F451897

General Info

Members Datasets Scaffolds Average Seq Length
478 204 956 196

Family's Representative Sequence

Representative Sequence 3300029277|Ga0311001_1097356|Ga0311001_10973561
Length 221
Sequence MGLFNRKSTAPTAAPTNAAPASGSVATLEAPVFDAGTSAVADITGEYVLDVTHTRIGFSARHAMVTTVRGQFNDFEAKATIDTANPAASSAEIRIKAASIDTGNEDRDGHLRSGDFLDVDTYSDLVFKTTAVSRKDADTFTVIGDLTIKDVTRPVSIDFDVTGSARDPFGNLRVGFEGSTTINRKDWNLTWNAALETGGVLVSDKIKLEFDVSAIAVAQQS

Samples

Sample ID Description Type Environment
1 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002864 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300013064 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
178 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
179 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2643221615 Nocardioides sp. Root224 Isolate Unclassified
203 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
204 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 43.1
Metatranscriptomes 56.28
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0
Rhizoplane 6.49
Rhizosphere 84.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0311001_1097356 3300029277 Bacteria 1179
2 LJQas_1016009 3300000549 Bacteria 876
3 Ga0006764J43180_105673 3300002864 Bacteria 659
4 Ga0006778J45830_1006219 3300003162 Bacteria 702
5 Ga0006778J45830_1042184 3300003162 Bacteria 600
6 Ga0006778J45830_1053133 3300003162 Bacteria 645
7 Ga0006778J45830_1072903 3300003162 Bacteria 686
8 Ga0006778J45830_1107529 3300003162 Bacteria 629
9 Ga0006759J45824_1011432 3300003163 Bacteria 688
10 Ga0006759J45824_1014015 3300003163 Bacteria 654
11 Ga0006759J45824_1030876 3300003163 Bacteria 641
12 Ga0006758J48902_1013371 3300003300 Bacteria 641
13 Ga0006770J48903_1026574 3300003305 Bacteria 683
14 Ga0006770J48903_1033943 3300003305 Bacteria 618
15 Ga0006770J48903_1037564 3300003305 Bacteria 1234
16 Ga0007417J51691_1019031 3300003544 Bacteria 680
17 Ga0007417J51691_1021298 3300003544 Bacteria 645
18 Ga0007417J51691_1060783 3300003544 Bacteria 723
19 Ga0007427J51700_104712 3300003559 Bacteria 682
20 Ga0007427J51700_109096 3300003559 Bacteria 628
21 Ga0007410J51695_1006882 3300003574 Bacteria 858
22 Ga0007410J51695_1014043 3300003574 Bacteria 810
23 Ga0007410J51695_1027330 3300003574 Bacteria 664
24 Ga0007410J51695_1055861 3300003574 Bacteria 645
25 Ga0007409J51694_1008142 3300003575 Bacteria 745
26 Ga0007409J51694_1027119 3300003575 Bacteria 626
27 Ga0007409J51694_1047609 3300003575 Bacteria 606
28 Ga0007409J51694_1053823 3300003575 Bacteria 673
29 Ga0007416J51690_1027179 3300003577 Bacteria 1523
30 Ga0007416J51690_1036269 3300003577 Bacteria 650
31 Ga0007429J51699_1042717 3300003579 Bacteria 600
32 Ga0007429J51699_1088340 3300003579 Bacteria 649
33 Ga0007429J51699_1097795 3300003579 Bacteria 687
34 Ga0007411J51799_104805 3300003611 Bacteria 667
35 Ga0007411J51799_106089 3300003611 Bacteria 699
36 Ga0007411J51799_114330 3300003611 Bacteria 634
37 Ga0007415J51800_109614 3300003613 Bacteria 659
38 Ga0032354_1006296 3300003693 Bacteria 1292
39 Ga0032354_1007757 3300003693 Bacteria 643
40 Ga0032354_1015825 3300003693 Bacteria 806
41 Ga0032354_1016360 3300003693 Bacteria 1022
42 Ga0032354_1026881 3300003693 Bacteria 638
43 Ga0032354_1028491 3300003693 Bacteria 708
44 Ga0032354_1032354 3300003693 Bacteria 664
45 Ga0032354_1040093 3300003693 Bacteria 638
46 Ga0032354_1043208 3300003693 Bacteria 687
47 Ga0058859_10065857 3300004798 Bacteria 673
48 Ga0058863_11870264 3300004799 Bacteria 732
49 Ga0058863_11935303 3300004799 Bacteria 1070
50 Ga0058861_11987715 3300004800 Bacteria 1112
51 Ga0058860_10007460 3300004801 Bacteria 1192
52 Ga0058862_12557159 3300004803 Bacteria 1023
53 Ga0070658_10026924 3300005327 Bacteria 4616
54 Ga0070658_10439633 3300005327 Bacteria 1123
55 Ga0070683_100228284 3300005329 Bacteria 1770
56 Ga0070677_10272086 3300005333 Bacteria 850
57 Ga0070682_100082601 3300005337 Bacteria 2083
58 Ga0068868_100430641 3300005338 Bacteria 1144
59 Ga0070660_100348634 3300005339 Bacteria 1219
60 Ga0070660_100732437 3300005339 Bacteria 830
61 Ga0070661_100264229 3300005344 Bacteria 1331
62 Ga0070668_100546550 3300005347 Bacteria 1008
63 Ga0070675_100108014 3300005354 Bacteria 2350
64 Ga0070667_100908585 3300005367 Bacteria 820
65 Ga0070678_100226529 3300005456 Bacteria 1556
66 Ga0070685_10173843 3300005466 Bacteria 1382
67 Ga0070684_100032928 3300005535 Bacteria 4422
68 Ga0068864_100511954 3300005618 Bacteria 1156
