F452125

General Info

Members Datasets Scaffolds Average Seq Length
479 283 959 123

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0029247|Ga0500583_0029247_1729_2157
Length 142
Sequence MIADTPDQRRTARKESAMLQTEFSFHLPLGFVDAEGNLHREGTMRLATAYDEIAPLKDPRVQANPGYLLVILLARVITRLGTLEQLNPKVIEGLYAGDLAYLQDLYQRVNEHGTDRVVTQCPHCDKAFSVEVRNAGGSGATP

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
274 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
275 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 3.34
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 2.51
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0029247 3300053092 Bacteria 2400
2 rootH1_10019743 3300003316 Bacteria 1229
3 rootH1_10019743 3300003323 Bacteria 3234
4 rootL2_10049323 3300003322 Unclassified 1535
5 rootL2_10070379 3300003322 Bacteria 3630
6 rootL2_10262803 3300003322 Bacteria 1186
7 rootH1_10183523 3300003323 Unclassified 2723
8 Ga0058859_11200781 3300004798 Bacteria 1256
9 Ga0058863_11390249 3300004799 Unclassified 802
10 Ga0058860_11506702 3300004801 Bacteria 1041
11 Ga0058862_12847150 3300004803 Unclassified 1502
12 Ga0065704_10251693 3300005289 Bacteria 987
13 Ga0065707_10168071 3300005295 Bacteria 1506
14 Ga0065707_10344794 3300005295 Bacteria 928
15 Ga0070690_100086404 3300005330 Bacteria 2059
16 Ga0068869_100166881 3300005334 Bacteria 1717
17 Ga0068869_101087996 3300005334 Bacteria 699
18 Ga0068869_101559496 3300005334 Bacteria 587
19 Ga0070666_10104348 3300005335 Unclassified 1956
20 Ga0070680_100020416 3300005336 Bacteria 5258
21 Ga0070680_100603398 3300005336 Unclassified 942
22 Ga0070680_101642059 3300005336 Bacteria 557
23 Ga0068868_100258349 3300005338 Bacteria 1468
24 Ga0070660_100384270 3300005339 Bacteria 1159
25 Ga0070660_100432837 3300005339 Bacteria 1090
26 Ga0070689_100126128 3300005340 Bacteria 2048
27 Ga0070689_100170880 3300005340 Bacteria 1761
28 Ga0070687_100005687 3300005343 Bacteria 5058
29 Ga0070687_100161800 3300005343 Unclassified 1324
30 Ga0070661_100426079 3300005344 Bacteria 1052
31 Ga0070675_100001133 3300005354 Bacteria 19251
32 Ga0070675_100974818 3300005354 Bacteria 778
33 Ga0070671_100008912 3300005355 Bacteria 8049
34 Ga0070674_100043012 3300005356 Bacteria 3071
35 Ga0070673_100002447 3300005364 Bacteria 11313
36 Ga0070688_100050843 3300005365 Bacteria 2583
37 Ga0070688_100095823 3300005365 Unclassified 1948
38 Ga0070688_100436440 3300005365 Bacteria 976
39 Ga0070667_100057322 3300005367 Bacteria 3292
40 Ga0070667_102068476 3300005367 Unclassified 536
41 Ga0070709_10015004 3300005434 Unclassified 4398
42 Ga0070709_10139473 3300005434 Bacteria 1664
43 Ga0070714_101030215 3300005435 Bacteria 801
44 Ga0070713_100334231 3300005436 Unclassified 1402
45 Ga0070713_100344112 3300005436 Bacteria 1382
46 Ga0070713_100649916 3300005436 Unclassified 1004
47 Ga0070710_10007185 3300005437 Bacteria 5383
48 Ga0070710_10081954 3300005437 Unclassified 1885
49 Ga0070710_10160614 3300005437 Bacteria 1393
50 Ga0070711_100087621 3300005439 Unclassified 2236
51 Ga0070705_100000014 3300005440 Bacteria 94384
52 Ga0070705_100261087 3300005440 Unclassified 1221
53 Ga0070705_100434974 3300005440 Bacteria 980
54 Ga0070700_100748437 3300005441 Bacteria 782
55 Ga0070708_100019227 3300005445 Bacteria 5736
56 Ga0070708_100232977 3300005445 Bacteria 1728
57 Ga0070708_101061841 3300005445 Bacteria 759
58 Ga0070663_101723947 3300005455 Bacteria 560
59 Ga0070681_10002203 3300005458 Bacteria 17752
60 Ga0068867_100272743 3300005459 Bacteria 1384
61 Ga0070685_10002356 3300005466 Bacteria 9737
62 Ga0070706_100320729 3300005467 Bacteria 1445
63 Ga0070699_100844508 3300005518 Unclassified 838
64 Ga0070679_100012706 3300005530 Bacteria 8054
65 Ga0070679_100344426 3300005530 Bacteria 1438
66 Ga0070679_100841065 3300005530 Bacteria 861
67 Ga0070684_101095922 3300005535 Bacteria 748
68 Ga0070697_101235247 3300005536 Bacteria 666
69 Ga0070697_102089167 3300005536 Bacteria 507
70 Ga0070672_100038916 3300005543 Bacteria 3638
71 Ga0070672_100320122 3300005543 Bacteria 1318
72 Ga0070672_101934366 3300005543 Bacteria 531
73 Ga0070686_100124338 3300005544 Unclassified 1775
74 Ga0070695_100801986 3300005545 Bacteria 754
75 Ga0070696_100232501 3300005546 Bacteria 1387
76 Ga0070696_100520498 3300005546 Bacteria 949
77 Ga0070696_100636874 3300005546 Bacteria 863
78 Ga0070696_101021631 3300005546 Bacteria 692
79 Ga0070665_100297241 3300005548 Bacteria 1617
80 Ga0070664_100002491 3300005564 Bacteria 14844
81 Ga0070664_101540670 3300005564 Unclassified 629
82 Ga0068856_101241674 3300005614 Unclassified 761
