F451323

General Info

Members Datasets Scaffolds Average Seq Length
475 158 950 123

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_101510557|Ga0068865_1015105571
Length 145
Sequence MSKFFRLAPPPGEPRPHGTLRFDVIAAWCWDLLEPYLTRNLLNRGVARPTRKQILEEFGRVWPEITATIGVQEPFAGTIRFKWLVRLASEEMAPFLDGPEAWIAARYGGGKFKMNLHHGLHFVNTKNFKPAGDPRWVAEPALELD

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 99.16
Stem 0
Stem Tuber 0
Unclassified 19.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_101510557 3300006881 Unclassified 602
2 Ga0065707_11047831 3300005295 Unclassified 527
3 Ga0070680_100098925 3300005336 Bacteria 2420
4 Ga0070680_100411650 3300005336 Bacteria 1153
5 Ga0070689_100165673 3300005340 Bacteria 1789
6 Ga0070692_10217563 3300005345 Unclassified 1127
7 Ga0070668_100212798 3300005347 Bacteria 1591
8 Ga0070669_100472885 3300005353 Unclassified 1036
9 Ga0070659_101429653 3300005366 Unclassified 615
10 Ga0070705_100808644 3300005440 Unclassified 746
11 Ga0070700_100447451 3300005441 Bacteria 982
12 Ga0070708_100003786 3300005445 Bacteria 11871
13 Ga0070708_100020484 3300005445 Bacteria 5576
14 Ga0070708_100181298 3300005445 Unclassified 1968
15 Ga0070708_100488773 3300005445 Bacteria 1161
16 Ga0070708_100489902 3300005445 Bacteria 1160
17 Ga0070708_100580558 3300005445 Bacteria 1057
18 Ga0070663_100720796 3300005455 Bacteria 849
19 Ga0070662_100181166 3300005457 Bacteria 1661
20 Ga0070662_101165282 3300005457 Bacteria 662
21 Ga0070681_10497503 3300005458 Unclassified 1132
22 Ga0068867_100117810 3300005459 Bacteria 2048
23 Ga0068867_100146795 3300005459 Bacteria 1849
24 Ga0068867_100658511 3300005459 Bacteria 920
25 Ga0070706_100112241 3300005467 Bacteria 2537
26 Ga0070707_100009148 3300005468 Bacteria 9188
27 Ga0070707_100091405 3300005468 Unclassified 2946
28 Ga0070707_100118384 3300005468 Bacteria 2571
29 Ga0070707_100793608 3300005468 Bacteria 911
30 Ga0070698_100022913 3300005471 Bacteria 6530
31 Ga0070698_101867600 3300005471 Unclassified 554
32 Ga0070699_100004242 3300005518 Bacteria 12673
33 Ga0070699_100030615 3300005518 Bacteria 4646
34 Ga0070699_100053460 3300005518 Bacteria 3495
35 Ga0070699_100119207 3300005518 Bacteria 2320
36 Ga0070699_100130914 3300005518 Unclassified 2211
37 Ga0070699_100319067 3300005518 Bacteria 1396
38 Ga0070697_100159801 3300005536 Unclassified 1903
39 Ga0070697_100503190 3300005536 Bacteria 1059
40 Ga0070697_100745256 3300005536 Bacteria 865
41 Ga0070697_100972736 3300005536 Unclassified 754
42 Ga0070672_100040719 3300005543 Bacteria 3567
43 Ga0070695_100168107 3300005545 Bacteria 1545
44 Ga0070695_100536464 3300005545 Bacteria 910
45 Ga0070695_100772647 3300005545 Bacteria 768
46 Ga0070695_100899050 3300005545 Unclassified 715
47 Ga0070696_100052583 3300005546 Bacteria 2834
48 Ga0070696_100835983 3300005546 Unclassified 760
49 Ga0070704_100273652 3300005549 Bacteria 1396
50 Ga0070704_100725808 3300005549 Bacteria 883
51 Ga0070702_100040602 3300005615 Bacteria 2604
52 Ga0068859_100179447 3300005617 Bacteria 2200
53 Ga0068866_10571662 3300005718 Bacteria 759
54 Ga0068861_100067918 3300005719 Bacteria 2753
55 Ga0068861_100872617 3300005719 Unclassified 850
56 Ga0068870_10375474 3300005840 Bacteria 919
57 Ga0068863_100146703 3300005841 Bacteria 2257
58 Ga0068858_100710816 3300005842 Bacteria 978
59 Ga0068860_100081412 3300005843 Bacteria 3079
60 Ga0068860_100862886 3300005843 Unclassified 920
61 Ga0068862_100052398 3300005844 Bacteria 3491
62 Ga0068862_100350976 3300005844 Archaea 1369
63 Ga0068862_100525950 3300005844 Unclassified 1126