69 Ga0068861_100094236 3300005719 Bacteria 2369
70 Ga0068861_100154659 3300005719 Bacteria 1885
71 Ga0068851_10103594 3300005834 Bacteria 1512
72 Ga0068870_10237741 3300005840 Bacteria 1123
73 Ga0075365_10015184 3300006038 Bacteria 4652
74 Ga0075365_10018912 3300006038 Bacteria 4243
75 Ga0075365_10024425 3300006038 Bacteria 3813
76 Ga0075365_10034090 3300006038 Bacteria 3286
77 Ga0075365_10047520 3300006038 Bacteria 2821
78 Ga0075365_10189152 3300006038 Bacteria 1440
79 Ga0075365_10396866 3300006038 Bacteria 973
80 Ga0075365_10450858 3300006038 Bacteria 908
81 Ga0075368_10038893 3300006042 Bacteria 1863
82 Ga0075363_100021580 3300006048 Bacteria 3246
83 Ga0075363_100372850 3300006048 Bacteria 836
84 Ga0075364_10013393 3300006051 Bacteria 5039
85 Ga0075364_10179873 3300006051 Bacteria 1431
86 Ga0075367_10047806 3300006178 Bacteria 2518
87 Ga0075370_10040379 3300006353 Bacteria 2631
88 Ga0105245_10217636 3300009098 Bacteria 1841
89 Ga0105245_10324558 3300009098 Bacteria 1517
90 Ga0105248_11938644 3300009177 Bacteria 669
91 Ga0105238_10575610 3300009551 Bacteria 1132
92 Ga0105249_10181326 3300009553 Bacteria 2049
93 Ga0105246_10177132 3300011119 Bacteria 1638
94 Ga0154019_117277 3300013044 Bacteria 635
95 Ga0154013_103734 3300013064 Bacteria 709
96 Ga0157375_10041067 3300013308 Bacteria 4464
97 Ga0157375_10184849 3300013308 Bacteria 2237
98 Ga0157375_10197110 3300013308 Bacteria 2169
99 Ga0157375_10228734 3300013308 Bacteria 2018
100 Ga0163163_10289085 3300014325 Bacteria 1691
101 Ga0157380_10386179 3300014326 Bacteria 1323
102 Ga0157379_10350521 3300014968 Bacteria 1351
103 Ga0163161_10020696 3300017792 Bacteria 4620
104 Ga0163161_10279494 3300017792 Bacteria 1309
105 Ga0197907_10389699 3300020069 Bacteria 1232
106 Ga0197907_10849451 3300020069 Bacteria 712
107 Ga0206356_10483060 3300020070 Bacteria 742
108 Ga0206356_10886302 3300020070 Bacteria 777
109 Ga0206349_1034388 3300020075 Bacteria 662
110 Ga0206349_1051340 3300020075 Bacteria 686
111 Ga0206349_1417077 3300020075 Bacteria 646
112 Ga0206349_1607748 3300020075 Bacteria 665
113 Ga0206349_1840403 3300020075 Bacteria 1009
114 Ga0206355_1181898 3300020076 Bacteria 634
115 Ga0206355_1356884 3300020076 Bacteria 1235
116 Ga0206355_1384815 3300020076 Bacteria 662
117 Ga0206355_1472869 3300020076 Bacteria 598
118 Ga0206351_10005058 3300020077 Bacteria 649
119 Ga0206351_10403912 3300020077 Bacteria 642
120 Ga0206352_10415710 3300020078 Bacteria 660
121 Ga0206352_10454457 3300020078 Bacteria 1471
122 Ga0206352_10475952 3300020078 Bacteria 1125
123 Ga0206352_11267199 3300020078 Bacteria 617
124 Ga0206350_10253833 3300020080 Bacteria 1335
125 Ga0206350_10276245 3300020080 Bacteria 634
126 Ga0206350_10960586 3300020080 Bacteria 1428
127 Ga0206350_11168178 3300020080 Bacteria 842
128 Ga0206350_11248833 3300020080 Bacteria 958
129 Ga0206350_11341067 3300020080 Bacteria 933
130 Ga0206350_11397137 3300020080 Bacteria 643
131 Ga0206354_10154204 3300020081 Bacteria 636
132 Ga0206354_10657086 3300020081 Bacteria 937
133 Ga0206354_11301014 3300020081 Bacteria 753
134 Ga0154015_1059883 3300020610 Bacteria 1324
135 Ga0154015_1442079 3300020610 Bacteria 616
136 Ga0224712_10490498 3300022467 Bacteria 593
137 Ga0207656_10160076 3300025321 Bacteria 1071
138 Ga0207705_10002870 3300025909 Bacteria 13189
139 Ga0207654_10631386 3300025911 Bacteria 766
140 Ga0207707_10067987 3300025912 Bacteria 3104
141 Ga0207657_10689981 3300025919 Bacteria 793
142 Ga0207687_11217084 3300025927 Bacteria 647
143 Ga0207661_10336386 3300025944 Bacteria 1360
144 Ga0207668_10452754 3300025972 Bacteria 1096
145 Ga0207658_10482539 3300025986 Bacteria 1102
146 Ga0207677_10449604 3300026023 Bacteria 1104
147 Ga0207639_10939835 3300026041 Bacteria 809
148 Ga0207678_10142668 3300026067 Bacteria 2044
149 Ga0207675_100188504 3300026118 Bacteria 1977
150 Ga0207683_10168777 3300026121 Bacteria 1981
151 Ga0209813_10120501 3300027866 Bacteria 913
152 Ga0268266_10073973 3300028379 Bacteria 2958
153 Ga0307405_10214420 3300031731 Bacteria 1408
154 Ga0307405_10449705 3300031731 Bacteria 1021
155 Ga0307405_10670051 3300031731 Bacteria 855
156 Ga0307413_10524866 3300031824 Bacteria 955
157 Ga0307413_10847464 3300031824 Bacteria 772
158 Ga0307410_10074807 3300031852 Bacteria 2360
159 Ga0307406_10066136 3300031901 Bacteria 2352
160 Ga0307406_10079826 3300031901 Bacteria 2171
161 Ga0307406_10319703 3300031901 Bacteria 1200