83 Ga0070702_100173028 3300005615 Bacteria 1406
84 Ga0068859_100005268 3300005617 Bacteria 13145
85 Ga0068864_100012265 3300005618 Bacteria 7083
86 Ga0068864_100457993 3300005618 Bacteria 1221
87 Ga0068866_10299818 3300005718 Bacteria 1003
88 Ga0068866_10505658 3300005718 Bacteria 800
89 Ga0068866_10596003 3300005718 Unclassified 745
90 Ga0068861_100849067 3300005719 Bacteria 861
91 Ga0068861_101058810 3300005719 Bacteria 777
92 Ga0068870_10147405 3300005840 Bacteria 1383
93 Ga0068863_100000380 3300005841 Bacteria 45271
94 Ga0068858_100044542 3300005842 Bacteria 4112
95 Ga0068858_100934282 3300005842 Bacteria 849
96 Ga0068860_100001325 3300005843 Bacteria 26877
97 Ga0068860_100851106 3300005843 Bacteria 927
98 Ga0068862_100558786 3300005844 Unclassified 1094
99 Ga0068862_100761120 3300005844 Bacteria 943
100 Ga0068862_100889169 3300005844 Bacteria 875
101 Ga0081455_10012738 3300005937 Bacteria 8366
102 Ga0081455_10098270 3300005937 Bacteria 2357
103 Ga0081455_10354499 3300005937 Bacteria 1034
104 Ga0081538_10096880 3300005981 Bacteria 1501
105 Ga0081539_10030679 3300005985 Bacteria 3331
106 Ga0070716_100056148 3300006173 Unclassified 2256
107 Ga0070716_101174248 3300006173 Bacteria 615
108 Ga0070712_100113019 3300006175 Unclassified 2030
109 Ga0070712_100454949 3300006175 Unclassified 1066
110 Ga0075367_10146964 3300006178 Bacteria 1462
111 Ga0097621_100006341 3300006237 Bacteria 8393
112 Ga0097621_100031469 3300006237 Bacteria 4211
113 Ga0097621_100138958 3300006237 Bacteria 2075
114 Ga0097621_100181389 3300006237 Bacteria 1819
115 Ga0097621_100876122 3300006237 Bacteria 835
116 Ga0068871_100009445 3300006358 Bacteria 7068
117 Ga0068871_100346565 3300006358 Bacteria 1313
118 Ga0068871_101494222 3300006358 Unclassified 638
119 Ga0075428_100000510 3300006844 Bacteria 39415
120 Ga0075428_100016496 3300006844 Bacteria 8156
121 Ga0075428_100156473 3300006844 Bacteria 2476
122 Ga0075430_100000227 3300006846 Bacteria 39046
123 Ga0075430_100001369 3300006846 Bacteria 19763
124 Ga0075430_100019875 3300006846 Bacteria 5714
125 Ga0075431_100001177 3300006847 Bacteria 23582
126 Ga0075431_100004675 3300006847 Bacteria 13442
127 Ga0075431_100589967 3300006847 Bacteria 1096
128 Ga0075433_10412759 3300006852 Bacteria 1191
129 Ga0075433_10806842 3300006852 Bacteria 820
130 Ga0075434_100011416 3300006871 Bacteria 8378
131 Ga0075429_100005762 3300006880 Bacteria 10695
132 Ga0075429_100095459 3300006880 Bacteria 2593
133 Ga0075429_100318701 3300006880 Bacteria 1361
134 Ga0075429_101946562 3300006880 Unclassified 509
135 Ga0068865_101410396 3300006881 Bacteria 622
136 Ga0075436_100158843 3300006914 Bacteria 1593
137 Ga0097620_100005267 3300006931 Bacteria 13145
138 Ga0075435_100002865 3300007076 Bacteria 11554
139 Ga0111539_10039612 3300009094 Bacteria 5677
140 Ga0111539_10078854 3300009094 Bacteria 3873
141 Ga0105245_11214611 3300009098 Bacteria 802
142 Ga0105245_12908067 3300009098 Unclassified 531
143 Ga0105247_10116818 3300009101 Unclassified 1724
144 Ga0114129_10000951 3300009147 Bacteria 37833
145 Ga0114129_10041465 3300009147 Bacteria 6486
146 Ga0114129_11371912 3300009147 Unclassified 873
147 Ga0114129_12235426 3300009147 Bacteria 658
148 Ga0105243_10301857 3300009148 Bacteria 1451
149 Ga0105243_10399679 3300009148 Bacteria 1276
150 Ga0105243_10429887 3300009148 Bacteria 1234
151 Ga0105242_10077578 3300009176 Bacteria 2772
152 Ga0105242_10278198 3300009176 Bacteria 1519
153 Ga0105242_11318453 3300009176 Bacteria 746
154 Ga0105242_11386122 3300009176 Bacteria 730
155 Ga0105248_10005096 3300009177 Bacteria 14495
156 Ga0105248_10020182 3300009177 Bacteria 7382
157 Ga0105248_10057540 3300009177 Bacteria 4364
158 Ga0105248_10272388 3300009177 Bacteria 1906
159 Ga0105238_10000007 3300009551 Bacteria 309725
160 Ga0105238_10769123 3300009551 Bacteria 978
161 Ga0105249_11604792 3300009553 Bacteria 723
162 Ga0105246_10263466 3300011119 Bacteria 1374
163 Ga0105246_10403291 3300011119 Bacteria 1136
164 Ga0105246_11737302 3300011119 Unclassified 594
165 Ga0157342_1048752 3300012507 Unclassified 589
166 Ga0157373_10147516 3300013100 Bacteria 1655
167 Ga0157369_12479668 3300013105 Bacteria 525
168 Ga0157374_12155292 3300013296 Bacteria 584
169 Ga0157378_10821427 3300013297 Bacteria 956
170 Ga0157378_12232650 3300013297 Bacteria 599
171 Ga0157378_12457744 3300013297 Bacteria 573
172 Ga0157378_13055062 3300013297 Bacteria 519
173 Ga0163162_10000425 3300013306 Bacteria 38967
174 Ga0163162_10008675 3300013306 Bacteria 9891
175 Ga0163162_12905030 3300013306 Bacteria 551
