F452063

General Info

Members Datasets Scaffolds Average Seq Length
479 285 475 133

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1025319|Ga0265319_10253192
Length 153
Sequence VEGGYSETAGPRGGIAEGSVRGRVRYLLDTDSVSFALRGQGQVGLRLQKQRPSDLCISTITLAELRYGADRKGSRKLHGLIGTFAASVEILSFDEAAAAEFGRIGSLLAERGTPIGDFDVLIAAHAVAVRCTLVTNNVRHFSKVPGLSVENWA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
4 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
5 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
195 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
196 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
197 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
277 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
282 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.63
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 0.84
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5293 2010549000 Bacteria 1822
2 JGI24736J21556_1018219 3300001904 Bacteria 1112
3 JGI24740J21852_10008085 3300001979 Bacteria 4221
4 JGI24740J21852_10033760 3300001979 Bacteria 1619
5 JGI24739J22299_10093253 3300001989 Bacteria 915
6 JGI24737J22298_10073977 3300001990 Bacteria 1016
7 JGI24735J21928_10008830 3300002067 Bacteria 3251
8 JGI24735J21928_10062813 3300002067 Bacteria 1066
9 JGI24750J21931_1000318 3300002070 Bacteria 8222
10 JGI24738J21930_10018205 3300002075 Bacteria 1469
11 JGI24033J26618_1064727 3300002155 Bacteria 542
12 JGI25406J46586_10000963 3300003203 Bacteria 13521
13 JGI25406J46586_10020480 3300003203 Bacteria 2674
14 rootH2_10022308 3300003320 Bacteria 3453
15 rootL2_10031791 3300003322 Bacteria 2411
16 rootH1_10303224 3300003323 Eukaryota 2393
17 Ga0065704_10440541 3300005289 Bacteria 714
18 Ga0065707_10216078 3300005295 Bacteria 1244
19 Ga0070683_100183710 3300005329 Unclassified 1985
20 Ga0070683_100613610 3300005329 Bacteria 1041
21 Ga0070690_100000177 3300005330 Bacteria 32685
22 Ga0070670_100101443 3300005331 Bacteria 2478
23 Ga0070677_10008412 3300005333 Bacteria 3470
24 Ga0070666_10000014 3300005335 Bacteria 224479
25 Ga0070680_101037682 3300005336 Unclassified 708
26 Ga0070682_100000033 3300005337 Bacteria 154740
27 Ga0070682_100050135 3300005337 Bacteria 2605
28 Ga0070682_100298799 3300005337 Bacteria 1181
29 Ga0070660_100045563 3300005339 Bacteria 3358
30 Ga0070689_100278042 3300005340 Bacteria 1388
31 Ga0070689_100488080 3300005340 Bacteria 1053
32 Ga0070687_100009090 3300005343 Bacteria 4242
33 Ga0070687_100160919 3300005343 Unclassified 1327
34 Ga0070661_100255102 3300005344 Bacteria 1354
35 Ga0070668_100251173 3300005347 Bacteria 1468
36 Ga0070669_100000028 3300005353 Bacteria 165168
37 Ga0070669_100000958 3300005353 Bacteria 21065
38 Ga0070671_100001321 3300005355 Bacteria 18639
39 Ga0070674_100055668 3300005356 Bacteria 2740
40 Ga0070688_100000708 3300005365 Bacteria 16427
41 Ga0070659_100107497 3300005366 Bacteria 2249
42 Ga0070659_101826790 3300005366 Bacteria 544
43 Ga0070667_100000655 3300005367 Bacteria 33618
44 Ga0070713_101719442 3300005436 Unclassified 609
45 Ga0070694_100544685 3300005444 Unclassified 928
46 Ga0070708_100009946 3300005445 Bacteria 7688
47 Ga0070708_100032781 3300005445 Unclassified 4508
48 Ga0070708_100098509 3300005445 Bacteria 2673
49 Ga0070708_100258490 3300005445 Unclassified 1637
50 Ga0070708_100774232 3300005445 Unclassified 902
51 Ga0070708_101223459 3300005445 Bacteria 702
52 Ga0070662_100017381 3300005457 Bacteria 4849
53 Ga0070681_10448953 3300005458 Bacteria 1201
54 Ga0070685_10003569 3300005466 Bacteria 7898
55 Ga0070706_100003372 3300005467 Bacteria 15756
56 Ga0070706_100014294 3300005467 Bacteria 7335
57 Ga0070706_100638534 3300005467 Bacteria 988
58 Ga0070707_100015529 3300005468 Bacteria 7146
59 Ga0070707_100172601 3300005468 Bacteria 2107
60 Ga0070707_100198437 3300005468 Unclassified 1956
61 Ga0070698_100004677 3300005471 Bacteria 15046
62 Ga0070698_100513155 3300005471 Unclassified 1137
63 Ga0070698_100690575 3300005471 Bacteria 962
64 Ga0070699_101363419 3300005518 Unclassified 650
65 Ga0070679_100491971 3300005530 Bacteria 1171
66 Ga0070684_100201688 3300005535 Bacteria 1812
67 Ga0070697_100059102 3300005536 Bacteria 3121
68 Ga0070697_101668984 3300005536 Unclassified 570
69 Ga0068853_100156551 3300005539 Bacteria 2053
70 Ga0068853_100420334 3300005539 Bacteria 1253
71 Ga0070686_100000002 3300005544 Bacteria 336303
72 Ga0070696_100047939 3300005546 Bacteria 2965
73 Ga0070696_100352363 3300005546 Bacteria 1140
74 Ga0070665_100000004 3300005548 Bacteria 785500
75 Ga0070704_100019395 3300005549 Bacteria 4369
76 Ga0070704_100390155 3300005549 Bacteria 1185
77 Ga0068855_100053677 3300005563 Bacteria 4740
78 Ga0068855_100127616 3300005563 Bacteria 2907
79 Ga0068855_100132251 3300005563 Bacteria 2848
80 Ga0068855_100583650 3300005563 Unclassified 1207
81 Ga0068855_101492922 3300005563 Unclassified 694
82 Ga0068855_102147505 3300005563 Unclassified 561
83 Ga0070664_101125901 3300005564 Unclassified 740
84 Ga0068857_100270495 3300005577 Bacteria 1561
85 Ga0068857_100596996 3300005577 Bacteria 1043
86 Ga0068857_100725285 3300005577 Bacteria 945
87 Ga0068854_100004367 3300005578 Bacteria 8917
88 Ga0068854_100347807 3300005578 Bacteria 1212
89 Ga0068854_100566575 3300005578 Bacteria 965
90 Ga0068856_100196935 3300005614 Bacteria 2029
91 Ga0068856_100453399 3300005614 Bacteria 1303
92 Ga0068856_101564811 3300005614 Bacteria 673
93 Ga0070702_100536063 3300005615 Unclassified 866
94 Ga0068852_100212993 3300005616 Bacteria 1834
95 Ga0068852_100562104 3300005616 Bacteria 1142
96 Ga0068852_100754415 3300005616 Bacteria 985
97 Ga0068859_100003140 3300005617 Bacteria 16798
98 Ga0068864_100009846 3300005618 Bacteria 7882
99 Ga0068864_100454739 3300005618 Bacteria 1225
100 Ga0068861_100780483 3300005719 Unclassified 895
101 Ga0068851_10169039 3300005834 Bacteria 1205
102 Ga0068851_10197054 3300005834 Bacteria 1122
103 Ga0068863_100912749 3300005841 Bacteria 879
104 Ga0068858_100015829 3300005842 Bacteria 7089
105 Ga0068860_100000001 3300005843 Bacteria 703043
106 Ga0081455_10245027 3300005937 Bacteria 1314
107 Ga0081539_10000350 3300005985 Bacteria 101255
108 Ga0081539_10001162 3300005985 Bacteria 47608
109 Ga0081539_10258405 3300005985 Bacteria 770
110 Ga0070717_10000127 3300006028 Bacteria 56161
111 Ga0070717_10140770 3300006028 Bacteria 2081
112 Ga0070717_11749207 3300006028 Bacteria 562
113 Ga0075363_100905097 3300006048 Bacteria 540
114 Ga0070716_100136992 3300006173 Unclassified 1556
115 Ga0068871_101093089 3300006358 Bacteria 745
116 Ga0075428_100014020 3300006844 Bacteria 8921
117 Ga0075428_100118243 3300006844 Bacteria 2886
118 Ga0075430_100211711 3300006846 Bacteria 1608
119 Ga0075430_100374067 3300006846 Bacteria 1176
120 Ga0075431_100015689 3300006847 Bacteria 7681