162 Ga0307406_11025337 3300031901 Bacteria 709
163 Ga0307407_10015471 3300031903 Bacteria 3773
164 Ga0307407_10273864 3300031903 Bacteria 1166
165 Ga0307409_100095278 3300031995 Bacteria 2452
166 Ga0307409_100607233 3300031995 Bacteria 1082
167 Ga0307409_100859804 3300031995 Bacteria 918
168 Ga0307416_100008939 3300032002 Bacteria 6513
169 Ga0307416_100057009 3300032002 Bacteria 3157
170 Ga0307411_10075586 3300032005 Bacteria 2300
171 Ga0307415_100000287 3300032126 Bacteria 21838
172 Ga0307415_100117698 3300032126 Bacteria 1985
173 Ga0395900_0345754 3300037418 Bacteria 1462
174 Ga0395900_1125448 3300037418 Bacteria 702
175 Ga0395905_0062910 3300037471 Bacteria 3471
176 Ga0395905_0384327 3300037471 Bacteria 1298
177 Ga0436364_0019825 3300037853 Bacteria 982
178 Ga0395901_0257448 3300038443 Bacteria 1817
179 Ga0395901_1489773 3300038443 Bacteria 633
180 Ga0395901_1588743 3300038443 Bacteria 608
181 Ga0451833_0535111 3300041491 Bacteria 954
182 Ga0451849_1547769 3300041505 Bacteria 820
183 Ga0466972_0087977 3300044658 Bacteria 1475
184 Ga0466972_0241577 3300044658 Bacteria 845
185 Ga0466966_0641855 3300044684 Bacteria 639
186 Ga0466963_0018670 3300044694 Bacteria 4340
187 Ga0466963_0146392 3300044694 Bacteria 1639
188 Ga0466964_0017357 3300044706 Bacteria 2754
189 Ga0466964_0156324 3300044706 Bacteria 1062
190 Ga0466970_0165391 3300044765 Bacteria 1224
191 Ga0466970_0291984 3300044765 Bacteria 918
192 Ga0466970_0462020 3300044765 Bacteria 728
193 Ga0466970_0555216 3300044765 Bacteria 664
194 Ga0466957_0092260 3300044842 Bacteria 1899
195 Ga0466957_0128536 3300044842 Bacteria 1621
196 Ga0466957_0383514 3300044842 Bacteria 959
197 Ga0466960_0009506 3300044901 Bacteria 4011
198 Ga0466960_0210752 3300044901 Bacteria 1065
199 Ga0466960_0492611 3300044901 Bacteria 717
200 Ga0466958_0138024 3300045836 Bacteria 1534
201 Ga0466967_0086892 3300045976 Bacteria 2834
202 Ga0466967_0101395 3300045976 Bacteria 2631
203 Ga0466967_0459334 3300045976 Bacteria 1245
204 Ga0466967_0557443 3300045976 Bacteria 1128
205 Ga0466967_0913730 3300045976 Bacteria 873
206 Ga0495582_0224636 3300046473 Bacteria 1075
207 Ga0495676_0645577 3300047321 Bacteria 687
208 Ga0496100_0105243 3300048903 Bacteria 1951
209 Ga0496101_0042528 3300048904 Bacteria 3243
210 Ga0496101_0673263 3300048904 Bacteria 817
211 Ga0496102_0008787 3300048905 Bacteria 8663
212 Ga0496103_0043843 3300048906 Bacteria 2755
213 Ga0496103_0482108 3300048906 Bacteria 794
214 Ga0496104_0010313 3300048907 Bacteria 8341
215 Ga0496104_0172597 3300048907 Bacteria 2073
216 Ga0496104_0700963 3300048907 Bacteria 920
217 Ga0496104_0765005 3300048907 Bacteria 872
218 Ga0496105_0064531 3300048908 Bacteria 3021
219 Ga0496105_0680768 3300048908 Bacteria 791
220 Ga0496106_0017302 3300048909 Bacteria 5336
221 Ga0496106_0410280 3300048909 Bacteria 1089
222 Ga0496107_0144305 3300048910 Bacteria 1760
223 Ga0496107_0187503 3300048910 Bacteria 1536
224 Ga0496108_0063073 3300048911 Bacteria 3120
225 Ga0496108_0427207 3300048911 Bacteria 1157
226 Ga0496109_0024691 3300048912 Bacteria 5347
227 Ga0496109_0058784 3300048912 Bacteria 3512
228 Ga0496110_0118077 3300048913 Bacteria 2388
229 Ga0496110_0334798 3300048913 Bacteria 1379
230 Ga0496110_0958306 3300048913 Bacteria 762
231 Ga0496111_0701512 3300048914 Bacteria 736
232 Ga0496111_0717525 3300048914 Bacteria 726
233 Ga0496112_0784798 3300048915 Bacteria 878
234 Ga0496113_0191690 3300048916 Bacteria 1622
235 Ga0496114_0017902 3300048917 Bacteria 5725
236 Ga0496114_0094040 3300048917 Bacteria 2549
237 Ga0496114_0761840 3300048917 Bacteria 846
238 Ga0496115_0011020 3300048918 Bacteria 6771
239 Ga0496124_0523640 3300048927 Bacteria 789
240 Ga0501306_010699 3300049127 Bacteria 1158
241 Ga0501306_012284 3300049127 Bacteria 1102
242 Ga0501306_015749 3300049127 Bacteria 1009
243 Ga0501306_040118 3300049127 Bacteria 724
244 Ga0501306_042290 3300049127 Bacteria 710
245 Ga0501306_047437 3300049127 Bacteria 681
246 Ga0501306_048142 3300049127 Bacteria 678
247 Ga0501306_048836 3300049127 Bacteria 674
248 Ga0501306_049981 3300049127 Bacteria 668
249 Ga0501306_055509 3300049127 Bacteria 644
250 Ga0501306_057360 3300049127 Bacteria 636
251 Ga0501308_011855 3300049128 Bacteria 988
252 Ga0501308_020660 3300049128 Bacteria 822
253 Ga0501308_028266 3300049128 Bacteria 740
254 Ga0501308_037457 3300049128 Bacteria 672
255 Ga0501308_043449 3300049128 Bacteria 639
256 Ga0501309_010345 3300049129 Bacteria 1201