176 Ga0157372_12291849 3300013307 Bacteria 620
177 Ga0157375_10001372 3300013308 Bacteria 21024
178 Ga0157375_10547596 3300013308 Bacteria 1319
179 Ga0157375_10665515 3300013308 Unclassified 1197
180 Ga0157375_11057102 3300013308 Bacteria 949
181 Ga0157375_13245279 3300013308 Unclassified 542
182 Ga0163163_10038566 3300014325 Bacteria 4658
183 Ga0157380_10239543 3300014326 Bacteria 1635
184 Ga0157380_10337746 3300014326 Bacteria 1404
185 Ga0157380_12382047 3300014326 Unclassified 594
186 Ga0157377_10665117 3300014745 Bacteria 752
187 Ga0157379_10000756 3300014968 Bacteria 26169
188 Ga0157376_10179176 3300014969 Bacteria 1936
189 Ga0163161_10059067 3300017792 Bacteria 2788
190 Ga0206353_10625478 3300020082 Bacteria 983
191 Ga0213876_10196150 3300021384 Bacteria 1073
192 Ga0213875_10000056 3300021388 Bacteria 136543
193 Ga0209233_1080925 3300025261 Bacteria 578
194 Ga0207692_10022215 3300025898 Bacteria 2916
195 Ga0207692_10065073 3300025898 Unclassified 1901
196 Ga0207692_10266539 3300025898 Bacteria 1031
197 Ga0207710_10149819 3300025900 Bacteria 1131
198 Ga0207680_10054196 3300025903 Bacteria 2412
199 Ga0207680_10221563 3300025903 Bacteria 1297
200 Ga0207699_10097150 3300025906 Unclassified 1861
201 Ga0207699_10133098 3300025906 Unclassified 1625
202 Ga0207643_10077549 3300025908 Bacteria 1921
203 Ga0207707_10014841 3300025912 Bacteria 6784
204 Ga0207693_10206598 3300025915 Bacteria 1544
205 Ga0207693_10375581 3300025915 Bacteria 1112
206 Ga0207660_10019752 3300025917 Bacteria 4510
207 Ga0207660_10715664 3300025917 Bacteria 817
208 Ga0207662_10014444 3300025918 Bacteria 4432
209 Ga0207662_10081008 3300025918 Unclassified 1981
210 Ga0207662_10185858 3300025918 Bacteria 1339
211 Ga0207662_11242152 3300025918 Bacteria 529
212 Ga0207657_11514837 3300025919 Bacteria 501
213 Ga0207649_11475652 3300025920 Unclassified 538
214 Ga0207652_10144756 3300025921 Bacteria 2126
215 Ga0207652_10940190 3300025921 Unclassified 762
216 Ga0207694_10000007 3300025924 Bacteria 595422
217 Ga0207694_10398799 3300025924 Bacteria 1144
218 Ga0207659_10000464 3300025926 Bacteria 24357
219 Ga0207687_11783030 3300025927 Unclassified 527
220 Ga0207664_10058187 3300025929 Bacteria 3074
221 Ga0207664_10395822 3300025929 Bacteria 1228
222 Ga0207644_10178135 3300025931 Bacteria 1664
223 Ga0207690_11108210 3300025932 Bacteria 660
224 Ga0207686_10116524 3300025934 Bacteria 1811
225 Ga0207686_10230196 3300025934 Bacteria 1343
226 Ga0207686_10629671 3300025934 Bacteria 847
227 Ga0207709_10003461 3300025935 Bacteria 9371
228 Ga0207709_10254113 3300025935 Bacteria 1285
229 Ga0207709_10799921 3300025935 Bacteria 761
230 Ga0207670_10044728 3300025936 Bacteria 2931
231 Ga0207670_10644588 3300025936 Bacteria 873
232 Ga0207669_10032454 3300025937 Bacteria 2933
233 Ga0207665_10076831 3300025939 Unclassified 2291
234 Ga0207665_11391205 3300025939 Unclassified 559
235 Ga0207691_10110237 3300025940 Bacteria 2448
236 Ga0207711_10001886 3300025941 Bacteria 19102
237 Ga0207711_10024445 3300025941 Bacteria 5062
238 Ga0207711_10097263 3300025941 Bacteria 2599
239 Ga0207711_10389309 3300025941 Bacteria 1294
240 Ga0207711_10576309 3300025941 Bacteria 1050
241 Ga0207689_10103567 3300025942 Bacteria 2338
242 Ga0207689_10149036 3300025942 Bacteria 1928
243 Ga0207661_10436580 3300025944 Bacteria 1191
244 Ga0207679_10016066 3300025945 Unclassified 4963
245 Ga0207651_10159104 3300025960 Bacteria 1768
246 Ga0207712_10794127 3300025961 Bacteria 832
247 Ga0207658_10070260 3300025986 Bacteria 2649
248 Ga0207658_10172192 3300025986 Bacteria 1784
249 Ga0207677_10477479 3300026023 Bacteria 1073
250 Ga0207703_10104211 3300026035 Bacteria 2409
251 Ga0207703_11331234 3300026035 Bacteria 691
252 Ga0207708_10881687 3300026075 Bacteria 774
253 Ga0207641_10001153 3300026088 Bacteria 26542
254 Ga0207641_10463695 3300026088 Bacteria 1226
255 Ga0207648_10300489 3300026089 Bacteria 1439
256 Ga0207676_10018075 3300026095 Bacteria 5119
257 Ga0207676_10292357 3300026095 Bacteria 1484
258 Ga0207676_10469808 3300026095 Bacteria 1189
259 Ga0207674_10026343 3300026116 Bacteria 6177
260 Ga0207675_100291366 3300026118 Bacteria 1588
261 Ga0207675_100731261 3300026118 Unclassified 1000
262 Ga0207428_10021144 3300027907 Bacteria 5511
263 Ga0207428_10153892 3300027907 Bacteria 1749
264 Ga0207428_10283542 3300027907 Bacteria 1229
265 Ga0268266_10654321 3300028379 Bacteria 1011
266 Ga0268265_10334835 3300028380 Bacteria 1376
267 Ga0268265_10649026 3300028380 Bacteria 1014
268 Ga0268264_10002778 3300028381 Bacteria 15272