121 Ga0075431_100753097 3300006847 Bacteria 949
122 Ga0075433_10166266 3300006852 Bacteria 1963
123 Ga0075434_100064364 3300006871 Unclassified 3651
124 Ga0075434_100924266 3300006871 Unclassified 887
125 Ga0075429_100014506 3300006880 Bacteria 6830
126 Ga0075436_100008008 3300006914 Bacteria 7233
127 Ga0075436_100122073 3300006914 Unclassified 1823
128 Ga0075436_100413866 3300006914 Unclassified 978
129 Ga0097620_100003140 3300006931 Bacteria 16798
130 Ga0075435_100000133 3300007076 Bacteria 41750
131 Ga0099794_10066677 3300007265 Unclassified 1757
132 Ga0099794_10229727 3300007265 Bacteria 954
133 Ga0099795_10004751 3300007788 Bacteria 3539
134 Ga0105240_10386039 3300009093 Bacteria 1580
135 Ga0105240_10568522 3300009093 Bacteria 1252
136 Ga0111539_10000022 3300009094 Bacteria 240838
137 Ga0111539_10016786 3300009094 Bacteria 9070
138 Ga0105245_10000434 3300009098 Bacteria 38625
139 Ga0114129_10038605 3300009147 Bacteria 6734
140 Ga0105248_11856386 3300009177 Unclassified 684
141 Ga0105237_10063500 3300009545 Bacteria 3690
142 Ga0105237_10091847 3300009545 Bacteria 3025
143 Ga0105237_10799259 3300009545 Unclassified 950
144 Ga0105237_10987491 3300009545 Unclassified 849
145 Ga0105238_10080162 3300009551 Bacteria 3254
146 Ga0105238_10092256 3300009551 Bacteria 3016
147 Ga0105238_10251729 3300009551 Bacteria 1745
148 Ga0105238_11114335 3300009551 Bacteria 812
149 Ga0105238_12351699 3300009551 Unclassified 568
150 Ga0105249_10000005 3300009553 Bacteria 362467
151 Ga0105249_10081575 3300009553 Bacteria 3007
152 Ga0099796_10190644 3300010159 Unclassified 827
153 Ga0105239_10220834 3300010375 Bacteria 2125
154 Ga0105239_11378425 3300010375 Bacteria 814
155 Ga0105246_10048398 3300011119 Bacteria 2906
156 Ga0105246_11874020 3300011119 Bacteria 575
157 Ga0157370_10069309 3300013104 Bacteria 3331
158 Ga0157370_10468515 3300013104 Bacteria 1158
159 Ga0157369_10105103 3300013105 Bacteria 3006
160 Ga0157369_10117627 3300013105 Bacteria 2821
161 Ga0157369_10536182 3300013105 Bacteria 1210
162 Ga0157374_10013654 3300013296 Bacteria 7094
163 Ga0157374_11204699 3300013296 Unclassified 779
164 Ga0157378_10000839 3300013297 Bacteria 28544
165 Ga0157378_10011297 3300013297 Bacteria 7816
166 Ga0163162_10017591 3300013306 Bacteria 6995
167 Ga0157372_10078176 3300013307 Bacteria 3738
168 Ga0157372_10481314 3300013307 Unclassified 1447
169 Ga0157372_11171670 3300013307 Bacteria 888
170 Ga0157375_10007688 3300013308 Bacteria 9431
171 Ga0163163_10295988 3300014325 Bacteria 1671
172 Ga0163163_11244229 3300014325 Bacteria 807
173 Ga0157380_10037435 3300014326 Bacteria 3759
174 Ga0157379_10124686 3300014968 Bacteria 2317
175 Ga0157376_10038721 3300014969 Plasmid 3881
176 Ga0157376_10560337 3300014969 Bacteria 1132
177 Ga0157376_11776676 3300014969 Bacteria 653
178 Ga0163161_10000106 3300017792 Bacteria 79467
179 Ga0163161_10570725 3300017792 Unclassified 929
180 Ga0207656_10126462 3300025321 Bacteria 1194
181 Ga0207682_10032869 3300025893 Bacteria 2086
182 Ga0207680_10000004 3300025903 Bacteria 827324
183 Ga0207647_10015569 3300025904 Bacteria 5209
184 Ga0207647_10371967 3300025904 Bacteria 807
185 Ga0207643_10035922 3300025908 Bacteria 2780
186 Ga0207684_10024176 3300025910 Bacteria 5182
187 Ga0207684_10120588 3300025910 Bacteria 2248
188 Ga0207684_10525995 3300025910 Bacteria 1013
189 Ga0207654_10002086 3300025911 Bacteria 10238
190 Ga0207654_10003127 3300025911 Bacteria 8381
191 Ga0207654_10005142 3300025911 Bacteria 6602
192 Ga0207695_10003538 3300025913 Bacteria 21879
193 Ga0207695_10012343 3300025913 Bacteria 10264
194 Ga0207695_10022675 3300025913 Bacteria 7118
195 Ga0207695_10165083 3300025913 Bacteria 2143
196 Ga0207671_10016463 3300025914 Bacteria 5745
197 Ga0207671_10019223 3300025914 Bacteria 5228
198 Ga0207671_10031552 3300025914 Bacteria 3948
199 Ga0207671_10467221 3300025914 Unclassified 1005
200 Ga0207671_10741598 3300025914 Unclassified 780
201 Ga0207662_10037471 3300025918 Bacteria 2838
202 Ga0207662_10147498 3300025918 Unclassified 1494
203 Ga0207662_10843220 3300025918 Unclassified 647
204 Ga0207657_10131253 3300025919 Bacteria 2053
205 Ga0207649_10165677 3300025920 Bacteria 1535
206 Ga0207649_10693771 3300025920 Bacteria 789
207 Ga0207652_10156673 3300025921 Unclassified 2041
208 Ga0207646_10069241 3300025922 Bacteria 3151
209 Ga0207681_10000056 3300025923 Bacteria 106145
210 Ga0207681_10000704 3300025923 Bacteria 21968
211 Ga0207694_10000630 3300025924 Bacteria 31969
212 Ga0207694_10005011 3300025924 Bacteria 10244
213 Ga0207694_10043409 3300025924 Bacteria 3470
214 Ga0207694_10046873 3300025924 Plasmid 3341
215 Ga0207650_10115924 3300025925 Bacteria 2080
216 Ga0207687_10002480 3300025927 Bacteria 12535
217 Ga0207687_10198266 3300025927 Bacteria 1567
218 Ga0207644_10000028 3300025931 Bacteria 142921
219 Ga0207690_10544731 3300025932 Bacteria 943
220 Ga0207690_11073475 3300025932 Bacteria 671
221 Ga0207706_10040418 3300025933 Bacteria 4133
222 Ga0207670_10099225 3300025936 Bacteria 2077
223 Ga0207670_10626781 3300025936 Bacteria 885
224 Ga0207670_11919212 3300025936 Bacteria 504
225 Ga0207669_10316178 3300025937 Bacteria 1193
226 Ga0207665_10402135 3300025939 Unclassified 1043
227 Ga0207665_10514178 3300025939 Bacteria 926
228 Ga0207711_10011145 3300025941 Bacteria 7471
229 Ga0207689_10244848 3300025942 Bacteria 1482
230 Ga0207689_10509131 3300025942 Unclassified 1009
231 Ga0207661_10138396 3300025944 Unclassified 2093
232 Ga0207661_10333259 3300025944 Bacteria 1366
233 Ga0207679_10991032 3300025945 Unclassified 770
234 Ga0207667_10004045 3300025949 Bacteria 18017
235 Ga0207667_10011382 3300025949 Bacteria 10345
236 Ga0207667_10013903 3300025949 Bacteria 9195
237 Ga0207667_10977738 3300025949 Unclassified 835
238 Ga0207712_10000001 3300025961 Bacteria 750309
239 Ga0207712_10046873 3300025961 Bacteria 2998
240 Ga0207668_10235574 3300025972 Bacteria 1478
241 Ga0207640_10075647 3300025981 Bacteria 2283
242 Ga0207640_10331923 3300025981 Bacteria 1215
243 Ga0207640_10441347 3300025981 Bacteria 1070
244 Ga0207658_10001581 3300025986 Bacteria 17579
245 Ga0207658_10739774 3300025986 Bacteria 890
246 Ga0207703_10000948 3300026035 Bacteria 28101
247 Ga0207639_10035055 3300026041 Bacteria 3712
248 Ga0207639_10039794 3300026041 Bacteria 3505
249 Ga0207702_10013506 3300026078 Bacteria 6784
250 Ga0207702_10019567 3300026078 Bacteria 5603
251 Ga0207702_10105006 3300026078 Bacteria 2501
252 Ga0207702_11290218 3300026078 Bacteria 724
253 Ga0207641_10081700 3300026088 Bacteria 2807
254 Ga0207676_10000373 3300026095 Bacteria 38263
255 Ga0207676_10942753 3300026095 Bacteria 848
256 Ga0207674_10657653 3300026116 Bacteria 1012
257 Ga0207674_10972418 3300026116 Unclassified 818
258 Ga0207675_100179823 3300026118 Bacteria 2025
259 Ga0207698_10003339 3300026142 Bacteria 9657
260 Ga0207698_10006940 3300026142 Bacteria 7087