257 Ga0501309_014256 3300049129 Bacteria 1065
258 Ga0501309_016703 3300049129 Bacteria 1003
259 Ga0501309_025126 3300049129 Bacteria 855
260 Ga0501309_045204 3300049129 Bacteria 681
261 Ga0501310_014716 3300049130 Bacteria 921
262 Ga0501310_017801 3300049130 Bacteria 862
263 Ga0501310_022112 3300049130 Bacteria 800
264 Ga0501310_037554 3300049130 Bacteria 664
265 Ga0501310_038752 3300049130 Bacteria 657
266 Ga0501310_048730 3300049130 Bacteria 608
267 Ga0501304_010901 3300049160 Bacteria 800
268 Ga0501304_016609 3300049160 Bacteria 698
269 Ga0501304_018611 3300049160 Bacteria 672
270 Ga0501305_007054 3300049161 Bacteria 1413
271 Ga0501305_009084 3300049161 Bacteria 1299
272 Ga0501305_014198 3300049161 Bacteria 1112
273 Ga0501305_039841 3300049161 Bacteria 761
274 Ga0501305_041393 3300049161 Bacteria 750
275 Ga0501305_060883 3300049161 Bacteria 649
276 Ga0501307_007988 3300049162 Bacteria 1179
277 Ga0501307_008954 3300049162 Bacteria 1136
278 Ga0501307_012072 3300049162 Bacteria 1023
279 Ga0501307_021366 3300049162 Bacteria 844
280 Ga0501307_036293 3300049162 Bacteria 702
281 Ga0501307_037791 3300049162 Bacteria 692
282 Ga0501307_038148 3300049162 Bacteria 690
283 Ga0501307_042306 3300049162 Bacteria 665
284 Ga0501307_042944 3300049162 Bacteria 661
285 Ga0501307_046053 3300049162 Bacteria 645
286 Ga0501307_057707 3300049162 Bacteria 596
287 Ga0501311_008420 3300049527 Bacteria 1208
288 Ga0501311_015687 3300049527 Bacteria 980
289 Ga0501311_024951 3300049527 Bacteria 835
290 Ga0501311_041167 3300049527 Bacteria 701
291 Ga0501311_042752 3300049527 Bacteria 691
292 Ga0501311_048894 3300049527 Bacteria 659
293 Ga0501312_017372 3300049528 Bacteria 1038
294 Ga0501312_017677 3300049528 Bacteria 1032
295 Ga0501312_030873 3300049528 Bacteria 840
296 Ga0501312_043436 3300049528 Bacteria 740
297 Ga0501312_044067 3300049528 Bacteria 736
298 Ga0501312_047499 3300049528 Bacteria 716
299 Ga0501312_051974 3300049528 Bacteria 693
300 Ga0501312_060350 3300049528 Bacteria 656
301 Ga0501312_069028 3300049528 Bacteria 624
302 Ga0501313_006532 3300049529 Bacteria 1265
303 Ga0501313_010324 3300049529 Bacteria 1062
304 Ga0501313_014223 3300049529 Bacteria 940
305 Ga0501313_014286 3300049529 Bacteria 939
306 Ga0501313_017586 3300049529 Bacteria 865
307 Ga0501313_021405 3300049529 Bacteria 801
308 Ga0501313_025515 3300049529 Bacteria 748
309 Ga0501313_026880 3300049529 Bacteria 734
310 Ga0501313_032733 3300049529 Bacteria 678
311 Ga0501313_034985 3300049529 Bacteria 661
312 Ga0501314_005601 3300049530 Bacteria 1075
313 Ga0501314_006863 3300049530 Bacteria 1001
314 Ga0501314_007129 3300049530 Bacteria 987
315 Ga0501314_008358 3300049530 Bacteria 934
316 Ga0501314_008420 3300049530 Bacteria 932
317 Ga0501314_019033 3300049530 Bacteria 702
318 Ga0501315_006751 3300049531 Bacteria 1288
319 Ga0501315_011905 3300049531 Bacteria 1069
320 Ga0501315_018932 3300049531 Bacteria 912
321 Ga0501315_022271 3300049531 Bacteria 863
322 Ga0501315_024905 3300049531 Bacteria 830
323 Ga0501315_029859 3300049531 Bacteria 780
324 Ga0501315_032185 3300049531 Bacteria 761
325 Ga0501315_039113 3300049531 Bacteria 712
326 Ga0501315_041578 3300049531 Bacteria 697
327 Ga0501315_045772 3300049531 Bacteria 675
328 Ga0501315_048607 3300049531 Bacteria 661
329 Ga0501316_003057 3300049532 Bacteria 1597
330 Ga0501316_006881 3300049532 Bacteria 1222
331 Ga0501316_008114 3300049532 Bacteria 1153
332 Ga0501316_021621 3300049532 Bacteria 815
333 Ga0501316_023291 3300049532 Bacteria 794
334 Ga0501316_025637 3300049532 Bacteria 768
335 Ga0501316_027838 3300049532 Bacteria 745
336 Ga0501317_004114 3300049533 Bacteria 1495
337 Ga0501317_013174 3300049533 Bacteria 1030
338 Ga0501317_014136 3300049533 Bacteria 1008
339 Ga0501317_032310 3300049533 Bacteria 766
340 Ga0501317_032418 3300049533 Bacteria 765
341 Ga0501317_042960 3300049533 Bacteria 696
342 Ga0501317_054867 3300049533 Bacteria 641
343 Ga0501318_001862 3300049534 Bacteria 1742
344 Ga0501318_002117 3300049534 Bacteria 1677
345 Ga0501318_004963 3300049534 Bacteria 1300
346 Ga0501318_005369 3300049534 Bacteria 1269
347 Ga0501318_010281 3300049534 Bacteria 1036
348 Ga0501318_011367 3300049534 Bacteria 1005
349 Ga0501318_014061 3300049534 Bacteria 939
350 Ga0501318_024168 3300049534 Bacteria 789
351 Ga0501318_028476 3300049534 Bacteria 748
352 Ga0501318_040595 3300049534 Bacteria 664
353 Ga0501318_047714 3300049534 Bacteria 629