269 Ga0268264_11227878 3300028381 Bacteria 759
270 Ga0307517_10355063 3300028786 Unclassified 794
271 Ga0265760_10018879 3300031090 Bacteria 1987
272 Ga0265340_10028455 3300031247 Bacteria 2811
273 Ga0265339_10055028 3300031249 Bacteria 2159
274 Ga0307509_10289086 3300031507 Bacteria 1395
275 Ga0316579_10629963 3300031691 Bacteria 519
276 Ga0265314_10027336 3300031711 Bacteria 4272
277 Ga0307413_10330143 3300031824 Bacteria 1169
278 Ga0307406_10766671 3300031901 Unclassified 811
279 Ga0307412_10651137 3300031911 Bacteria 899
280 Ga0307409_101136076 3300031995 Bacteria 803
281 Ga0307416_100039131 3300032002 Bacteria 3668
282 Ga0307416_102433364 3300032002 Bacteria 623
283 Ga0307415_100091075 3300032126 Bacteria 2208
284 Ga0316593_10079224 3300032168 Bacteria 1145
285 Ga0316593_10098714 3300032168 Bacteria 1034
286 Ga0316593_10267423 3300032168 Unclassified 642
287 Ga0316586_1057123 3300033527 Unclassified 705
288 Ga0316588_1066706 3300033528 Bacteria 881
289 Ga0316587_1002155 3300033529 Bacteria 2584
290 Ga0316587_1008539 3300033529 Bacteria 1611
291 Ga0316587_1037827 3300033529 Bacteria 866
292 Ga0316596_1055251 3300033541 Unclassified 1054
293 Ga0373928_0108887 3300035084 Unclassified 731
294 Ga0373944_0298033 3300035089 Bacteria 605
295 Ga0373943_0282312 3300035170 Bacteria 939
296 Ga0373935_0475567 3300035692 Unclassified 905
297 Ga0373927_0490572 3300035695 Bacteria 812
298 Ga0373937_0106165 3300036401 Bacteria 2611
299 Ga0316584_0346503 3300036712 Unclassified 1067
300 Ga0395900_0383140 3300037418 Bacteria 1374
301 Ga0395900_0386281 3300037418 Bacteria 1367
302 Ga0395900_1151399 3300037418 Bacteria 692
303 Ga0395905_0670337 3300037471 Bacteria 939
304 Ga0395905_1311025 3300037471 Unclassified 628
305 Ga0436364_0196389 3300037853 Bacteria 74609
306 Ga0436364_1214568 3300037853 Unclassified 2108
307 Ga0395901_0444868 3300038443 Bacteria 1326
308 Ga0436365_0181249 3300039437 Unclassified 515
309 Ga0436365_0455506 3300039437 Bacteria 1705
310 Ga0436365_1259400 3300039437 Unclassified 615
311 Ga0436365_1618681 3300039437 Bacteria 663
312 Ga0436360_0658856 3300039438 Unclassified 773
313 Ga0436361_0087226 3300039447 Bacteria 35136
314 Ga0436363_0084770 3300039450 Bacteria 753
315 Ga0436362_0798289 3300039453 Unclassified 743
316 Ga0451837_1652775 3300041494 Bacteria 3489
317 Ga0451839_1299354 3300041496 Unclassified 527
318 Ga0439455_0104867 3300042012 Bacteria 783
319 Ga0439435_0207119 3300042436 Bacteria 649
320 Ga0439460_0367763 3300042461 Unclassified 508
321 Ga0466963_0266745 3300044694 Bacteria 1203
322 Ga0453684_0002706 3300044712 Bacteria 42066
323 Ga0453684_1651037 3300044712 Bacteria 656
324 Ga0453684_2156389 3300044712 Unclassified 557
325 Ga0466971_0587070 3300044719 Bacteria 555
326 Ga0451576_0048294 3300045051 Bacteria 4472
327 Ga0451576_0321464 3300045051 Bacteria 1619
328 Ga0466958_0456493 3300045836 Bacteria 828
329 Ga0466967_0953355 3300045976 Bacteria 854
330 Ga0466967_1284761 3300045976 Bacteria 729
331 Ga0466967_1983948 3300045976 Bacteria 579
332 Ga0495617_110130 3300046452 Bacteria 891
333 Ga0495638_0001512 3300046460 Bacteria 20930
334 Ga0495653_0737853 3300046463 Bacteria 596
335 Ga0495650_0011128 3300046471 Bacteria 4957
336 Ga0495580_0370744 3300046472 Unclassified 968
337 Ga0495605_0002389 3300046474 Bacteria 11634
338 Ga0495605_0280727 3300046474 Bacteria 708
339 Ga0495585_0151414 3300046492 Bacteria 1209
340 Ga0495594_0009227 3300046499 Bacteria 5091
341 Ga0495596_0303324 3300046500 Unclassified 621
342 Ga0495607_0041446 3300046501 Bacteria 2735
343 Ga0495583_0000095 3300046506 Bacteria 152114
344 Ga0495583_0374921 3300046506 Bacteria 560
345 Ga0495618_0747860 3300046514 Bacteria 572
346 Ga0495643_0000055 3300046522 Bacteria 198641
347 Ga0495642_0004753 3300046528 Bacteria 5253
348 Ga0495665_0446271 3300046531 Bacteria 654
349 Ga0495609_0079863 3300046538 Bacteria 1431
350 Ga0495622_0510863 3300046557 Unclassified 513
351 Ga0495599_0049178 3300046678 Bacteria 2643
352 Ga0495658_0377970 3300046683 Bacteria 902
353 Ga0495669_0022114 3300046684 Bacteria 2762
354 Ga0495670_0003195 3300046691 Bacteria 8070
355 Ga0495671_0099569 3300046692 Bacteria 1421
356 Ga0495649_0322766 3300046694 Bacteria 783
357 Ga0495589_0011894 3300046794 Bacteria 4513
358 Ga0495674_0022584 3300047319 Bacteria 5801
359 Ga0495674_0155211 3300047319 Bacteria 1918
360 Ga0495676_0596066 3300047321 Bacteria 720
361 Ga0495683_0134721 3300047323 Bacteria 1162
362 Ga0495684_0238870 3300047471 Bacteria 1326
363 Ga0495626_0046845 3300048091 Bacteria 2012
364 Ga0496101_0651149 3300048904 Bacteria 832