64 Ga0068862_100597382 3300005844 Bacteria 1059
65 Ga0081539_10000005 3300005985 Bacteria 549026
66 Ga0075432_10028009 3300006058 Bacteria 1943
67 Ga0075428_100001426 3300006844 Bacteria 25474
68 Ga0075428_100001646 3300006844 Bacteria 23777
69 Ga0075428_100070391 3300006844 Bacteria 3824
70 Ga0075428_100184772 3300006844 Bacteria 2256
71 Ga0075428_100466020 3300006844 Bacteria 1353
72 Ga0075428_100677936 3300006844 Bacteria 1099
73 Ga0075428_100990309 3300006844 Unclassified 890
74 Ga0075428_101801954 3300006844 Bacteria 637
75 Ga0075430_100000068 3300006846 Bacteria 55821
76 Ga0075430_100001067 3300006846 Bacteria 21734
77 Ga0075430_100122738 3300006846 Bacteria 2166
78 Ga0075430_100269146 3300006846 Unclassified 1410
79 Ga0075430_100437217 3300006846 Bacteria 1080
80 Ga0075430_100629726 3300006846 Bacteria 885
81 Ga0075430_100917370 3300006846 Unclassified 722
82 Ga0075431_100000238 3300006847 Bacteria 41406
83 Ga0075431_100001186 3300006847 Bacteria 23511
84 Ga0075431_100001913 3300006847 Bacteria 19786
85 Ga0075431_100009868 3300006847 Bacteria 9587
86 Ga0075431_100018321 3300006847 Bacteria 7128
87 Ga0075431_100018791 3300006847 Bacteria 7041
88 Ga0075431_100028973 3300006847 Bacteria 5694
89 Ga0075431_100036911 3300006847 Bacteria 5034
90 Ga0075431_100120671 3300006847 Bacteria 2705
91 Ga0075431_100532949 3300006847 Bacteria 1163
92 Ga0075431_100863512 3300006847 Bacteria 876
93 Ga0075431_100922959 3300006847 Bacteria 842
94 Ga0075433_10000659 3300006852 Bacteria 23294
95 Ga0075433_10002564 3300006852 Bacteria 13833
96 Ga0075433_10072065 3300006852 Bacteria 3037
97 Ga0075433_10134873 3300006852 Bacteria 2194
98 Ga0075433_10171279 3300006852 Bacteria 1932
99 Ga0075433_10612038 3300006852 Bacteria 956
100 Ga0075433_10760229 3300006852 Bacteria 847
101 Ga0075434_100001544 3300006871 Bacteria 19489
102 Ga0075434_100027702 3300006871 Bacteria 5564
103 Ga0075434_100068788 3300006871 Bacteria 3528
104 Ga0075434_100072689 3300006871 Bacteria 3431
105 Ga0075434_100164811 3300006871 Bacteria 2236
106 Ga0075434_100542202 3300006871 Bacteria 1183
107 Ga0075434_100583207 3300006871 Bacteria 1137
108 Ga0075434_100677390 3300006871 Bacteria 1049
109 Ga0075434_101904295 3300006871 Bacteria 601
110 Ga0075434_101963603 3300006871 Unclassified 591
111 Ga0075429_100002287 3300006880 Bacteria 16068
112 Ga0075429_100005572 3300006880 Bacteria 10849
113 Ga0075429_100011747 3300006880 Bacteria 7595
114 Ga0075429_100015396 3300006880 Bacteria 6627
115 Ga0075429_100015625 3300006880 Bacteria 6578
116 Ga0075429_100065601 3300006880 Bacteria 3161
117 Ga0075429_100189778 3300006880 Unclassified 1800
118 Ga0075429_100566099 3300006880 Unclassified 996
119 Ga0075429_101263504 3300006880 Unclassified 644
120 Ga0068865_100057225 3300006881 Bacteria 2719
121 Ga0075436_100003846 3300006914 Bacteria 10293
122 Ga0075436_100167284 3300006914 Unclassified 1552
123 Ga0075436_100221004 3300006914 Unclassified 1344
124 Ga0075436_100690248 3300006914 Unclassified 756
125 Ga0097620_100179448 3300006931 Bacteria 2200
126 Ga0075435_100032641 3300007076 Bacteria 4113
127 Ga0075435_100042019 3300007076 Bacteria 3656
128 Ga0075435_100083043 3300007076 Bacteria 2634
129 Ga0075435_100310474 3300007076 Bacteria 1349
130 Ga0075435_100356317 3300007076 Bacteria 1254
131 Ga0075435_100920931 3300007076 Unclassified 762
132 Ga0099794_10000256 3300007265 Bacteria 18535
133 Ga0099794_10506569 3300007265 Bacteria 635
134 Ga0111539_10001624 3300009094 Bacteria 30047
135 Ga0111539_10002856 3300009094 Bacteria 22943
136 Ga0111539_10465969 3300009094 Bacteria 1471