354 Ga0501318_056510 3300049534 Bacteria 594
355 Ga0501319_008105 3300049535 Bacteria 803
356 Ga0501319_013931 3300049535 Bacteria 671
357 Ga0501320_007473 3300049536 Bacteria 1053
358 Ga0501320_018548 3300049536 Bacteria 787
359 Ga0501320_021613 3300049536 Bacteria 748
360 Ga0501320_033389 3300049536 Bacteria 649
361 Ga0501321_004054 3300049537 Bacteria 1380
362 Ga0501321_008538 3300049537 Bacteria 1089
363 Ga0501321_009157 3300049537 Bacteria 1064
364 Ga0501321_009948 3300049537 Bacteria 1036
365 Ga0501321_010002 3300049537 Bacteria 1034
366 Ga0501321_014653 3300049537 Bacteria 915
367 Ga0501321_031212 3300049537 Bacteria 713
368 Ga0501321_033799 3300049537 Bacteria 694
369 Ga0501321_035064 3300049537 Bacteria 686
370 Ga0501321_044000 3300049537 Bacteria 636
371 Ga0501322_001744 3300049538 Bacteria 1263
372 Ga0501322_003826 3300049538 Bacteria 990
373 Ga0501322_006458 3300049538 Bacteria 835
374 Ga0501322_007492 3300049538 Bacteria 796
375 Ga0501322_009198 3300049538 Bacteria 745
376 Ga0501322_011055 3300049538 Bacteria 702
377 Ga0501323_014540 3300049539 Bacteria 985
378 Ga0501323_017475 3300049539 Bacteria 922
379 Ga0501323_022072 3300049539 Bacteria 845
380 Ga0501323_028509 3300049539 Bacteria 773
381 Ga0501323_039395 3300049539 Bacteria 688
382 Ga0501323_040713 3300049539 Bacteria 681
383 Ga0501324_003949 3300049540 Bacteria 1160
384 Ga0501324_014560 3300049540 Bacteria 755
385 Ga0501324_019569 3300049540 Bacteria 684
386 Ga0501324_019778 3300049540 Bacteria 682
387 Ga0501325_011179 3300049541 Bacteria 826
388 Ga0501325_013443 3300049541 Bacteria 784
389 Ga0501325_018411 3300049541 Bacteria 715
390 Ga0501325_018554 3300049541 Bacteria 714
391 Ga0501325_018797 3300049541 Bacteria 711
392 Ga0501325_031563 3300049541 Bacteria 609
393 Ga0501330_005320 3300049546 Bacteria 818
394 Ga0501332_06256 3300049548 Bacteria 742
395 Ga0501333_003735 3300049549 Bacteria 939
396 Ga0501340_007310 3300049556 Bacteria 759
397 Ga0501340_011859 3300049556 Bacteria 654
398 Ga0501031_0079409 3300049568 Bacteria 2138
399 Ga0501032_0025317 3300049569 Bacteria 4091
400 Ga0501032_0037868 3300049569 Bacteria 3287
401 Ga0501033_0003068 3300049570 Bacteria 13881
402 Ga0501034_0047700 3300049571 Bacteria 4324
403 Ga0501034_0377098 3300049571 Bacteria 1344
404 Ga0501036_0040923 3300049572 Bacteria 3921
405 Ga0501036_0047389 3300049572 Bacteria 3640
406 Ga0501037_0020849 3300049573 Bacteria 4839
407 Ga0501037_0028730 3300049573 Bacteria 4108
408 Ga0501038_0036936 3300049574 Bacteria 4286
409 Ga0501038_0085638 3300049574 Bacteria 2649
410 Ga0501039_0238341 3300049575 Bacteria 1430
411 Ga0501043_0020188 3300049579 Bacteria 5231
412 Ga0501046_0006726 3300049580 Bacteria 10153
413 Ga0501046_0040862 3300049580 Bacteria 3703
414 Ga0501047_0076080 3300049581 Bacteria 3230
415 Ga0501048_0006126 3300049582 Bacteria 9167
416 Ga0501048_0851266 3300049582 Bacteria 655
417 Ga0501067_0003721 3300049583 Bacteria 8404
418 Ga0501067_0028045 3300049583 Bacteria 3120
419 Ga0501068_0044353 3300049584 Bacteria 2678
420 Ga0501068_0395401 3300049584 Bacteria 891
421 Ga0501069_0091778 3300049585 Bacteria 1718
422 Ga0501073_0089798 3300049589 Bacteria 2136
423 Ga0501073_0425832 3300049589 Bacteria 917
424 Ga0501080_0053887 3300049742 Bacteria 3746
425 Ga0501035_0005955 3300049822 Bacteria 11480
426 Ga0501035_0075004 3300049822 Bacteria 2991
427 Ga0501044_0010012 3300049823 Bacteria 10299
428 nmdc:mga00v17_152416_c1 3300050491 Bacteria 1485
429 nmdc:mga0yw44_132040_c1 3300050492 Bacteria 1617
430 nmdc:mga0yw44_138615_c1 3300050492 Bacteria 1580
431 nmdc:mga0yw44_159099_c1 3300050492 Bacteria 1478
432 nmdc:mga0yw44_17797_c1 3300050492 Bacteria 3877
433 nmdc:mga0yw44_185993_c1 3300050492 Bacteria 1369
434 nmdc:mga0yw44_394904_c1 3300050492 Bacteria 935
435 nmdc:mga0yw44_49473_c1 3300050492 Bacteria 2537
436 nmdc:mga0yw44_52022_c1 3300050492 Bacteria 2482
437 nmdc:mga0yw44_69641_c1 3300050492 Bacteria 2180
438 nmdc:mga06z11_247121_c1 3300050494 Bacteria 1050
439 nmdc:mga04h51_57261_c1 3300050495 Bacteria 1326
440 nmdc:mga07m45_147805_c1 3300050496 Bacteria 1362
441 nmdc:mga07m45_45912_c1 3300050496 Bacteria 2453
442 nmdc:mga07m45_96104_c1 3300050496 Bacteria 1700
443 nmdc:mga08y16_387166_c1 3300050511 Bacteria 1432
444 Ga0500554_182267 3300053102 Bacteria 706
445 Ga0500593_000054 3300053117 Bacteria 41842
446 Ga0587084_044899 3300059477 Bacteria 764
447 Ga0587077_111438 3300059493 Bacteria 671