365 Ga0496104_0113535 3300048907 Bacteria 2598
366 Ga0496105_0284622 3300048908 Bacteria 1332
367 Ga0496108_0409254 3300048911 Bacteria 1185
368 Ga0496109_0422492 3300048912 Bacteria 1259
369 Ga0496109_0611790 3300048912 Unclassified 1026
370 Ga0496110_1587250 3300048913 Unclassified 564
371 Ga0496113_1357158 3300048916 Bacteria 552
372 Ga0496114_0000082 3300048917 Bacteria 68431
373 Ga0496114_0000193 3300048917 Bacteria 44410
374 Ga0496114_0299225 3300048917 Bacteria 1420
375 Ga0496115_0288186 3300048918 Bacteria 1347
376 Ga0496122_0530981 3300048925 Bacteria 565
377 Ga0501031_0075897 3300049568 Bacteria 2188
378 Ga0501031_0084548 3300049568 Bacteria 2068
379 Ga0501031_0171639 3300049568 Bacteria 1417
380 Ga0501032_0000296 3300049569 Bacteria 41901
381 Ga0501032_0009116 3300049569 Bacteria 7202
382 Ga0501032_0043127 3300049569 Unclassified 3057
383 Ga0501032_0962819 3300049569 Bacteria 536
384 Ga0501033_0000123 3300049570 Bacteria 74947
385 Ga0501033_0004063 3300049570 Bacteria 11815
386 Ga0501033_0031301 3300049570 Bacteria 3998
387 Ga0501033_0194418 3300049570 Bacteria 1451
388 Ga0501034_0115584 3300049571 Unclassified 2671
389 Ga0501034_0165050 3300049571 Bacteria 2183
390 Ga0501036_0008229 3300049572 Bacteria 8550
391 Ga0501036_0019882 3300049572 Bacteria 5639
392 Ga0501036_0482791 3300049572 Unclassified 1031
393 Ga0501037_0014648 3300049573 Bacteria 5770
394 Ga0501037_0060007 3300049573 Unclassified 2774
395 Ga0501037_0260575 3300049573 Unclassified 1211
396 Ga0501038_0000762 3300049574 Bacteria 28600
397 Ga0501038_0002209 3300049574 Bacteria 18099
398 Ga0501038_0005259 3300049574 Bacteria 12034
399 Ga0501038_0007273 3300049574 Bacteria 10220
400 Ga0501038_1266279 3300049574 Unclassified 533
401 Ga0501039_0009936 3300049575 Bacteria 7257
402 Ga0501040_0002590 3300049576 Bacteria 11665
403 Ga0501040_0004489 3300049576 Bacteria 9064
404 Ga0501041_0004279 3300049577 Bacteria 8261
405 Ga0501042_0002243 3300049578 Bacteria 11789
406 Ga0501042_0004274 3300049578 Bacteria 9100
407 Ga0501043_0019754 3300049579 Bacteria 5290
408 Ga0501043_0020495 3300049579 Bacteria 5187
409 Ga0501043_0041407 3300049579 Bacteria 3619
410 Ga0501043_0047244 3300049579 Bacteria 3384
411 Ga0501046_0008164 3300049580 Bacteria 9146
412 Ga0501046_0018424 3300049580 Bacteria 5810
413 Ga0501046_0019958 3300049580 Bacteria 5548
414 Ga0501046_0085631 3300049580 Bacteria 2430
415 Ga0501046_0086160 3300049580 Unclassified 2422
416 Ga0501047_0002600 3300049581 Bacteria 17188
417 Ga0501047_0020404 3300049581 Bacteria 6364
418 Ga0501047_0434235 3300049581 Bacteria 1144
419 Ga0501048_0011362 3300049582 Bacteria 6640
420 Ga0501048_0043677 3300049582 Bacteria 3207
421 Ga0501048_0921421 3300049582 Bacteria 628
422 Ga0501068_0005509 3300049584 Bacteria 6934
423 Ga0501068_0008980 3300049584 Bacteria 5577
424 Ga0501070_0075005 3300049586 Bacteria 2800
425 Ga0501071_0026364 3300049587 Bacteria 4078
426 Ga0501072_0004907 3300049588 Bacteria 10176
427 Ga0501075_0004698 3300049591 Bacteria 9269
428 Ga0501075_1173512 3300049591 Bacteria 583
429 Ga0501076_0002610 3300049592 Bacteria 12407
430 Ga0501077_0002904 3300049593 Bacteria 10281
431 Ga0501225_0054514 3300049705 Bacteria 1118
432 Ga0501079_0005561 3300049741 Bacteria 9402
433 Ga0501080_0006826 3300049742 Bacteria 10295
434 Ga0501081_0038580 3300049743 Bacteria 3264
435 Ga0501083_0163763 3300049744 Bacteria 1454
436 Ga0501035_0000232 3300049822 Bacteria 66277
437 Ga0501035_0004479 3300049822 Bacteria 13257
438 Ga0501035_0082900 3300049822 Bacteria 2829
439 Ga0501035_0110706 3300049822 Bacteria 2407
440 Ga0501035_0469204 3300049822 Unclassified 1039
441 Ga0501044_0001325 3300049823 Bacteria 29123
442 Ga0501044_0017367 3300049823 Bacteria 7718
443 Ga0501044_0150740 3300049823 Bacteria 2307
444 Ga0501044_0379573 3300049823 Unclassified 1328
445 Ga0501045_0000738 3300049824 Bacteria 20868
446 Ga0501045_0002624 3300049824 Bacteria 12240
447 Ga0501212_085084 3300049851 Bacteria 577
448 nmdc:mga06z11_179717_c1 3300050494 Bacteria 1219
449 nmdc:mga05p37_1318280_c1 3300050507 Bacteria 734
450 nmdc:mga05p37_1377_c1 3300050507 Bacteria 28279
451 nmdc:mga05p37_191927_c1 3300050507 Bacteria 2479
452 nmdc:mga05p37_2112077_c1 3300050507 Unclassified 527
453 nmdc:mga09592_344552_c1 3300050508 Bacteria 1290
454 nmdc:mga09592_494424_c1 3300050508 Unclassified 1053
455 nmdc:mga09592_5658_c1 3300050508 Bacteria 10190
456 nmdc:mga0qj67_11229_c1 3300050509 Bacteria 6708
457 nmdc:mga0qj67_1890_c1 3300050509 Bacteria 14851
458 nmdc:mga0qj67_587341_c1 3300050509 Bacteria 892
