1001427
677 Ga0209148_1000005
678 Ga0209148_1000024
679 Ga0209148_1002951
680 Ga0209233_1000023
681 Ga0207666_1002521
682 Ga0209455_1000025
683 Ga0207697_10005087
684 Ga0207697_10007364
685 Ga0207680_10000001
686 Ga0207680_10095345
687 Ga0207647_10002262
688 Ga0207647_10025506
689 Ga0207647_10161689
690 Ga0207645_10016094
691 Ga0207705_10000097
692 Ga0207705_10000860
693 Ga0207705_10002152
694 Ga0207705_10010347
695 Ga0207705_10019909
696 Ga0207654_10195684
697 Ga0207707_10000065
698 Ga0207707_10000084
699 Ga0207707_10000144
700 Ga0207707_10000949
701 Ga0207707_10002017
702 Ga0207707_10002311
703 Ga0207707_10020735
704 Ga0207707_10118277
705 Ga0207707_10274640
706 Ga0207695_10011149
707 Ga0207695_10015102
708 Ga0207695_10031699
709 Ga0207695_10061182
710 Ga0207695_10225025
711 Ga0207671_10153593
712 Ga0207660_10000368
713 Ga0207660_10000420
714 Ga0207660_10000561
715 Ga0207660_10019410
716 Ga0207660_10033468
717 Ga0207660_10049509
718 Ga0207660_10090506
719 Ga0207660_10097799
720 Ga0207660_10550542
721 Ga0207662_10220788
722 Ga0207657_10001354
723 Ga0207657_10005703
724 Ga0207657_10008784
725 Ga0207657_10075053
726 Ga0207649_10000984
727 Ga0207649_10012386
728 Ga0207649_10022872
729 Ga0207649_10044932
730 Ga0207652_10000076
731 Ga0207652_10000082
732 Ga0207652_10000339
733 Ga0207652_10001827
734 Ga0207652_10023885
735 Ga0207652_10028275
736 Ga0207652_10045114
737 Ga0207652_10483432
738 Ga0207681_10021357
739 Ga0207694_10006377
740 Ga0207694_10009516
741 Ga0207650_10000894
742 Ga0207690_10000621
743 Ga0207690_10000739
744 Ga0207690_10013299
745 Ga0207690_10133429
746 Ga0207706_10003080
747 Ga0207706_10003682
748 Ga0207686_10020490
749 Ga0207709_10225124
750 Ga0207670_10134644
751 Ga0207704_10082464
752 Ga0207691_10008980
753 Ga0207661_10009364
754 Ga0207661_10065732
755 Ga0207679_10005533
756 Ga0207679_10233257
757 Ga0207679_10653098
758 Ga0207667_10010147
759 Ga0207667_10011653
760 Ga0207667_10023369
761 Ga0207667_10032214
762 Ga0207667_10053764
763 Ga0207667_10061006
764 Ga0207651_10383344
765 Ga0207640_10002811
766 Ga0207640_10005324
767 Ga0207640_10099076
768 Ga0207640_10512578
769 Ga0207640_10676498
770 Ga0207658_10155337
771 Ga0207658_10679311
772 Ga0207677_10099562
773 Ga0207639_10001518
774 Ga0207639_10029049
775 Ga0207639_10340267
776 Ga0207678_10000886
777 Ga0207678_10004889
778 Ga0207678_10020950
779 Ga0207678_10044321
780 Ga0207708_10018093
781 Ga0207702_10007519
782 Ga0207702_10227796
783 Ga0207676_10034269
784 Ga0207674_10001405
785 Ga0207674_10074014
786 Ga0207674_10078688
787 Ga0207683_10004470
788 Ga0207698_10001395
789 Ga0207698_10007721
790 Ga0207698_10012116
791 Ga0209984_1007378
792 Ga0209982_1001370
793 Ga0210002_1022253
794 Ga0209983_1020611
795 Ga0209998_10005805
796 Ga0209974_10010926
797 Ga0209974_10070393
798 Ga0207428_10535590
799 Ga0268266_10000091
800 Ga0268266_10510649
801 Ga0268264_10022376
802 Ga0265334_10089537
803 Ga0265338_10000782
804 Ga0265332_10004064
805 Ga0265325_10000090
806 Ga0265329_10040565
807 Ga0265340_10081503
808 Ga0265339_10098761
809 Ga0265313_10000178
810 Ga0265342_10002396
811 Ga0307405_10129049
812 Ga0307412_10000608
813 Ga0307510_10001702
814 Ga0373945_0003451
815 Ga0373931_0006821
816 Ga0373925_0202981
817 Ga0395899_0000905
818 Ga0395899_0013830
819 Ga0395899_0036111
820 Ga0395900_0000189
821 Ga0395900_0001663
822 Ga0395900_0025280
823 Ga0395900_0191772
824 Ga0395898_0000605
825 Ga0395898_0025812
826 Ga0395898_0112713
827 Ga0395898_0125856
828 Ga0395898_0255691
829 Ga0395905_0283636
830 Ga0395905_0403744
831 Ga0395905_0575693
832 Ga0395901_0029754
833 Ga0436361_0192686
834 Ga0439436_0000022
835 Ga0439465_0000154
836 Ga0439445_0013477
837 Ga0450908_000055
838 Ga0451577_0479248
839 Ga0466957_0261927
840 Ga0451576_0615234
841 Ga0495590_0000028
842 Ga0495590_0000219
843 Ga0495653_0002045
844 Ga0495653_0042385
845 Ga0495653_0098093
846 Ga0495650_0000469
847 Ga0495580_0012147