261 Ga0207698_10259200 3300026142 Bacteria 1596
262 Ga0209179_1018149 3300027512 Bacteria 1341
263 Ga0207428_10000030 3300027907 Bacteria 240846
264 Ga0207428_10020340 3300027907 Bacteria 5639
265 Ga0268266_10000009 3300028379 Bacteria 1097737
266 Ga0268266_10001995 3300028379 Bacteria 22845
267 Ga0268264_10000006 3300028381 Bacteria 827324
268 Ga0268264_10606120 3300028381 Bacteria 1080
269 Ga0265337_1010116 3300028556 Bacteria 3322
270 Ga0265319_1025319 3300028563 Bacteria 2125
271 Ga0265319_1026255 3300028563 Bacteria 2078
272 Ga0265334_10200545 3300028573 Bacteria 693
273 Ga0265323_10021966 3300028653 Bacteria 2441
274 Ga0265322_10002667 3300028654 Bacteria 5480
275 Ga0265338_10404296 3300028800 Unclassified 973
276 Ga0307511_10000270 3300030521 Bacteria 54049
277 Ga0265760_10001026 3300031090 Bacteria 8120
278 Ga0265760_10079320 3300031090 Bacteria 1015
279 Ga0265330_10031965 3300031235 Bacteria 2359
280 Ga0265330_10039509 3300031235 Bacteria 2096
281 Ga0265330_10069731 3300031235 Unclassified 1521
282 Ga0265332_10164776 3300031238 Unclassified 925
283 Ga0265325_10016564 3300031241 Unclassified 4119
284 Ga0265340_10061711 3300031247 Bacteria 1792
285 Ga0265339_10025595 3300031249 Plasmid 3386
286 Ga0265339_10140412 3300031249 Bacteria 1229
287 Ga0265339_10215605 3300031249 Unclassified 941
288 Ga0265339_10544795 3300031249 Unclassified 534
289 Ga0265331_10270367 3300031250 Unclassified 762
290 Ga0265316_10001617 3300031344 Bacteria 24031
291 Ga0265316_10174821 3300031344 Bacteria 1601
292 Ga0265316_10188347 3300031344 Bacteria 1534
293 Ga0265316_10695011 3300031344 Bacteria 717
294 Ga0307408_101099692 3300031548 Unclassified 737
295 Ga0265314_10044808 3300031711 Bacteria 3132
296 Ga0265314_10057404 3300031711 Plasmid 2673
297 Ga0265314_10065434 3300031711 Bacteria 2455
298 Ga0265342_10072021 3300031712 Bacteria 2012
299 Ga0265342_10172878 3300031712 Bacteria 1187
300 Ga0265342_10181479 3300031712 Bacteria 1152
301 Ga0265342_10247181 3300031712 Bacteria 953
302 Ga0316576_10446965 3300031727 Bacteria 955
303 Ga0316577_10226110 3300031733 Unclassified 1058
304 Ga0307407_10250168 3300031903 Bacteria 1214
305 Ga0307416_102780231 3300032002 Unclassified 585
306 Ga0316593_10071654 3300032168 Unclassified 1199
307 Ga0307510_10059756 3300033180 Bacteria 3932
308 Ga0373929_0000003 3300035085 Bacteria 575058
309 Ga0373936_0077808 3300035113 Bacteria 1376
310 Ga0373945_0474772 3300035116 Unclassified 555
311 Ga0373957_0226076 3300035120 Unclassified 784
312 Ga0373943_0068258 3300035170 Bacteria 1795
313 Ga0373961_0000780 3300035241 Bacteria 10930
314 Ga0316574_0190668 3300035398 Unclassified 1318
315 Ga0373935_0176944 3300035692 Bacteria 1463
316 Ga0373935_1367145 3300035692 Unclassified 529
317 Ga0373927_0224169 3300035695 Unclassified 1235
318 Ga0373947_0081678 3300035725 Bacteria 2002
319 Ga0316582_0052550 3300036647 Bacteria 2590
320 Ga0316582_0192665 3300036647 Bacteria 1389
321 Ga0316584_0369384 3300036712 Unclassified 1027
322 Ga0316584_0901894 3300036712 Unclassified 595
323 Ga0316584_1026019 3300036712 Bacteria 550
324 Ga0373925_0623593 3300037068 Unclassified 888
325 Ga0373925_0894289 3300037068 Bacteria 732
326 Ga0395905_0006143 3300037471 Bacteria 12122
327 Ga0436364_0174146 3300037853 Bacteria 60383
328 Ga0400485_19185 3300038735 Bacteria 9446
329 Ga0400488_02322 3300038741 Bacteria 1821
330 Ga0400488_37091 3300038741 Bacteria 9262
331 Ga0400486_05408 3300038742 Bacteria 10429
332 Ga0400487_20668 3300039110 Bacteria 1051
333 Ga0400487_39606 3300039110 Bacteria 7634
334 Ga0436360_0819037 3300039438 Bacteria 1742
335 Ga0436360_0980263 3300039438 Bacteria 794
336 Ga0436363_0236406 3300039450 Bacteria 746
337 Ga0439465_0092341 3300041413 Bacteria 1037
338 Ga0439450_050403 3300042008 Bacteria 987
339 Ga0451577_0022422 3300042876 Bacteria 5765
340 Ga0451577_0129281 3300042876 Bacteria 2265
341 Ga0453683_0028222 3300044673 Bacteria 3554
342 Ga0453683_0759490 3300044673 Bacteria 637
343 Ga0453683_1168025 3300044673 Unclassified 515
344 Ga0453684_0100130 3300044712 Unclassified 3548
345 Ga0453684_0105372 3300044712 Bacteria 3439
346 Ga0453684_0135556 3300044712 Bacteria 2948
347 Ga0453684_0494962 3300044712 Bacteria 1354
348 Ga0453684_0689426 3300044712 Bacteria 1111
349 Ga0453684_1270060 3300044712 Bacteria 770
350 Ga0453684_1413536 3300044712 Bacteria 721
351 Ga0451576_0072666 3300045051 Unclassified 3579
352 Ga0451576_0076575 3300045051 Bacteria 3481
353 Ga0451576_0268419 3300045051 Bacteria 1784
354 Ga0495638_0044260 3300046460 Bacteria 2805
355 Ga0495620_0001644 3300046515 Bacteria 13227
356 Ga0495640_0167975 3300046533 Viruses 1403
357 Ga0495586_0211403 3300046535 Bacteria 1101
358 Ga0495622_0124810 3300046557 Unclassified 1174
359 Ga0495668_0147945 3300046616 Bacteria 1286
360 Ga0495635_0576825 3300046663 Unclassified 736
361 Ga0495658_0057483 3300046683 Viruses 2222
362 Ga0495680_0121516 3300047322 Bacteria 1928
363 Ga0495679_006609 3300047446 Bacteria 4961
364 Ga0495686_0015022 3300047472 Bacteria 5307
365 Ga0495686_0128651 3300047472 Bacteria 1503
366 Ga0496101_0934171 3300048904 Unclassified 683
367 Ga0496106_0164425 3300048909 Bacteria 1756
368 Ga0496106_0988704 3300048909 Unclassified 662
369 Ga0496115_0632516 3300048918 Unclassified 848
370 Ga0501291_093467 3300049514 Unclassified 617
371 Ga0501032_0000222 3300049569 Bacteria 47180
372 Ga0501033_0000001 3300049570 Bacteria 795921
373 Ga0501033_0364118 3300049570 Bacteria 1011
374 Ga0501033_0578756 3300049570 Unclassified 771
375 Ga0501034_0020304 3300049571 Bacteria 6783
376 Ga0501034_0591195 3300049571 Unclassified 1016
377 Ga0501037_0329969 3300049573 Bacteria 1055
378 Ga0501038_0011785 3300049574 Bacteria 7976
379 Ga0501038_0190847 3300049574 Bacteria 1649
380 Ga0501040_0003643 3300049576 Bacteria 9980
381 Ga0501040_0250116 3300049576 Bacteria 1264
382 Ga0501041_0042793 3300049577 Bacteria 2753
383 Ga0501041_0205994 3300049577 Unclassified 1233
384 Ga0501042_0477675 3300049578 Unclassified 904
385 Ga0501043_0193322 3300049579 Unclassified 1582
386 Ga0501043_0326511 3300049579 Unclassified 1169
387 Ga0501043_1286388 3300049579 Unclassified 511
388 Ga0501046_0262554 3300049580 Bacteria 1268
389 Ga0501047_0050333 3300049581 Bacteria 4023
390 Ga0501047_0273815 3300049581 Bacteria 1534
391 Ga0501048_0019391 3300049582 Bacteria 4991
392 Ga0501048_0812127 3300049582 Unclassified 672
393 Ga0501067_0041582 3300049583 Bacteria 2552
394 Ga0501068_0022878 3300049584 Bacteria 3659
395 Ga0501068_0670571 3300049584 Unclassified 677
396 Ga0501069_0481053 3300049585 Bacteria 740
397 Ga0501070_0065395 3300049586 Bacteria 3011
398 Ga0501070_0526064 3300049586 Unclassified 948
399 Ga0501071_0188782 3300049587 Bacteria 1545
400 Ga0501071_0371754 3300049587 Unclassified 1089