448 Ga0587080_093991 3300059503 Bacteria 633
449 Ga0587086_052808 3300059507 Bacteria 659
450 Ga0587088_072725 3300059508 Bacteria 720
451 Ga0587088_107185 3300059508 Bacteria 631
452 Ga0587090_081903 3300059510 Bacteria 648
453 Ga0587092_067402 3300059512 Bacteria 682
454 Ga0587094_064958 3300059513 Bacteria 646
455 Ga0587094_068198 3300059513 Bacteria 636
456 Ga0587098_046661 3300059604 Bacteria 646
457 Ga0587106_064954 3300059605 Bacteria 679
458 Ga0587106_072949 3300059605 Bacteria 654
459 Ga0587099_032957 3300059622 Bacteria 637
460 Ga0587101_069196 3300059623 Bacteria 647
461 Ga0587101_078999 3300059623 Bacteria 620
462 Ga0587122_027937 3300059628 Bacteria 650
463 Ga0587069_084176 3300059642 Bacteria 626
464 Ga0587075_030949 3300059644 Bacteria 852
465 Ga0587076_103566 3300059645 Bacteria 639
466 Ga0587102_033258 3300059649 Bacteria 639
467 Ga0587114_051187 3300059655 Bacteria 700
468 Ga0587071_101504 3300060344 Bacteria 666
469 Ga0587071_105635 3300060344 Bacteria 657
470 Ga0587111_0064314 3300060346 Bacteria 842
471 Ga0587111_0120827 3300060346 Bacteria 674
472 Ga0501082_0292986 3300060353 Bacteria 1417
473 Ga0466962_0341364 3300061719 Bacteria 745
474 Ga0466962_0388098 3300061719 Bacteria 698
475 Ga0530510_0200574 3300061734 Bacteria 1482
476 2644092613 2643221615 Bacteria 5487866
477 2644322226 2643221657 Bacteria 5490246
478 2857484906 2857481737 Bacteria 4761446
479 Ga0311001_1097356
480 LJQas_1016009
481 Ga0006764J43180_105673
482 Ga0006778J45830_1006219
483 Ga0006778J45830_1042184
484 Ga0006778J45830_1053133
485 Ga0006778J45830_1072903
486 Ga0006778J45830_1107529
487 Ga0006759J45824_1011432
488 Ga0006759J45824_1014015
489 Ga0006759J45824_1030876
490 Ga0006758J48902_1013371
491 Ga0006770J48903_1026574
492 Ga0006770J48903_1033943
493 Ga0006770J48903_1037564
494 Ga0007417J51691_1019031
495 Ga0007417J51691_1021298
496 Ga0007417J51691_1060783
497 Ga0007427J51700_104712
498 Ga0007427J51700_109096
499 Ga0007410J51695_1006882
500 Ga0007410J51695_1014043
501 Ga0007410J51695_1027330
502 Ga0007410J51695_1055861
503 Ga0007409J51694_1008142
504 Ga0007409J51694_1027119
505 Ga0007409J51694_1047609
506 Ga0007409J51694_1053823
507 Ga0007416J51690_1027179
508 Ga0007416J51690_1036269
509 Ga0007429J51699_1042717
510 Ga0007429J51699_1088340
511 Ga0007429J51699_1097795
512 Ga0007411J51799_104805
513 Ga0007411J51799_106089
514 Ga0007411J51799_114330
515 Ga0007415J51800_109614
516 Ga0032354_1006296
517 Ga0032354_1007757
518 Ga0032354_1015825
519 Ga0032354_1016360
520 Ga0032354_1026881
521 Ga0032354_1028491
522 Ga0032354_1032354
523 Ga0032354_1040093
524 Ga0032354_1043208
525 Ga0058859_10065857
526 Ga0058863_11870264
527 Ga0058863_11935303
528 Ga0058861_11987715
529 Ga0058860_10007460
530 Ga0058862_12557159
531 Ga0070658_10026924
532 Ga0070658_10439633
533 Ga0070683_100228284
534 Ga0070677_10272086
535 Ga0070682_100082601
536 Ga0068868_100430641
537 Ga0070660_100348634
538 Ga0070660_100732437
539 Ga0070661_100264229
540 Ga0070668_100546550
541 Ga0070675_100108014
542 Ga0070667_100908585
543 Ga0070678_100226529
544 Ga0070685_10173843
545 Ga0070684_100032928
546 Ga0068864_100511954
547 Ga0068861_100094236
548 Ga0068861_100154659
549 Ga0068851_10103594
550 Ga0068870_10237741
551 Ga0075365_10015184
552 Ga0075365_10018912
553 Ga0075365_10024425
554 Ga0075365_10034090
555 Ga0075365_10047520
556 Ga0075365_10189152
557 Ga0075365_10396866
558 Ga0075365_10450858
559 Ga0075368_10038893
560 Ga0075363_100021580
561 Ga0075363_100372850
562 Ga0075364_10013393
563 Ga0075364_10179873
564 Ga0075367_10047806
565 Ga0075370_10040379
566 Ga0105245_10217636
567 Ga0105245_10324558
568 Ga0105248_11938644
569 Ga0105238_10575610
570 Ga0105249_10181326
571 Ga0105246_10177132
572 Ga0154019_117277
573 Ga0154013_103734
574 Ga0157375_10041067
575 Ga0157375_10184849
576 Ga0157375_10197110
577 Ga0157375_10228734
578 Ga0163163_10289085
579 Ga0157380_10386179
580 Ga0157379_10350521
581 Ga0163161_10020696
582 Ga0163161_10279494
583 Ga0197907_10389699
584 Ga0197907_10849451
585 Ga0206356_10483060
586 Ga0206356_10886302
587 Ga0206349_1034388
588 Ga0206349_1051340
589 Ga0206349_1417077
590 Ga0206349_1607748
591 Ga0206349_1840403
592 Ga0206355_1181898
593 Ga0206355_1356884
594 Ga0206355_1384815
595 Ga0206355_1472869
596 Ga0206351_10005058
597 Ga0206351_10403912
598 Ga0206352_10415710
599 Ga0206352_10454457
600 Ga0206352_10475952
601 Ga0206352_11267199