459 nmdc:mga0qj67_5886_c1 3300050509 Bacteria 8983
460 nmdc:mga06r32_43104_c1 3300050510 Bacteria 4293
461 nmdc:mga06r32_7037_c1 3300050510 Bacteria 10120
462 nmdc:mga08y16_1724_c1 3300050511 Bacteria 22185
463 nmdc:mga08y16_178296_c1 3300050511 Bacteria 2207
464 nmdc:mga08y16_31779_c1 3300050511 Bacteria 5551
465 nmdc:mga08y16_546521_c1 3300050511 Bacteria 1172
466 nmdc:mga0n895_16295_c1 3300050512 Bacteria 6815
467 nmdc:mga0rr50_4837_c1 3300050513 Bacteria 7960
468 Ga0500651_0377439 3300053093 Bacteria 800
469 Ga0500591_086333 3300053115 Bacteria 1381
470 Ga0500617_059252 3300053124 Bacteria 1697
471 Ga0500588_0027800 3300053146 Bacteria 1597
472 Ga0500624_047697 3300053157 Bacteria 789
473 Ga0500639_103989 3300053163 Bacteria 1392
474 Ga0500637_0003461 3300053178 Bacteria 7295
475 Ga0501084_0006947 3300054114 Bacteria 9322
476 Ga0587062_079379 3300059639 Bacteria 607
477 Ga0501082_0002083 3300060353 Bacteria 17620
478 Ga0530510_0004813 3300061734 Bacteria 9341
479 Ga0530510_0006248 3300061734 Bacteria 8285
480 2753569119 2751185846 Bacteria 7242164
481 Ga0500583_0029247
482 rootH1_10019743
483 rootL2_10049323
484 rootL2_10070379
485 rootL2_10262803
486 rootH1_10183523
487 Ga0058859_11200781
488 Ga0058863_11390249
489 Ga0058860_11506702
490 Ga0058862_12847150
491 Ga0065704_10251693
492 Ga0065707_10168071
493 Ga0065707_10344794
494 Ga0070690_100086404
495 Ga0068869_100166881
496 Ga0068869_101087996
497 Ga0068869_101559496
498 Ga0070666_10104348
499 Ga0070680_100020416
500 Ga0070680_100603398
501 Ga0070680_101642059
502 Ga0068868_100258349
503 Ga0070660_100384270
504 Ga0070660_100432837
505 Ga0070689_100126128
506 Ga0070689_100170880
507 Ga0070687_100005687
508 Ga0070687_100161800
509 Ga0070661_100426079
510 Ga0070675_100001133
511 Ga0070675_100974818
512 Ga0070671_100008912
513 Ga0070674_100043012
514 Ga0070673_100002447
515 Ga0070688_100050843
516 Ga0070688_100095823
517 Ga0070688_100436440
518 Ga0070667_100057322
519 Ga0070667_102068476
520 Ga0070709_10015004
521 Ga0070709_10139473
522 Ga0070714_101030215
523 Ga0070713_100334231
524 Ga0070713_100344112
525 Ga0070713_100649916
526 Ga0070710_10007185
527 Ga0070710_10081954
528 Ga0070710_10160614
529 Ga0070711_100087621
530 Ga0070705_100000014
531 Ga0070705_100261087
532 Ga0070705_100434974
533 Ga0070700_100748437
534 Ga0070708_100019227
535 Ga0070708_100232977
536 Ga0070708_101061841
537 Ga0070663_101723947
538 Ga0070681_10002203
539 Ga0068867_100272743
540 Ga0070685_10002356
541 Ga0070706_100320729
542 Ga0070699_100844508
543 Ga0070679_100012706
544 Ga0070679_100344426
545 Ga0070679_100841065
546 Ga0070684_101095922
547 Ga0070697_101235247
548 Ga0070697_102089167
549 Ga0070672_100038916
550 Ga0070672_100320122
551 Ga0070672_101934366
552 Ga0070686_100124338
553 Ga0070695_100801986
554 Ga0070696_100232501
555 Ga0070696_100520498
556 Ga0070696_100636874
557 Ga0070696_101021631
558 Ga0070665_100297241
559 Ga0070664_100002491
560 Ga0070664_101540670
561 Ga0068856_101241674
562 Ga0070702_100173028
563 Ga0068859_100005268
564 Ga0068864_100012265
565 Ga0068864_100457993
566 Ga0068866_10299818
567 Ga0068866_10505658
568 Ga0068866_10596003
569 Ga0068861_100849067
570 Ga0068861_101058810
571 Ga0068870_10147405
572 Ga0068863_100000380
573 Ga0068858_100044542
574 Ga0068858_100934282
575 Ga0068860_100001325
576 Ga0068860_100851106
577 Ga0068862_100558786
578 Ga0068862_100761120
579 Ga0068862_100889169
580 Ga0081455_10012738
581 Ga0081455_10098270
582 Ga0081455_10354499
583 Ga0081538_10096880
584 Ga0081539_10030679
585 Ga0070716_100056148
586 Ga0070716_101174248
587 Ga0070712_100113019
588 Ga0070712_100454949
589 Ga0075367_10146964
590 Ga0097621_100006341
591 Ga0097621_100031469
592 Ga0097621_100138958
593 Ga0097621_100181389
594 Ga0097621_100876122
595 Ga0068871_100009445
596 Ga0068871_100346565
597 Ga0068871_101494222
598 Ga0075428_100000510
599 Ga0075428_100016496
600 Ga0075428_100156473
601 Ga0075430_100000227
602 Ga0075430_100001369
603 Ga0075430_100019875
604 Ga0075431_100001177
605 Ga0075431_100004675
606 Ga0075431_100589967
607 Ga0075433_10412759
608 Ga0075433_10806842
609 Ga0075434_100011416
610 Ga0075429_100005762
611 Ga0075429_100095459
612 Ga0075429_100318701
613 Ga0075429_101946562
614 Ga0068865_101410396
615 Ga0075436_100158843
616 Ga0097620_100005267
617 Ga0075435_100002865
618 Ga0111539_10039612
619 Ga0111539_10078854
620 Ga0105245_11214611
621 Ga0105245_12908067
622 Ga0105247_10116818
623 Ga0114129_10000951
624 Ga0114129_10041465
625 Ga0114129_11371912
626 Ga0114129_12235426