401 Ga0501072_0004303 3300049588 Bacteria 10813
402 Ga0501074_0434300 3300049590 Bacteria 931
403 Ga0501075_0000007 3300049591 Bacteria 110960
404 Ga0501075_0027771 3300049591 Bacteria 4172
405 Ga0501076_0000668 3300049592 Bacteria 21973
406 Ga0501076_0132285 3300049592 Bacteria 2023
407 Ga0501077_0000012 3300049593 Bacteria 96777
408 Ga0501077_0094795 3300049593 Bacteria 1892
409 Ga0501079_0073538 3300049741 Unclassified 2642
410 Ga0501080_0007659 3300049742 Bacteria 9765
411 Ga0501080_0041431 3300049742 Bacteria 4291
412 Ga0501080_0454271 3300049742 Unclassified 1148
413 Ga0501081_0035911 3300049743 Bacteria 3376
414 Ga0501081_0067307 3300049743 Bacteria 2492
415 Ga0501083_0039253 3300049744 Bacteria 3216
416 Ga0501083_0387795 3300049744 Unclassified 909
417 Ga0501268_091551 3300049765 Unclassified 641
418 Ga0501035_0009553 3300049822 Bacteria 9019
419 Ga0501035_0293289 3300049822 Unclassified 1372
420 Ga0501035_0701681 3300049822 Unclassified 816
421 Ga0501044_0061655 3300049823 Bacteria 3836
422 Ga0501044_0806645 3300049823 Unclassified 818
423 Ga0501045_0101284 3300049824 Unclassified 2132
424 Ga0501045_0426677 3300049824 Bacteria 986
425 nmdc:mga05p37_13467_c1 3300050507 Bacteria 9801
426 nmdc:mga09592_11147_c1 3300050508 Bacteria 7314
427 nmdc:mga09592_1196430_c1 3300050508 Unclassified 628
428 nmdc:mga09592_531311_c1 3300050508 Bacteria 1011
429 nmdc:mga0qj67_1442562_c1 3300050509 Unclassified 530
430 nmdc:mga0qj67_41257_c1 3300050509 Bacteria 3629
431 nmdc:mga0qj67_82731_c1 3300050509 Bacteria 2574
432 nmdc:mga06r32_12237_c1 3300050510 Bacteria 7738
433 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
434 nmdc:mga08y16_9962_c1 3300050511 Bacteria 9976
435 nmdc:mga0n895_243300_c1 3300050512 Unclassified 1826
436 nmdc:mga0rr50_96_c1 3300050513 Bacteria 49211
437 nmdc:mga08x19_250480_c1 3300050514 Unclassified 1223
438 nmdc:mga08x19_4285_c1 3300050514 Bacteria 8457
439 nmdc:mga0a205_185356_c1 3300050515 Bacteria 1974
440 Ga0500647_0017765 3300053091 Bacteria 3286
441 Ga0500583_0081971 3300053092 Bacteria 1559
442 Ga0500566_0000020 3300053094 Bacteria 83462
443 Ga0500640_000050 3300053095 Bacteria 17941
444 Ga0500641_0018894 3300053096 Bacteria 2599
445 Ga0500562_010685 3300053108 Bacteria 2328
446 Ga0500562_016236 3300053108 Bacteria 1914
447 Ga0500572_000068 3300053111 Bacteria 32485
448 Ga0500591_029748 3300053115 Bacteria 2640
449 Ga0500608_002574 3300053122 Bacteria 6631
450 Ga0500614_001335 3300053123 Bacteria 5939
451 Ga0500559_0095281 3300053136 Bacteria 1366
452 Ga0500585_081841 3300053144 Bacteria 1167
453 Ga0500590_035369 3300053148 Bacteria 2586
454 Ga0500603_000234 3300053150 Bacteria 14574
455 Ga0500619_301437 3300053154 Bacteria 517
456 Ga0500622_0043256 3300053156 Bacteria 2337
457 Ga0500630_000407 3300053159 Bacteria 18443
458 Ga0500638_014308 3300053162 Bacteria 3617
459 Ga0500638_119199 3300053162 Bacteria 1209
460 Ga0500639_000111 3300053163 Bacteria 38862
461 Ga0500636_0013677 3300053177 Bacteria 4768
462 Ga0500637_0016496 3300053178 Bacteria 3937
463 Ga0500596_000226 3300053735 Bacteria 9586
464 Ga0500601_001691 3300053737 Bacteria 2377
465 Ga0501084_0010487 3300054114 Bacteria 7659
466 Ga0501084_1018336 3300054114 Bacteria 696
467 Ga0501082_0000054 3300060353 Bacteria 82015
468 Ga0501082_0005340 3300060353 Bacteria 11161
469 Ga0501082_0177296 3300060353 Bacteria 1853
470 Ga0501082_1846677 3300060353 Unclassified 527
471 Ga0530510_0000033 3300061734 Bacteria 62842
472 Ga0530510_0000151 3300061734 Bacteria 41451
473 Ga0530510_0008613 3300061734 Bacteria 7126
474 Ga0530510_0057614 3300061734 Bacteria 2808
475 Ga0530510_0109925 3300061734 Bacteria 2018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0190668 Ga0316574_0190668_959_1300 112
2 3300026095 Ga0207676_10942753 Ga0207676_109427531 115
3 3300005614 Ga0068856_101564811 Ga0068856_1015648111 119
4 3300026116 Ga0207674_10972418 Ga0207674_109724182 119
5 3300037853 Ga0436364_0174146 Ga0436364_0174146_3174_3545 123
6 iso_pu_bacteria 2585427530 2585555109 125
7 3300005329 Ga0070683_100613610 Ga0070683_1006136101 127
8 3300005337 Ga0070682_100000033 Ga0070682_100000033124 127
9 3300005340 Ga0070689_100488080 Ga0070689_1004880802 127
10 3300005458 Ga0070681_10448953 Ga0070681_104489532 127
11 3300005468 Ga0070707_100015529 Ga0070707_1000155294 127
12 3300005530 Ga0070679_100491971 Ga0070679_1004919712 127
13 3300005577 Ga0068857_100596996 Ga0068857_1005969962 127
14 3300005937 Ga0081455_10245027 Ga0081455_102450273 127
15 3300006914 Ga0075436_100008008 Ga0075436_1000080087 127
16 3300007076 Ga0075435_100000133 Ga0075435_10000013313 127
17 3300009094 Ga0111539_10000022 Ga0111539_10000022171 127
18 3300009545 Ga0105237_10063500 Ga0105237_100635003 127
19 3300009551 Ga0105238_12351699 Ga0105238_123516991 127
20 3300011119 Ga0105246_10048398 Ga0105246_100483984 127
21 3300013297 Ga0157378_10000839 Ga0157378_1000083910 127
22 3300025914 Ga0207671_10467221 Ga0207671_104672212 127
23 3300025914 Ga0207671_10741598 Ga0207671_107415982 127
24 3300025918 Ga0207662_10037471 Ga0207662_100374713 127
25 3300025924 Ga0207694_10046873 Ga0207694_100468733 127
26 3300025936 Ga0207670_10626781 Ga0207670_106267812 127
27 3300025986 Ga0207658_10739774 Ga0207658_107397742 127
28 3300026116 Ga0207674_10657653 Ga0207674_106576533 127
29 3300027907 Ga0207428_10000030 Ga0207428_10000030170 127
30 3300028800 Ga0265338_10404296 Ga0265338_104042961 127
31 3300031249 Ga0265339_10215605 Ga0265339_102156051 127
32 3300035241 Ga0373961_0000780 Ga0373961_0000780_9407_9790 127
33 3300044673 Ga0453683_1168025 Ga0453683_1168025_36_419 127
34 3300044712 Ga0453684_1270060 Ga0453684_1270060_367_750 127
35 3300045051 Ga0451576_0268419 Ga0451576_0268419_1163_1546 127
36 3300046515 Ga0495620_0001644 Ga0495620_0001644_6741_7124 127
37 3300047446 Ga0495679_006609 Ga0495679_006609_3379_3762 127
38 3300048909 Ga0496106_0164425 Ga0496106_0164425_1014_1397 127
39 3300049583 Ga0501067_0041582 Ga0501067_0041582_1455_1838 127
40 3300049584 Ga0501068_0022878 Ga0501068_0022878_2820_3203 127
41 3300049591 Ga0501075_0027771 Ga0501075_0027771_1048_1431 127
42 3300049593 Ga0501077_0000012 Ga0501077_0000012_58107_58490 127
43 3300049742 Ga0501080_0007659 Ga0501080_0007659_1055_1438 127
44 3300050511 nmdc:mga08y16_24_c1 nmdc:mga08y16_24_c1_165720_166103 127
45 3300050512 nmdc:mga0n895_243300_c1 nmdc:mga0n895_243300_c1_784_1167 127
46 3300050515 nmdc:mga0a205_185356_c1 nmdc:mga0a205_185356_c1_107_490 127
47 3300060353 Ga0501082_0000054 Ga0501082_0000054_45376_45759 127
48 3300061734 Ga0530510_0057614 Ga0530510_0057614_2162_2545 127
49 3300025927 Ga0207687_10002480 Ga0207687_100024805 128
50 3300025936 Ga0207670_11919212 Ga0207670_119192121 128
51 iso_pu_bacteria 2511231221 2512037835 128
52 iso_pu_bacteria 2876369609 2876375311 128