602 Ga0206350_10253833
603 Ga0206350_10276245
604 Ga0206350_10960586
605 Ga0206350_11168178
606 Ga0206350_11248833
607 Ga0206350_11341067
608 Ga0206350_11397137
609 Ga0206354_10154204
610 Ga0206354_10657086
611 Ga0206354_11301014
612 Ga0154015_1059883
613 Ga0154015_1442079
614 Ga0224712_10490498
615 Ga0207656_10160076
616 Ga0207705_10002870
617 Ga0207654_10631386
618 Ga0207707_10067987
619 Ga0207657_10689981
620 Ga0207687_11217084
621 Ga0207661_10336386
622 Ga0207668_10452754
623 Ga0207658_10482539
624 Ga0207677_10449604
625 Ga0207639_10939835
626 Ga0207678_10142668
627 Ga0207675_100188504
628 Ga0207683_10168777
629 Ga0209813_10120501
630 Ga0268266_10073973
631 Ga0307405_10214420
632 Ga0307405_10449705
633 Ga0307405_10670051
634 Ga0307413_10524866
635 Ga0307413_10847464
636 Ga0307410_10074807
637 Ga0307406_10066136
638 Ga0307406_10079826
639 Ga0307406_10319703
640 Ga0307406_11025337
641 Ga0307407_10015471
642 Ga0307407_10273864
643 Ga0307409_100095278
644 Ga0307409_100607233
645 Ga0307409_100859804
646 Ga0307416_100008939
647 Ga0307416_100057009
648 Ga0307411_10075586
649 Ga0307415_100000287
650 Ga0307415_100117698
651 Ga0395900_0345754
652 Ga0395900_1125448
653 Ga0395905_0062910
654 Ga0395905_0384327
655 Ga0436364_0019825
656 Ga0395901_0257448
657 Ga0395901_1489773
658 Ga0395901_1588743
659 Ga0451833_0535111
660 Ga0451849_1547769
661 Ga0466972_0087977
662 Ga0466972_0241577
663 Ga0466966_0641855
664 Ga0466963_0018670
665 Ga0466963_0146392
666 Ga0466964_0017357
667 Ga0466964_0156324
668 Ga0466970_0165391
669 Ga0466970_0291984
670 Ga0466970_0462020
671 Ga0466970_0555216
672 Ga0466957_0092260
673 Ga0466957_0128536
674 Ga0466957_0383514
675 Ga0466960_0009506
676 Ga0466960_0210752
677 Ga0466960_0492611
678 Ga0466958_0138024
679 Ga0466967_0086892
680 Ga0466967_0101395
681 Ga0466967_0459334
682 Ga0466967_0557443
683 Ga0466967_0913730
684 Ga0495582_0224636
685 Ga0495676_0645577
686 Ga0496100_0105243
687 Ga0496101_0042528
688 Ga0496101_0673263
689 Ga0496102_0008787
690 Ga0496103_0043843
691 Ga0496103_0482108
692 Ga0496104_0010313
693 Ga0496104_0172597
694 Ga0496104_0700963
695 Ga0496104_0765005
696 Ga0496105_0064531
697 Ga0496105_0680768
698 Ga0496106_0017302
699 Ga0496106_0410280
700 Ga0496107_0144305
701 Ga0496107_0187503
702 Ga0496108_0063073
703 Ga0496108_0427207
704 Ga0496109_0024691
705 Ga0496109_0058784
706 Ga0496110_0118077
707 Ga0496110_0334798
708 Ga0496110_0958306
709 Ga0496111_0701512
710 Ga0496111_0717525
711 Ga0496112_0784798
712 Ga0496113_0191690
713 Ga0496114_0017902
714 Ga0496114_0094040
715 Ga0496114_0761840
716 Ga0496115_0011020
717 Ga0496124_0523640
718 Ga0501306_010699
719 Ga0501306_012284
720 Ga0501306_015749
721 Ga0501306_040118
722 Ga0501306_042290
723 Ga0501306_047437
724 Ga0501306_048142
725 Ga0501306_048836
726 Ga0501306_049981
727 Ga0501306_055509
728 Ga0501306_057360
729 Ga0501308_011855
730 Ga0501308_020660
731 Ga0501308_028266
732 Ga0501308_037457
733 Ga0501308_043449
734 Ga0501309_010345
735 Ga0501309_014256
736 Ga0501309_016703
737 Ga0501309_025126
738 Ga0501309_045204
739 Ga0501310_014716
740 Ga0501310_017801
741 Ga0501310_022112
742 Ga0501310_037554
743 Ga0501310_038752
744 Ga0501310_048730
745 Ga0501304_010901
746 Ga0501304_016609
747 Ga0501304_018611
748 Ga0501305_007054
749 Ga0501305_009084
750 Ga0501305_014198
751 Ga0501305_039841
752 Ga0501305_041393
753 Ga0501305_060883
754 Ga0501307_007988
755 Ga0501307_008954
756 Ga0501307_012072
757 Ga0501307_021366
758 Ga0501307_036293
759 Ga0501307_037791
760 Ga0501307_038148
761 Ga0501307_042306
762 Ga0501307_042944
763 Ga0501307_046053
764 Ga0501307_057707
765 Ga0501311_008420
766 Ga0501311_015687
767 Ga0501311_024951
768 Ga0501311_041167
769 Ga0501311_042752
770 Ga0501311_048894
771 Ga0501312_017372
772 Ga0501312_017677
773 Ga0501312_030873
774 Ga0501312_043436
775 Ga0501312_044067
776 Ga0501312_047499
777 Ga0501312_051974
778 Ga0501312_060350
779 Ga0501312_069028
780 Ga0501313_006532
781 Ga0501313_010324
782 Ga0501313_014223
783 Ga0501313_014286
784 Ga0501313_017586
785 Ga0501313_021405
786 Ga0501313_025515
787 Ga0501313_026880
788 Ga0501313_032733
789 Ga0501313_034985
790 Ga0501314_005601
791 Ga0501314_006863
792 Ga0501314_007129
793 Ga0501314_008358
794 Ga0501314_008420
795 Ga0501314_019033
796 Ga0501315_006751
797 Ga0501315_011905
798 Ga0501315_018932
799 Ga0501315_022271
800 Ga0501315_024905
801 Ga0501315_029859
802 Ga0501315_032185
803 Ga0501315_039113