627 Ga0105243_10301857
628 Ga0105243_10399679
629 Ga0105243_10429887
630 Ga0105242_10077578
631 Ga0105242_10278198
632 Ga0105242_11318453
633 Ga0105242_11386122
634 Ga0105248_10005096
635 Ga0105248_10020182
636 Ga0105248_10057540
637 Ga0105248_10272388
638 Ga0105238_10000007
639 Ga0105238_10769123
640 Ga0105249_11604792
641 Ga0105246_10263466
642 Ga0105246_10403291
643 Ga0105246_11737302
644 Ga0157342_1048752
645 Ga0157373_10147516
646 Ga0157369_12479668
647 Ga0157374_12155292
648 Ga0157378_10821427
649 Ga0157378_12232650
650 Ga0157378_12457744
651 Ga0157378_13055062
652 Ga0163162_10000425
653 Ga0163162_10008675
654 Ga0163162_12905030
655 Ga0157372_12291849
656 Ga0157375_10001372
657 Ga0157375_10547596
658 Ga0157375_10665515
659 Ga0157375_11057102
660 Ga0157375_13245279
661 Ga0163163_10038566
662 Ga0157380_10239543
663 Ga0157380_10337746
664 Ga0157380_12382047
665 Ga0157377_10665117
666 Ga0157379_10000756
667 Ga0157376_10179176
668 Ga0163161_10059067
669 Ga0206353_10625478
670 Ga0213876_10196150
671 Ga0213875_10000056
672 Ga0209233_1080925
673 Ga0207692_10022215
674 Ga0207692_10065073
675 Ga0207692_10266539
676 Ga0207710_10149819
677 Ga0207680_10054196
678 Ga0207680_10221563
679 Ga0207699_10097150
680 Ga0207699_10133098
681 Ga0207643_10077549
682 Ga0207707_10014841
683 Ga0207693_10206598
684 Ga0207693_10375581
685 Ga0207660_10019752
686 Ga0207660_10715664
687 Ga0207662_10014444
688 Ga0207662_10081008
689 Ga0207662_10185858
690 Ga0207662_11242152
691 Ga0207657_11514837
692 Ga0207649_11475652
693 Ga0207652_10144756
694 Ga0207652_10940190
695 Ga0207694_10000007
696 Ga0207694_10398799
697 Ga0207659_10000464
698 Ga0207687_11783030
699 Ga0207664_10058187
700 Ga0207664_10395822
701 Ga0207644_10178135
702 Ga0207690_11108210
703 Ga0207686_10116524
704 Ga0207686_10230196
705 Ga0207686_10629671
706 Ga0207709_10003461
707 Ga0207709_10254113
708 Ga0207709_10799921
709 Ga0207670_10044728
710 Ga0207670_10644588
711 Ga0207669_10032454
712 Ga0207665_10076831
713 Ga0207665_11391205
714 Ga0207691_10110237
715 Ga0207711_10001886
716 Ga0207711_10024445
717 Ga0207711_10097263
718 Ga0207711_10389309
719 Ga0207711_10576309
720 Ga0207689_10103567
721 Ga0207689_10149036
722 Ga0207661_10436580
723 Ga0207679_10016066
724 Ga0207651_10159104
725 Ga0207712_10794127
726 Ga0207658_10070260
727 Ga0207658_10172192
728 Ga0207677_10477479
729 Ga0207703_10104211
730 Ga0207703_11331234
731 Ga0207708_10881687
732 Ga0207641_10001153
733 Ga0207641_10463695
734 Ga0207648_10300489
735 Ga0207676_10018075
736 Ga0207676_10292357
737 Ga0207676_10469808
738 Ga0207674_10026343
739 Ga0207675_100291366
740 Ga0207675_100731261
741 Ga0207428_10021144
742 Ga0207428_10153892
743 Ga0207428_10283542
744 Ga0268266_10654321
745 Ga0268265_10334835
746 Ga0268265_10649026
747 Ga0268264_10002778
748 Ga0268264_11227878
749 Ga0307517_10355063
750 Ga0265760_10018879
751 Ga0265340_10028455
752 Ga0265339_10055028
753 Ga0307509_10289086
754 Ga0316579_10629963
755 Ga0265314_10027336
756 Ga0307413_10330143
757 Ga0307406_10766671
758 Ga0307412_10651137
759 Ga0307409_101136076
760 Ga0307416_100039131
761 Ga0307416_102433364
762 Ga0307415_100091075
763 Ga0316593_10079224
764 Ga0316593_10098714
765 Ga0316593_10267423
766 Ga0316586_1057123
767 Ga0316588_1066706
768 Ga0316587_1002155
769 Ga0316587_1008539
770 Ga0316587_1037827
771 Ga0316596_1055251
772 Ga0373928_0108887
773 Ga0373944_0298033
774 Ga0373943_0282312
775 Ga0373935_0475567
776 Ga0373927_0490572
777 Ga0373937_0106165
778 Ga0316584_0346503
779 Ga0395900_0383140
780 Ga0395900_0386281
781 Ga0395900_1151399
782 Ga0395905_0670337
783 Ga0395905_1311025
784 Ga0436364_0196389
785 Ga0436364_1214568
786 Ga0395901_0444868
787 Ga0436365_0181249
788 Ga0436365_0455506
789 Ga0436365_1259400
790 Ga0436365_1618681
791 Ga0436360_0658856
792 Ga0436361_0087226
793 Ga0436363_0084770
794 Ga0436362_0798289
795 Ga0451837_1652775
796 Ga0451839_1299354
797 Ga0439455_0104867
798 Ga0439435_0207119
799 Ga0439460_0367763
800 Ga0466963_0266745
801 Ga0453684_0002706
802 Ga0453684_1651037
803 Ga0453684_2156389
804 Ga0466971_0587070
805 Ga0451576_0048294
806 Ga0451576_0321464
807 Ga0466958_0456493
808 Ga0466967_0953355
809 Ga0466967_1284761
810 Ga0466967_1983948
811 Ga0495617_110130
812 Ga0495638_0001512
813 Ga0495653_0737853
814 Ga0495650_0011128
815 Ga0495580_0370744
816 Ga0495605_0002389
817 Ga0495605_0280727
818 Ga0495585_0151414
819 Ga0495594_0009227
820 Ga0495596_0303324
821 Ga0495607_0041446
822 Ga0495583_0000095
823 Ga0495583_0374921
824 Ga0495618_0747860
825 Ga0495643_0000055
826 Ga0495642_0004753