53 3300003203 JGI25406J46586_10020480 JGI25406J46586_100204804 129
54 3300003322 rootL2_10031791 rootL2_100317911 129
55 3300005616 Ga0068852_100562104 Ga0068852_1005621043 129
56 3300005985 Ga0081539_10001162 Ga0081539_1000116251 129
57 3300035113 Ga0373936_0077808 Ga0373936_0077808_709_1101 129
58 3300044712 Ga0453684_0100130 Ga0453684_0100130_477_869 129
59 3300045051 Ga0451576_0072666 Ga0451576_0072666_470_862 129
60 3300049765 Ga0501268_091551 Ga0501268_091551_122_517 129
61 3300053091 Ga0500647_0017765 Ga0500647_0017765_2401_2793 129
62 3300053094 Ga0500566_0000020 Ga0500566_0000020_27138_27530 129
63 3300053095 Ga0500640_000050 Ga0500640_000050_549_941 129
64 3300053111 Ga0500572_000068 Ga0500572_000068_4583_4975 129
65 3300053115 Ga0500591_029748 Ga0500591_029748_1017_1409 129
66 3300053122 Ga0500608_002574 Ga0500608_002574_4068_4460 129
67 3300053123 Ga0500614_001335 Ga0500614_001335_2212_2604 129
68 3300053136 Ga0500559_0095281 Ga0500559_0095281_710_1102 129
69 3300053144 Ga0500585_081841 Ga0500585_081841_498_890 129
70 3300053148 Ga0500590_035369 Ga0500590_035369_1127_1519 129
71 3300053150 Ga0500603_000234 Ga0500603_000234_8610_9002 129
72 3300053154 Ga0500619_301437 Ga0500619_301437_69_458 129
73 3300053159 Ga0500630_000407 Ga0500630_000407_14650_15042 129
74 3300053162 Ga0500638_014308 Ga0500638_014308_2369_2761 129
75 3300053163 Ga0500639_000111 Ga0500639_000111_9778_10170 129
76 3300053735 Ga0500596_000226 Ga0500596_000226_2404_2796 129
77 3300053737 Ga0500601_001691 Ga0500601_001691_709_1101 129
78 3300005329 Ga0070683_100183710 Ga0070683_1001837103 130
79 3300005336 Ga0070680_101037682 Ga0070680_1010376822 130
80 3300005343 Ga0070687_100160919 Ga0070687_1001609191 130
81 3300005436 Ga0070713_101719442 Ga0070713_1017194421 130
82 3300005445 Ga0070708_101223459 Ga0070708_1012234592 130
83 3300005468 Ga0070707_100198437 Ga0070707_1001984374 130
84 3300005563 Ga0068855_101492922 Ga0068855_1014929221 130
85 3300005614 Ga0068856_100196935 Ga0068856_1001969352 130
86 3300005615 Ga0070702_100536063 Ga0070702_1005360632 130
87 3300005616 Ga0068852_100212993 Ga0068852_1002129933 130
88 3300005618 Ga0068864_100454739 Ga0068864_1004547392 130
89 3300006028 Ga0070717_10140770 Ga0070717_101407702 130
90 3300006028 Ga0070717_11749207 Ga0070717_117492071 130
91 3300006844 Ga0075428_100118243 Ga0075428_1001182432 130
92 3300007265 Ga0099794_10066677 Ga0099794_100666773 130
93 3300007788 Ga0099795_10004751 Ga0099795_100047513 130
94 3300009545 Ga0105237_10987491 Ga0105237_109874912 130
95 3300009551 Ga0105238_10080162 Ga0105238_100801623 130
96 3300009551 Ga0105238_11114335 Ga0105238_111143353 130
97 3300010159 Ga0099796_10190644 Ga0099796_101906442 130
98 3300010375 Ga0105239_10220834 Ga0105239_102208343 130
99 3300013105 Ga0157369_10105103 Ga0157369_101051031 130
100 3300013296 Ga0157374_11204699 Ga0157374_112046992 130
101 3300013307 Ga0157372_10078176 Ga0157372_100781763 130
102 3300014969 Ga0157376_10560337 Ga0157376_105603372 130
103 3300014969 Ga0157376_11776676 Ga0157376_117766762 130
104 3300025908 Ga0207643_10035922 Ga0207643_100359223 130
105 3300025913 Ga0207695_10165083 Ga0207695_101650833 130
106 3300025918 Ga0207662_10147498 Ga0207662_101474981 130
107 3300025918 Ga0207662_10843220 Ga0207662_108432202 130
108 3300025921 Ga0207652_10156673 Ga0207652_101566732 130
109 3300025944 Ga0207661_10138396 Ga0207661_101383963 130
110 3300025944 Ga0207661_10333259 Ga0207661_103332592 130
111 3300025949 Ga0207667_10977738 Ga0207667_109777382 130
112 3300026078 Ga0207702_11290218 Ga0207702_112902182 130
113 3300026142 Ga0207698_10259200 Ga0207698_102592002 130
114 3300027512 Ga0209179_1018149 Ga0209179_10181492 130
115 3300028381 Ga0268264_10606120 Ga0268264_106061203 130
116 3300028563 Ga0265319_1026255 Ga0265319_10262552 130
117 3300028653 Ga0265323_10021966 Ga0265323_100219662 130
118 3300028654 Ga0265322_10002667 Ga0265322_100026673 130
119 3300030521 Ga0307511_10000270 Ga0307511_1000027031 130
120 3300031235 Ga0265330_10031965 Ga0265330_100319654 130
121 3300031235 Ga0265330_10039509 Ga0265330_100395091 130
122 3300031238 Ga0265332_10164776 Ga0265332_101647761 130
123 3300031241 Ga0265325_10016564 Ga0265325_100165645 130
124 3300031247 Ga0265340_10061711 Ga0265340_100617112 130
125 3300031249 Ga0265339_10025595 Ga0265339_100255957 130
126 3300031249 Ga0265339_10140412 Ga0265339_101404122 130
127 3300031344 Ga0265316_10001617 Ga0265316_1000161718 130
128 3300031344 Ga0265316_10695011 Ga0265316_106950112 130
129 3300031711 Ga0265314_10057404 Ga0265314_100574043 130
130 3300031712 Ga0265342_10072021 Ga0265342_100720213 130
131 3300031712 Ga0265342_10181479 Ga0265342_101814792 130
132 3300031712 Ga0265342_10247181 Ga0265342_102471812 130
133 3300035120 Ga0373957_0226076 Ga0373957_0226076_123_515 130
134 3300035692 Ga0373935_1367145 Ga0373935_1367145_35_427 130
135 3300035695 Ga0373927_0224169 Ga0373927_0224169_242_634 130
136 3300037068 Ga0373925_0623593 Ga0373925_0623593_43_435 130
137 3300037068 Ga0373925_0894289 Ga0373925_0894289_74_481 130
138 3300042876 Ga0451577_0022422 Ga0451577_0022422_671_1063 130
139 3300042876 Ga0451577_0129281 Ga0451577_0129281_704_1099 130
140 3300044712 Ga0453684_0494962 Ga0453684_0494962_306_698 130
141 3300044712 Ga0453684_0689426 Ga0453684_0689426_342_734 130
142 3300044712 Ga0453684_1413536 Ga0453684_1413536_281_676 130
143 3300045051 Ga0451576_0076575 Ga0451576_0076575_166_558 130
144 3300046663 Ga0495635_0576825 Ga0495635_0576825_47_439 130
145 3300047322 Ga0495680_0121516 Ga0495680_0121516_716_1108 130
146 3300048904 Ga0496101_0934171 Ga0496101_0934171_233_625 130
147 3300048918 Ga0496115_0632516 Ga0496115_0632516_287_679 130
148 3300049569 Ga0501032_0000222 Ga0501032_0000222_39832_40233 130
149 3300049570 Ga0501033_0000001 Ga0501033_0000001_139958_140359 130
150 3300049586 Ga0501070_0526064 Ga0501070_0526064_391_789 130
151 3300053092 Ga0500583_0081971 Ga0500583_0081971_74_469 130
152 3300053096 Ga0500641_0018894 Ga0500641_0018894_492_887 130
153 3300053108 Ga0500562_016236 Ga0500562_016236_22_417 130
154 3300053178 Ga0500637_0016496 Ga0500637_0016496_2538_2933 130
155 iso_pu_bacteria 2913912277 2913916878 130
156 3300002155 JGI24033J26618_1064727 JGI24033J26618_10647272 131
157 3300005343 Ga0070687_100009090 Ga0070687_1000090903 131
158 3300005444 Ga0070694_100544685 Ga0070694_1005446852 131
159 3300005445 Ga0070708_100032781 Ga0070708_1000327814 131
160 3300005445 Ga0070708_100098509 Ga0070708_1000985093 131
161 3300005445 Ga0070708_100258490 Ga0070708_1002584901 131
162 3300005467 Ga0070706_100638534 Ga0070706_1006385342 131
163 3300005468 Ga0070707_100172601 Ga0070707_1001726013 131
164 3300005471 Ga0070698_100690575 Ga0070698_1006905752 131
165 3300005518 Ga0070699_101363419 Ga0070699_1013634191 131