804 Ga0501315_041578
805 Ga0501315_045772
806 Ga0501315_048607
807 Ga0501316_003057
808 Ga0501316_006881
809 Ga0501316_008114
810 Ga0501316_021621
811 Ga0501316_023291
812 Ga0501316_025637
813 Ga0501316_027838
814 Ga0501317_004114
815 Ga0501317_013174
816 Ga0501317_014136
817 Ga0501317_032310
818 Ga0501317_032418
819 Ga0501317_042960
820 Ga0501317_054867
821 Ga0501318_001862
822 Ga0501318_002117
823 Ga0501318_004963
824 Ga0501318_005369
825 Ga0501318_010281
826 Ga0501318_011367
827 Ga0501318_014061
828 Ga0501318_024168
829 Ga0501318_028476
830 Ga0501318_040595
831 Ga0501318_047714
832 Ga0501318_056510
833 Ga0501319_008105
834 Ga0501319_013931
835 Ga0501320_007473
836 Ga0501320_018548
837 Ga0501320_021613
838 Ga0501320_033389
839 Ga0501321_004054
840 Ga0501321_008538
841 Ga0501321_009157
842 Ga0501321_009948
843 Ga0501321_010002
844 Ga0501321_014653
845 Ga0501321_031212
846 Ga0501321_033799
847 Ga0501321_035064
848 Ga0501321_044000
849 Ga0501322_001744
850 Ga0501322_003826
851 Ga0501322_006458
852 Ga0501322_007492
853 Ga0501322_009198
854 Ga0501322_011055
855 Ga0501323_014540
856 Ga0501323_017475
857 Ga0501323_022072
858 Ga0501323_028509
859 Ga0501323_039395
860 Ga0501323_040713
861 Ga0501324_003949
862 Ga0501324_014560
863 Ga0501324_019569
864 Ga0501324_019778
865 Ga0501325_011179
866 Ga0501325_013443
867 Ga0501325_018411
868 Ga0501325_018554
869 Ga0501325_018797
870 Ga0501325_031563
871 Ga0501330_005320
872 Ga0501332_06256
873 Ga0501333_003735
874 Ga0501340_007310
875 Ga0501340_011859
876 Ga0501031_0079409
877 Ga0501032_0025317
878 Ga0501032_0037868
879 Ga0501033_0003068
880 Ga0501034_0047700
881 Ga0501034_0377098
882 Ga0501036_0040923
883 Ga0501036_0047389
884 Ga0501037_0020849
885 Ga0501037_0028730
886 Ga0501038_0036936
887 Ga0501038_0085638
888 Ga0501039_0238341
889 Ga0501043_0020188
890 Ga0501046_0006726
891 Ga0501046_0040862
892 Ga0501047_0076080
893 Ga0501048_0006126
894 Ga0501048_0851266
895 Ga0501067_0003721
896 Ga0501067_0028045
897 Ga0501068_0044353
898 Ga0501068_0395401
899 Ga0501069_0091778
900 Ga0501073_0089798
901 Ga0501073_0425832
902 Ga0501080_0053887
903 Ga0501035_0005955
904 Ga0501035_0075004
905 Ga0501044_0010012
906 nmdc:mga00v17_152416_c1
907 nmdc:mga0yw44_132040_c1
908 nmdc:mga0yw44_138615_c1
909 nmdc:mga0yw44_159099_c1
910 nmdc:mga0yw44_17797_c1
911 nmdc:mga0yw44_185993_c1
912 nmdc:mga0yw44_394904_c1
913 nmdc:mga0yw44_49473_c1
914 nmdc:mga0yw44_52022_c1
915 nmdc:mga0yw44_69641_c1
916 nmdc:mga06z11_247121_c1
917 nmdc:mga04h51_57261_c1
918 nmdc:mga07m45_147805_c1
919 nmdc:mga07m45_45912_c1
920 nmdc:mga07m45_96104_c1
921 nmdc:mga08y16_387166_c1
922 Ga0500554_182267
923 Ga0500593_000054
924 Ga0587084_044899
925 Ga0587077_111438
926 Ga0587080_093991
927 Ga0587086_052808
928 Ga0587088_072725
929 Ga0587088_107185
930 Ga0587090_081903
931 Ga0587092_067402
932 Ga0587094_064958
933 Ga0587094_068198
934 Ga0587098_046661
935 Ga0587106_064954
936 Ga0587106_072949
937 Ga0587099_032957
938 Ga0587101_069196
939 Ga0587101_078999
940 Ga0587122_027937
941 Ga0587069_084176
942 Ga0587075_030949
943 Ga0587076_103566
944 Ga0587102_033258
945 Ga0587114_051187
946 Ga0587071_101504
947 Ga0587071_105635
948 Ga0587111_0064314
949 Ga0587111_0120827
950 Ga0501082_0292986
951 Ga0466962_0341364
952 Ga0466962_0388098
953 Ga0530510_0200574
954 2644092613
955 2644322226
956 2857484906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

47

214

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9301 28 199
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9247 28 199
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9156 28 200
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9104 28 200
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9037 29 200
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9161 28 200 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9108 28 200 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9037 29 200 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8992 32 195 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8962 48 200 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A4Q6BXC7-F1-model_v4 Polyisoprenoid-binding protein 0.9547 28 154
AF-A0A7G7EUC5-F1-model_v4 deleted 0.9542 26 199
AF-A0A1M6EH66-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9506 26 200
AF-A0A4U3M1J7-F1-model_v4 YceI family protein 0.9495 27 196
AF-A0A7G7EUC5-F1-model_v4 deleted 0.9486 26 199

Map