827 Ga0495665_0446271
828 Ga0495609_0079863
829 Ga0495622_0510863
830 Ga0495599_0049178
831 Ga0495658_0377970
832 Ga0495669_0022114
833 Ga0495670_0003195
834 Ga0495671_0099569
835 Ga0495649_0322766
836 Ga0495589_0011894
837 Ga0495674_0022584
838 Ga0495674_0155211
839 Ga0495676_0596066
840 Ga0495683_0134721
841 Ga0495684_0238870
842 Ga0495626_0046845
843 Ga0496101_0651149
844 Ga0496104_0113535
845 Ga0496105_0284622
846 Ga0496108_0409254
847 Ga0496109_0422492
848 Ga0496109_0611790
849 Ga0496110_1587250
850 Ga0496113_1357158
851 Ga0496114_0000082
852 Ga0496114_0000193
853 Ga0496114_0299225
854 Ga0496115_0288186
855 Ga0496122_0530981
856 Ga0501031_0075897
857 Ga0501031_0084548
858 Ga0501031_0171639
859 Ga0501032_0000296
860 Ga0501032_0009116
861 Ga0501032_0043127
862 Ga0501032_0962819
863 Ga0501033_0000123
864 Ga0501033_0004063
865 Ga0501033_0031301
866 Ga0501033_0194418
867 Ga0501034_0115584
868 Ga0501034_0165050
869 Ga0501036_0008229
870 Ga0501036_0019882
871 Ga0501036_0482791
872 Ga0501037_0014648
873 Ga0501037_0060007
874 Ga0501037_0260575
875 Ga0501038_0000762
876 Ga0501038_0002209
877 Ga0501038_0005259
878 Ga0501038_0007273
879 Ga0501038_1266279
880 Ga0501039_0009936
881 Ga0501040_0002590
882 Ga0501040_0004489
883 Ga0501041_0004279
884 Ga0501042_0002243
885 Ga0501042_0004274
886 Ga0501043_0019754
887 Ga0501043_0020495
888 Ga0501043_0041407
889 Ga0501043_0047244
890 Ga0501046_0008164
891 Ga0501046_0018424
892 Ga0501046_0019958
893 Ga0501046_0085631
894 Ga0501046_0086160
895 Ga0501047_0002600
896 Ga0501047_0020404
897 Ga0501047_0434235
898 Ga0501048_0011362
899 Ga0501048_0043677
900 Ga0501048_0921421
901 Ga0501068_0005509
902 Ga0501068_0008980
903 Ga0501070_0075005
904 Ga0501071_0026364
905 Ga0501072_0004907
906 Ga0501075_0004698
907 Ga0501075_1173512
908 Ga0501076_0002610
909 Ga0501077_0002904
910 Ga0501225_0054514
911 Ga0501079_0005561
912 Ga0501080_0006826
913 Ga0501081_0038580
914 Ga0501083_0163763
915 Ga0501035_0000232
916 Ga0501035_0004479
917 Ga0501035_0082900
918 Ga0501035_0110706
919 Ga0501035_0469204
920 Ga0501044_0001325
921 Ga0501044_0017367
922 Ga0501044_0150740
923 Ga0501044_0379573
924 Ga0501045_0000738
925 Ga0501045_0002624
926 Ga0501212_085084
927 nmdc:mga06z11_179717_c1
928 nmdc:mga05p37_1318280_c1
929 nmdc:mga05p37_1377_c1
930 nmdc:mga05p37_191927_c1
931 nmdc:mga05p37_2112077_c1
932 nmdc:mga09592_344552_c1
933 nmdc:mga09592_494424_c1
934 nmdc:mga09592_5658_c1
935 nmdc:mga0qj67_11229_c1
936 nmdc:mga0qj67_1890_c1
937 nmdc:mga0qj67_587341_c1
938 nmdc:mga0qj67_5886_c1
939 nmdc:mga06r32_43104_c1
940 nmdc:mga06r32_7037_c1
941 nmdc:mga08y16_1724_c1
942 nmdc:mga08y16_178296_c1
943 nmdc:mga08y16_31779_c1
944 nmdc:mga08y16_546521_c1
945 nmdc:mga0n895_16295_c1
946 nmdc:mga0rr50_4837_c1
947 Ga0500651_0377439
948 Ga0500591_086333
949 Ga0500617_059252
950 Ga0500588_0027800
951 Ga0500624_047697
952 Ga0500639_103989
953 Ga0500637_0003461
954 Ga0501084_0006947
955 Ga0587062_079379
956 Ga0501082_0002083
957 Ga0530510_0004813
958 Ga0530510_0006248
959 2753569119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3klu-assembly1.cif.gz_A crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. 0.5064 1 102
3klu-assembly1.cif.gz_A crystal structure of the protein yqbn. northeast structural genomics consortium target sr445. 0.4471 1 102
6fsf-assembly1.cif.gz_A crystal structure of the tandem px-ph-domains of bem3 from saccharomyces cerevisiae 0.4336 3 35
2yt2-assembly1.cif.gz_A solution structure of the chimera of the ptb domain of snt-2 and 19-residue peptide (aa 1571-1589) of halk 0.4328 1 37
4bob-assembly1.cif.gz_A structure of complement regulator-acquiring surface protein 3 (crasp- 3, erpp or bbn38) from borrelia burgdorferi 0.4155 11 35
ID Description Score Start End Superfamily
2pptB01 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.9073 105 122 2.30.30.380
1gk5A00 Mainly Beta;Ribbon;Laminin;Laminin 0.5753 104 120 2.10.25.10
af_Q9W217_73_142_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5618 106 119 3.30.40.10
af_I1KZF8_50_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5568 104 119 3.30.40.10
3t2lA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5499 13 36 2.60.40.2630
ID Description Score Start End GO Terms
AF-A0A0F5YNS6-F1-model_v4 Uncharacterized protein 0.9206 11 101
AF-A0A1Z4LK17-F1-model_v4 Phage tail assembly protein 0.9188 11 101
AF-A0A2W4VYL4-F1-model_v4 Phage tail assembly protein 0.9184 11 101
AF-U5QKS5-F1-model_v4 Phage tail assembly protein 0.9183 11 101
AF-Q7NDX8-F1-model_v4 Glr4104 protein 0.9179 11 101

Map