166 3300005536 Ga0070697_101668984 Ga0070697_1016689841 131
167 3300005546 Ga0070696_100047939 Ga0070696_1000479393 131
168 3300005546 Ga0070696_100352363 Ga0070696_1003523632 131
169 3300005549 Ga0070704_100019395 Ga0070704_1000193954 131
170 3300005563 Ga0068855_100132251 Ga0068855_1001322512 131
171 3300006028 Ga0070717_10000127 Ga0070717_1000012739 131
172 3300006852 Ga0075433_10166266 Ga0075433_101662661 131
173 3300006871 Ga0075434_100064364 Ga0075434_1000643643 131
174 3300006871 Ga0075434_100924266 Ga0075434_1009242661 131
175 3300006914 Ga0075436_100413866 Ga0075436_1004138661 131
176 3300007265 Ga0099794_10229727 Ga0099794_102297272 131
177 3300010375 Ga0105239_11378425 Ga0105239_113784252 131
178 3300017792 Ga0163161_10570725 Ga0163161_105707252 131
179 3300025910 Ga0207684_10525995 Ga0207684_105259952 131
180 3300025922 Ga0207646_10069241 Ga0207646_100692411 131
181 3300025939 Ga0207665_10402135 Ga0207665_104021352 131
182 3300025942 Ga0207689_10509131 Ga0207689_105091313 131
183 3300025949 Ga0207667_10011382 Ga0207667_100113825 131
184 3300028563 Ga0265319_1025319 Ga0265319_10253192 131
185 3300031548 Ga0307408_101099692 Ga0307408_1010996921 131
186 3300032002 Ga0307416_102780231 Ga0307416_1027802311 131
187 3300035116 Ga0373945_0474772 Ga0373945_0474772_129_524 131
188 3300035170 Ga0373943_0068258 Ga0373943_0068258_1148_1543 131
189 3300035692 Ga0373935_0176944 Ga0373935_0176944_568_963 131
190 3300035725 Ga0373947_0081678 Ga0373947_0081678_739_1134 131
191 3300036647 Ga0316582_0052550 Ga0316582_0052550_1329_1724 131
192 3300036712 Ga0316584_0369384 Ga0316584_0369384_182_577 131
193 3300036712 Ga0316584_1026019 Ga0316584_1026019_125_520 131
194 3300039438 Ga0436360_0980263 Ga0436360_0980263_23_418 131
195 3300039450 Ga0436363_0236406 Ga0436363_0236406_184_591 131
196 3300044673 Ga0453683_0028222 Ga0453683_0028222_715_1110 131
197 3300044673 Ga0453683_0759490 Ga0453683_0759490_178_573 131
198 3300044712 Ga0453684_0135556 Ga0453684_0135556_305_700 131
199 3300046460 Ga0495638_0044260 Ga0495638_0044260_769_1173 131
200 3300046535 Ga0495586_0211403 Ga0495586_0211403_89_484 131
201 3300046557 Ga0495622_0124810 Ga0495622_0124810_291_689 131
202 3300048909 Ga0496106_0988704 Ga0496106_0988704_184_582 131
203 3300049570 Ga0501033_0364118 Ga0501033_0364118_74_469 131
204 3300049570 Ga0501033_0578756 Ga0501033_0578756_328_723 131
205 3300049574 Ga0501038_0011785 Ga0501038_0011785_4320_4715 131
206 3300049576 Ga0501040_0003643 Ga0501040_0003643_969_1364 131
207 3300049576 Ga0501040_0250116 Ga0501040_0250116_249_644 131
208 3300049577 Ga0501041_0042793 Ga0501041_0042793_1307_1702 131
209 3300049577 Ga0501041_0205994 Ga0501041_0205994_490_885 131
210 3300049578 Ga0501042_0477675 Ga0501042_0477675_444_839 131
211 3300049579 Ga0501043_0193322 Ga0501043_0193322_565_960 131
212 3300049579 Ga0501043_0326511 Ga0501043_0326511_640_1035 131
213 3300049582 Ga0501048_0019391 Ga0501048_0019391_2295_2690 131
214 3300049582 Ga0501048_0812127 Ga0501048_0812127_180_575 131
215 3300049584 Ga0501068_0670571 Ga0501068_0670571_105_500 131
216 3300049587 Ga0501071_0188782 Ga0501071_0188782_27_422 131
217 3300049587 Ga0501071_0371754 Ga0501071_0371754_62_457 131
218 3300049588 Ga0501072_0004303 Ga0501072_0004303_7467_7862 131
219 3300049591 Ga0501075_0000007 Ga0501075_0000007_54661_55056 131
220 3300049592 Ga0501076_0000668 Ga0501076_0000668_13028_13423 131
221 3300049592 Ga0501076_0132285 Ga0501076_0132285_992_1387 131
222 3300049593 Ga0501077_0094795 Ga0501077_0094795_869_1264 131
223 3300049741 Ga0501079_0073538 Ga0501079_0073538_1316_1711 131
224 3300049742 Ga0501080_0041431 Ga0501080_0041431_3610_4005 131
225 3300049742 Ga0501080_0454271 Ga0501080_0454271_72_467 131
226 3300049743 Ga0501081_0035911 Ga0501081_0035911_2539_2934 131
227 3300049743 Ga0501081_0067307 Ga0501081_0067307_670_1065 131
228 3300049744 Ga0501083_0039253 Ga0501083_0039253_453_848 131
229 3300049822 Ga0501035_0293289 Ga0501035_0293289_718_1113 131
230 3300049822 Ga0501035_0701681 Ga0501035_0701681_149_544 131
231 3300049823 Ga0501044_0806645 Ga0501044_0806645_384_779 131
232 3300049824 Ga0501045_0101284 Ga0501045_0101284_1017_1412 131
233 3300049824 Ga0501045_0426677 Ga0501045_0426677_94_489 131
234 3300050508 nmdc:mga09592_531311_c1 nmdc:mga09592_531311_c1_397_795 131
235 3300050509 nmdc:mga0qj67_1442562_c1 nmdc:mga0qj67_1442562_c1_14_409 131
236 3300050513 nmdc:mga0rr50_96_c1 nmdc:mga0rr50_96_c1_40552_40950 131
237 3300050514 nmdc:mga08x19_4285_c1 nmdc:mga08x19_4285_c1_4834_5232 131
238 3300054114 Ga0501084_0010487 Ga0501084_0010487_5360_5755 131
239 3300060353 Ga0501082_0005340 Ga0501082_0005340_8562_8957 131
240 3300060353 Ga0501082_0177296 Ga0501082_0177296_1374_1769 131
241 3300060353 Ga0501082_1846677 Ga0501082_1846677_100_495 131
242 3300061734 Ga0530510_0000033 Ga0530510_0000033_15561_15956 131
243 3300061734 Ga0530510_0000151 Ga0530510_0000151_4791_5186 131
244 3300061734 Ga0530510_0008613 Ga0530510_0008613_3456_3851 131
245 3300061734 Ga0530510_0109925 Ga0530510_0109925_1118_1513 131
246 3300003320 rootH2_10022308 rootH2_100223085 132
247 3300003323 rootH1_10303224 rootH1_103032245 132
248 3300005289 Ga0065704_10440541 Ga0065704_104405411 132
249 3300005295 Ga0065707_10216078 Ga0065707_102160783 132
250 3300005333 Ga0070677_10008412 Ga0070677_100084123 132
251 3300005337 Ga0070682_100050135 Ga0070682_1000501353 132
252 3300005563 Ga0068855_100583650 Ga0068855_1005836501 132
253 3300005841 Ga0068863_100912749 Ga0068863_1009127492 132
254 3300006173 Ga0070716_100136992 Ga0070716_1001369922 132
255 3300006846 Ga0075430_100211711 Ga0075430_1002117113 132
256 3300006847 Ga0075431_100753097 Ga0075431_1007530972 132
257 3300006914 Ga0075436_100122073 Ga0075436_1001220732 132
258 3300009098 Ga0105245_10000434 Ga0105245_1000043435 132
259 3300009177 Ga0105248_11856386 Ga0105248_118563861 132
260 3300009553 Ga0105249_10081575 Ga0105249_100815753 132
261 3300013296 Ga0157374_10013654 Ga0157374_100136543 132
262 3300013306 Ga0163162_10017591 Ga0163162_100175916 132
263 3300013307 Ga0157372_10481314 Ga0157372_104813142 132
264 3300014325 Ga0163163_11244229 Ga0163163_112442291 132
265 3300014969 Ga0157376_10038721 Ga0157376_100387214 132
266 3300025893 Ga0207682_10032869 Ga0207682_100328693 132
267 3300025927 Ga0207687_10198266 Ga0207687_101982661 132
268 3300025939 Ga0207665_10514178 Ga0207665_105141782 132
269 3300025961 Ga0207712_10046873 Ga0207712_100468733 132
270 3300026088 Ga0207641_10081700 Ga0207641_100817002 132
271 3300028556 Ga0265337_1010116 Ga0265337_10101162 132
272 3300028573 Ga0265334_10200545 Ga0265334_102005452 132
273 3300031090 Ga0265760_10001026 Ga0265760_1000102611 132
274 3300031090 Ga0265760_10079320 Ga0265760_100793202 132
275 3300031249 Ga0265339_10544795 Ga0265339_105447951 132