848 Ga0495580_0306634
849 Ga0495605_0039141
850 Ga0495605_0040955
851 Ga0495584_0067331
852 Ga0495584_0207783
853 Ga0495585_0000746
854 Ga0495594_0072363
855 Ga0495596_0015096
856 Ga0495606_0006832
857 Ga0495606_0044883
858 Ga0495606_0090199
859 Ga0495606_0112238
860 Ga0495606_0202954
861 Ga0495610_0001156
862 Ga0495616_0000095
863 Ga0495630_0002928
864 Ga0495631_0006043
865 Ga0495631_0010642
866 Ga0495637_0004951
867 Ga0495666_0002391
868 Ga0495642_0011224
869 Ga0495652_0050731
870 Ga0495665_0004500
871 Ga0495665_0004677
872 Ga0495640_0025994
873 Ga0495609_0000926
874 Ga0495597_0000178
875 Ga0495597_0014326
876 Ga0495633_0089346
877 Ga0495633_0124056
878 Ga0495668_0016739
879 Ga0495634_0012741
880 Ga0495611_0060920
881 Ga0495661_0004816
882 Ga0495623_0017956
883 Ga0495623_0029123
884 Ga0495623_0067108
885 Ga0495646_0368443
886 Ga0495670_0002619
887 Ga0495671_0034421
888 Ga0495649_0015184
889 Ga0495600_0036917
890 Ga0495660_0038311
891 Ga0495604_0030141
892 Ga0495636_0017920
893 Ga0495672_0000150
894 Ga0495680_0080993
895 Ga0495675_0046342
896 Ga0495679_051387
897 Ga0495602_0007516
898 Ga0495626_0000364
899 Ga0495626_0042184
900 Ga0495626_0126596
901 Ga0496102_0174682
902 Ga0496102_0576614
903 Ga0496105_0110632
904 Ga0496106_0065882
905 Ga0496108_0033502
906 Ga0496112_0005233
907 Ga0496112_0084826
908 Ga0496113_0039580
909 Ga0496119_0025219
910 Ga0496121_0091531
911 Ga0496124_0063535
912 Ga0496126_0222362
913 Ga0501031_0481327
914 Ga0501033_0041796
915 Ga0501034_0070716
916 Ga0501036_0199553
917 Ga0501037_0002238
918 Ga0501038_0033363
919 Ga0501047_0001702
920 Ga0501047_0414273
921 Ga0501069_0000180
922 Ga0501069_0016089
923 Ga0501070_0000728
924 Ga0501070_0009118
925 Ga0501070_0017441
926 Ga0501070_0031209
927 Ga0501070_0139347
928 Ga0501070_0228097
929 Ga0501071_0005004
930 Ga0501071_0386168
931 Ga0501073_0001721
932 Ga0501073_0192631
933 Ga0501074_0000200
934 Ga0501074_0334725
935 Ga0501076_0459851
936 Ga0501080_0006034
937 Ga0501080_0137592
938 Ga0501080_0304229
939 Ga0501035_0010205
940 Ga0501035_0022665
941 Ga0501035_0055003
942 Ga0501044_0003083
943 Ga0501044_0005818
944 Ga0501044_0386790
945 nmdc:mga05p37_392494_c1
946 nmdc:mga05p37_98259_c1
947 nmdc:mga08y16_183878_c1
948 nmdc:mga08y16_223217_c1
949 nmdc:mga0n895_117436_c1
950 nmdc:mga0rr50_406713_c1
951 nmdc:mga08x19_270384_c1
952 nmdc:mga08x19_444523_c1
953 nmdc:mga0a205_233030_c1
954 nmdc:mga0a205_34083_c1
955 nmdc:mga0sz30_73392_c1
956 2595447140
957 2842920197
958 2919406447
959 2928963712
960 2953995491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

137

285

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.9207 89 229
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8655 93 232
6y0k-assembly1.cif.gz_AAA-2 sulfite oxidase from thermus thermophilus with coordinated phosphate 0.8555 95 230
3hbg-assembly1.cif.gz_A-2 structure of recombinant chicken liver sulfite oxidase mutant c185s 0.8425 64 228
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8411 95 244
ID Description Score Start End Superfamily
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9138 93 232 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.864 93 232 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8276 93 244 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8249 76 227 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8045 76 227 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A431KVI2-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.957 78 241 GO:0016020
GO:0022904
AF-A0A7V2QGH1-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9544 93 229
AF-F9G6G0-F1-model_v4 Sulfite oxidase 0.9488 93 229 GO:0005739
GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A7C7WE29-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9434 93 230
AF-A0A7Z9GMK5-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9429 93 230 GO:0006790
GO:0008482
GO:0020037
GO:0043546

Map