276 3300031344 Ga0265316_10188347 Ga0265316_101883473 132
277 3300031711 Ga0265314_10065434 Ga0265314_100654344 132
278 3300031712 Ga0265342_10172878 Ga0265342_101728782 132
279 3300031733 Ga0316577_10226110 Ga0316577_102261102 132
280 3300031903 Ga0307407_10250168 Ga0307407_102501682 132
281 3300033180 Ga0307510_10059756 Ga0307510_100597564 132
282 3300036712 Ga0316584_0901894 Ga0316584_0901894_115_519 132
283 3300041413 Ga0439465_0092341 Ga0439465_0092341_367_768 132
284 3300046533 Ga0495640_0167975 Ga0495640_0167975_593_1006 132
285 3300046616 Ga0495668_0147945 Ga0495668_0147945_615_1013 132
286 3300046683 Ga0495658_0057483 Ga0495658_0057483_637_1050 132
287 3300049514 Ga0501291_093467 Ga0501291_093467_92_493 132
288 3300049571 Ga0501034_0020304 Ga0501034_0020304_1642_2040 132
289 3300049573 Ga0501037_0329969 Ga0501037_0329969_92_490 132
290 3300049574 Ga0501038_0190847 Ga0501038_0190847_649_1047 132
291 3300049579 Ga0501043_1286388 Ga0501043_1286388_79_480 132
292 3300049580 Ga0501046_0262554 Ga0501046_0262554_680_1078 132
293 3300049581 Ga0501047_0050333 Ga0501047_0050333_392_790 132
294 3300049581 Ga0501047_0273815 Ga0501047_0273815_1007_1408 132
295 3300049585 Ga0501069_0481053 Ga0501069_0481053_114_512 132
296 3300049586 Ga0501070_0065395 Ga0501070_0065395_2132_2530 132
297 3300049590 Ga0501074_0434300 Ga0501074_0434300_168_569 132
298 3300049744 Ga0501083_0387795 Ga0501083_0387795_319_723 132
299 3300049822 Ga0501035_0009553 Ga0501035_0009553_3676_4074 132
300 3300049823 Ga0501044_0061655 Ga0501044_0061655_3124_3522 132
301 3300050508 nmdc:mga09592_1196430_c1 nmdc:mga09592_1196430_c1_175_579 132
302 3300050509 nmdc:mga0qj67_82731_c1 nmdc:mga0qj67_82731_c1_348_749 132
303 3300050514 nmdc:mga08x19_250480_c1 nmdc:mga08x19_250480_c1_550_948 132
304 3300054114 Ga0501084_1018336 Ga0501084_1018336_231_629 132
305 2010549000 RicEn_C5293 RicEn_94550 133
306 3300001904 JGI24736J21556_1018219 JGI24736J21556_10182192 133
307 3300001979 JGI24740J21852_10008085 JGI24740J21852_100080853 133
308 3300001979 JGI24740J21852_10033760 JGI24740J21852_100337603 133
309 3300001989 JGI24739J22299_10093253 JGI24739J22299_100932533 133
310 3300001990 JGI24737J22298_10073977 JGI24737J22298_100739771 133
311 3300002067 JGI24735J21928_10008830 JGI24735J21928_100088302 133
312 3300002067 JGI24735J21928_10062813 JGI24735J21928_100628133 133
313 3300002070 JGI24750J21931_1000318 JGI24750J21931_10003188 133
314 3300002075 JGI24738J21930_10018205 JGI24738J21930_100182052 133
315 3300003203 JGI25406J46586_10000963 JGI25406J46586_100009635 133
316 3300005330 Ga0070690_100000177 Ga0070690_10000017731 133
317 3300005331 Ga0070670_100101443 Ga0070670_1001014435 133
318 3300005335 Ga0070666_10000014 Ga0070666_10000014229 133
319 3300005337 Ga0070682_100298799 Ga0070682_1002987992 133
320 3300005339 Ga0070660_100045563 Ga0070660_1000455634 133
321 3300005340 Ga0070689_100278042 Ga0070689_1002780421 133
322 3300005344 Ga0070661_100255102 Ga0070661_1002551022 133
323 3300005347 Ga0070668_100251173 Ga0070668_1002511732 133
324 3300005353 Ga0070669_100000028 Ga0070669_100000028139 133
325 3300005353 Ga0070669_100000958 Ga0070669_10000095820 133
326 3300005355 Ga0070671_100001321 Ga0070671_10000132117 133
327 3300005356 Ga0070674_100055668 Ga0070674_1000556684 133
328 3300005365 Ga0070688_100000708 Ga0070688_1000007085 133
329 3300005366 Ga0070659_100107497 Ga0070659_1001074975 133
330 3300005366 Ga0070659_101826790 Ga0070659_1018267901 133
331 3300005367 Ga0070667_100000655 Ga0070667_10000065534 133
332 3300005445 Ga0070708_100009946 Ga0070708_1000099467 133
333 3300005445 Ga0070708_100774232 Ga0070708_1007742322 133
334 3300005457 Ga0070662_100017381 Ga0070662_1000173815 133
335 3300005466 Ga0070685_10003569 Ga0070685_1000356910 133
336 3300005467 Ga0070706_100003372 Ga0070706_1000033727 133
337 3300005467 Ga0070706_100014294 Ga0070706_1000142943 133
338 3300005471 Ga0070698_100004677 Ga0070698_1000046777 133
339 3300005471 Ga0070698_100513155 Ga0070698_1005131552 133
340 3300005535 Ga0070684_100201688 Ga0070684_1002016883 133
341 3300005536 Ga0070697_100059102 Ga0070697_1000591023 133
342 3300005539 Ga0068853_100156551 Ga0068853_1001565512 133
343 3300005539 Ga0068853_100420334 Ga0068853_1004203342 133
344 3300005544 Ga0070686_100000002 Ga0070686_100000002348 133
345 3300005548 Ga0070665_100000004 Ga0070665_100000004753 133
346 3300005549 Ga0070704_100390155 Ga0070704_1003901552 133
347 3300005563 Ga0068855_100053677 Ga0068855_1000536777 133
348 3300005563 Ga0068855_100127616 Ga0068855_1001276162 133
349 3300005563 Ga0068855_102147505 Ga0068855_1021475051 133
350 3300005564 Ga0070664_101125901 Ga0070664_1011259012 133
351 3300005577 Ga0068857_100270495 Ga0068857_1002704953 133
352 3300005577 Ga0068857_100725285 Ga0068857_1007252852 133
353 3300005578 Ga0068854_100004367 Ga0068854_1000043672 133
354 3300005578 Ga0068854_100347807 Ga0068854_1003478073 133
355 3300005578 Ga0068854_100566575 Ga0068854_1005665751 133
356 3300005614 Ga0068856_100453399 Ga0068856_1004533993 133
357 3300005616 Ga0068852_100754415 Ga0068852_1007544152 133
358 3300005617 Ga0068859_100003140 Ga0068859_1000031409 133
359 3300005618 Ga0068864_100009846 Ga0068864_1000098462 133
360 3300005719 Ga0068861_100780483 Ga0068861_1007804832 133
361 3300005834 Ga0068851_10169039 Ga0068851_101690393 133
362 3300005834 Ga0068851_10197054 Ga0068851_101970542 133
363 3300005842 Ga0068858_100015829 Ga0068858_1000158298 133
364 3300005843 Ga0068860_100000001 Ga0068860_100000001740 133
365 3300005985 Ga0081539_10000350 Ga0081539_1000035034 133
366 3300005985 Ga0081539_10258405 Ga0081539_102584051 133
367 3300006048 Ga0075363_100905097 Ga0075363_1009050971 133
368 3300006358 Ga0068871_101093089 Ga0068871_1010930893 133
369 3300006844 Ga0075428_100014020 Ga0075428_1000140205 133
370 3300006846 Ga0075430_100374067 Ga0075430_1003740672 133
371 3300006847 Ga0075431_100015689 Ga0075431_1000156895 133
372 3300006880 Ga0075429_100014506 Ga0075429_1000145065 133
373 3300006931 Ga0097620_100003140 Ga0097620_1000031409 133
374 3300009093 Ga0105240_10386039 Ga0105240_103860392 133
375 3300009093 Ga0105240_10568522 Ga0105240_105685222 133
376 3300009094 Ga0111539_10016786 Ga0111539_100167865 133
377 3300009147 Ga0114129_10038605 Ga0114129_100386053 133
378 3300009545 Ga0105237_10091847 Ga0105237_100918477 133
379 3300009545 Ga0105237_10799259 Ga0105237_107992592 133
380 3300009551 Ga0105238_10092256 Ga0105238_100922562 133
381 3300009551 Ga0105238_10251729 Ga0105238_102517293 133
382 3300009553 Ga0105249_10000005 Ga0105249_100000059 133
383 3300011119 Ga0105246_11874020 Ga0105246_118740202 133
384 3300013104 Ga0157370_10069309 Ga0157370_100693094 133
385 3300013104 Ga0157370_10468515 Ga0157370_104685152 133
386 3300013105 Ga0157369_10117627 Ga0157369_101176273 133
387 3300013105 Ga0157369_10536182 Ga0157369_105361822 133
388 3300013297 Ga0157378_10011297 Ga0157378_100112976 133
389 3300013307 Ga0157372_11171670 Ga0157372_111716702 133
390 3300013308 Ga0157375_10007688 Ga0157375_100076887 133
391 3300014325 Ga0163163_10295988 Ga0163163_102959884 133
392 3300014326 Ga0157380_10037435 Ga0157380_100374353 133
393 3300014968 Ga0157379_10124686 Ga0157379_101246862 133
394 3300017792 Ga0163161_10000106 Ga0163161_1000010674 133
395 3300025321 Ga0207656_10126462 Ga0207656_101264621 133
396 3300025903 Ga0207680_10000004 Ga0207680_10000004135 133
397 3300025904 Ga0207647_10015569 Ga0207647_100155693 133
398 3300025904 Ga0207647_10371967 Ga0207647_103719672 133
399 3300025910 Ga0207684_10024176 Ga0207684_100241765 133
400 3300025910 Ga0207684_10120588 Ga0207684_101205883 133
401 3300025911 Ga0207654_10002086 Ga0207654_100020867 133
402 3300025911 Ga0207654_10003127 Ga0207654_100031279 133
403 3300025911 Ga0207654_10005142 Ga0207654_100051423 133
404 3300025913 Ga0207695_10003538 Ga0207695_100035383 133
405 3300025913 Ga0207695_10012343 Ga0207695_100123437 133
406 3300025913 Ga0207695_10022675 Ga0207695_100226753 133
407 3300025914 Ga0207671_10016463 Ga0207671_100164632 133
408 3300025914 Ga0207671_10019223 Ga0207671_100192233 133
409 3300025914 Ga0207671_10031552 Ga0207671_100315525 133
410 3300025919 Ga0207657_10131253 Ga0207657_101312533 133
411 3300025920 Ga0207649_10165677 Ga0207649_101656772 133
412 3300025920 Ga0207649_10693771 Ga0207649_106937711 133
413 3300025923 Ga0207681_10000056 Ga0207681_100000565 133
414 3300025923 Ga0207681_10000704 Ga0207681_100007046 133
415 3300025924 Ga0207694_10000630 Ga0207694_100006303 133
416 3300025924 Ga0207694_10005011 Ga0207694_100050117 133
417 3300025924 Ga0207694_10043409 Ga0207694_100434092 133
418 3300025925 Ga0207650_10115924 Ga0207650_101159244 133
419 3300025931 Ga0207644_10000028 Ga0207644_10000028135 133
420 3300025932 Ga0207690_10544731 Ga0207690_105447312 133
421 3300025932 Ga0207690_11073475 Ga0207690_110734752 133
422 3300025933 Ga0207706_10040418 Ga0207706_100404187 133
423 3300025936 Ga0207670_10099225 Ga0207670_100992253 133
424 3300025937 Ga0207669_10316178 Ga0207669_103161783 133
425 3300025941 Ga0207711_10011145 Ga0207711_100111454 133
426 3300025942 Ga0207689_10244848 Ga0207689_102448483 133
427 3300025945 Ga0207679_10991032 Ga0207679_109910322 133
428 3300025949 Ga0207667_10004045 Ga0207667_1000404526 133
429 3300025949 Ga0207667_10013903 Ga0207667_100139032 133
430 3300025961 Ga0207712_10000001 Ga0207712_100000019 133
431 3300025972 Ga0207668_10235574 Ga0207668_102355742 133
432 3300025981 Ga0207640_10075647 Ga0207640_100756472 133
433 3300025981 Ga0207640_10331923 Ga0207640_103319233 133
434 3300025981 Ga0207640_10441347 Ga0207640_104413472 133
435 3300025986 Ga0207658_10001581 Ga0207658_1000158116 133
436 3300026035 Ga0207703_10000948 Ga0207703_1000094829 133
437 3300026041 Ga0207639_10035055 Ga0207639_100350553 133
438 3300026041 Ga0207639_10039794 Ga0207639_100397947 133
439 3300026078 Ga0207702_10013506 Ga0207702_100135063 133
440 3300026078 Ga0207702_10019567 Ga0207702_100195673 133
441 3300026078 Ga0207702_10105006 Ga0207702_101050065 133
442 3300026095 Ga0207676_10000373 Ga0207676_1000037338 133
443 3300026118 Ga0207675_100179823 Ga0207675_1001798234 133
444 3300026142 Ga0207698_10003339 Ga0207698_100033392 133
445 3300026142 Ga0207698_10006940 Ga0207698_100069404 133
446 3300027907 Ga0207428_10020340 Ga0207428_100203403 133
447 3300028379 Ga0268266_10000009 Ga0268266_1000000954 133
448 3300028379 Ga0268266_10001995 Ga0268266_100019955 133
449 3300028381 Ga0268264_10000006 Ga0268264_10000006135 133
450 3300031235 Ga0265330_10069731 Ga0265330_100697312 133
451 3300031250 Ga0265331_10270367 Ga0265331_102703672 133
452 3300031344 Ga0265316_10174821 Ga0265316_101748212 133
453 3300031711 Ga0265314_10044808 Ga0265314_100448085 133
454 3300031727 Ga0316576_10446965 Ga0316576_104469652 133
455 3300032168 Ga0316593_10071654 Ga0316593_100716542 133
456 3300035085 Ga0373929_0000003 Ga0373929_0000003_480445_480855 133
457 3300036647 Ga0316582_0192665 Ga0316582_0192665_802_1215 133
458 3300037471 Ga0395905_0006143 Ga0395905_0006143_5297_5713 133
459 3300038735 Ga0400485_19185 Ga0400485_19185_7787_8200 133
460 3300038741 Ga0400488_02322 Ga0400488_02322_144_557 133
461 3300038741 Ga0400488_37091 Ga0400488_37091_963_1376 133
462 3300038742 Ga0400486_05408 Ga0400486_05408_8793_9206 133
463 3300039110 Ga0400487_20668 Ga0400487_20668_585_998 133
464 3300039110 Ga0400487_39606 Ga0400487_39606_1552_1965 133
465 3300039438 Ga0436360_0819037 Ga0436360_0819037_680_1081 133
466 3300042008 Ga0439450_050403 Ga0439450_050403_46_447 133
467 3300044712 Ga0453684_0105372 Ga0453684_0105372_2468_2899 133
468 3300047472 Ga0495686_0015022 Ga0495686_0015022_3882_4298 133
469 3300047472 Ga0495686_0128651 Ga0495686_0128651_713_1135 133
470 3300049571 Ga0501034_0591195 Ga0501034_0591195_118_528 133
471 3300050507 nmdc:mga05p37_13467_c1 nmdc:mga05p37_13467_c1_4192_4593 133
472 3300050508 nmdc:mga09592_11147_c1 nmdc:mga09592_11147_c1_2700_3101 133
473 3300050509 nmdc:mga0qj67_41257_c1 nmdc:mga0qj67_41257_c1_1951_2352 133
474 3300050510 nmdc:mga06r32_12237_c1 nmdc:mga06r32_12237_c1_4177_4578 133
475 3300050511 nmdc:mga08y16_9962_c1 nmdc:mga08y16_9962_c1_5362_5763 133
476 3300053108 Ga0500562_010685 Ga0500562_010685_1076_1492 133
477 3300053156 Ga0500622_0043256 Ga0500622_0043256_1149_1565 133
478 3300053162 Ga0500638_119199 Ga0500638_119199_440_844 133
479 3300053177 Ga0500636_0013677 Ga0500636_0013677_983_1387 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

26

147

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9465 1 131
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.939 1 131
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9374 2 131
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9371 1 131
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.9339 1 131
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9465 1 131 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9316 1 131 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9004 2 131 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8803 2 133 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8746 3 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A259RWL1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.001 2 133 GO:0000287
GO:0004540
GO:0090729
AF-A0A3S2GHS1-F1-model_v4 deleted 1 2 133
AF-I3U762-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1 2 132 GO:0000287
GO:0004540
GO:0090729
AF-A1WV59-F1-model_v4 PilT protein-like protein 1 41 131 GO:0004518
GO:0046872
AF-I3TX34-F1-model_v4 PilT protein domain protein 0.9998 35 133 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map