137 Ga0114129_10000018 3300009147 Bacteria 125757
138 Ga0114129_10000536 3300009147 Bacteria 46547
139 Ga0114129_10001708 3300009147 Bacteria 29965
140 Ga0114129_10002375 3300009147 Bacteria 26134
141 Ga0114129_10025346 3300009147 Bacteria 8403
142 Ga0114129_10030019 3300009147 Bacteria 7697
143 Ga0114129_10035200 3300009147 Bacteria 7075
144 Ga0114129_10041969 3300009147 Bacteria 6441
145 Ga0114129_10095730 3300009147 Unclassified 4112
146 Ga0114129_10105726 3300009147 Bacteria 3889
147 Ga0114129_10116045 3300009147 Bacteria 3689
148 Ga0114129_10138232 3300009147 Bacteria 3342
149 Ga0114129_10282808 3300009147 Bacteria 2216
150 Ga0114129_10621785 3300009147 Bacteria 1397
151 Ga0114129_11035679 3300009147 Bacteria 1031
152 Ga0114129_11309178 3300009147 Unclassified 898
153 Ga0105243_10235982 3300009148 Bacteria 1625
154 Ga0105241_10070077 3300009174 Bacteria 2720
155 Ga0105242_11822219 3300009176 Unclassified 647
156 Ga0105242_12967770 3300009176 Unclassified 525
157 Ga0105249_10379993 3300009553 Archaea 1438
158 Ga0105249_10382537 3300009553 Bacteria 1434
159 Ga0105249_10570327 3300009553 Bacteria 1184
160 Ga0105246_11570235 3300011119 Bacteria 621
161 Ga0157378_10271079 3300013297 Unclassified 1632
162 Ga0163162_10159491 3300013306 Bacteria 2377
163 Ga0163162_11280471 3300013306 Unclassified 833
164 Ga0157375_10158936 3300013308 Bacteria 2401
165 Ga0157380_10165428 3300014326 Bacteria 1927
166 Ga0157380_10274035 3300014326 Bacteria 1540
167 Ga0163161_10762857 3300017792 Unclassified 810
168 Ga0207642_10381482 3300025899 Bacteria 839
169 Ga0207642_10561479 3300025899 Unclassified 706
170 Ga0207684_10003573 3300025910 Bacteria 15133
171 Ga0207684_10009370 3300025910 Bacteria 8651
172 Ga0207684_10016060 3300025910 Bacteria 6429
173 Ga0207684_10344996 3300025910 Bacteria 1282
174 Ga0207654_10030592 3300025911 Bacteria 2957
175 Ga0207660_10304314 3300025917 Unclassified 1270
176 Ga0207660_10339468 3300025917 Bacteria 1202
177 Ga0207662_10123042 3300025918 Bacteria 1628
178 Ga0207646_10002385 3300025922 Bacteria 22192
179 Ga0207646_10064552 3300025922 Bacteria 3268
180 Ga0207646_10261072 3300025922 Bacteria 1565
181 Ga0207706_10205611 3300025933 Bacteria 1726
182 Ga0207709_10028246 3300025935 Bacteria 3243
183 Ga0207709_11066745 3300025935 Unclassified 662
184 Ga0207704_10051119 3300025938 Bacteria 2497
185 Ga0207691_10064137 3300025940 Bacteria 3329
186 Ga0207712_10329670 3300025961 Bacteria 1262
187 Ga0207668_10234681 3300025972 Bacteria 1481
188 Ga0207708_10476524 3300026075 Bacteria 1043
189 Ga0207641_10077494 3300026088 Bacteria 2877
190 Ga0207648_10111392 3300026089 Bacteria 2403
191 Ga0207648_10429384 3300026089 Unclassified 1201
192 Ga0207675_100053315 3300026118 Bacteria 3774
193 Ga0207675_101155189 3300026118 Bacteria 794
194 Ga0207675_101675395 3300026118 Bacteria 656
195 Ga0209588_1039677 3300027671 Bacteria 1518
196 Ga0209998_10023217 3300027717 Bacteria 1340
197 Ga0209974_10024713 3300027876 Unclassified 1987
198 Ga0207428_10000340 3300027907 Bacteria 60713
199 Ga0207428_10068904 3300027907 Bacteria 2782
200 Ga0207428_10136920 3300027907 Bacteria 1872
201 Ga0268265_10034781 3300028380 Bacteria 3676
202 Ga0268265_10724069 3300028380 Bacteria 963
203 Ga0268265_10737207 3300028380 Unclassified 955
204 Ga0268265_11976408 3300028380 Unclassified 590
205 Ga0268264_10600927 3300028381 Unclassified 1084
206 Ga0268264_11380191 3300028381 Bacteria 715
207 Ga0307408_100031983 3300031548 Bacteria 3667
208 Ga0307408_100060152 3300031548 Bacteria 2768
209 Ga0307408_100120690 3300031548 Bacteria 2030
210 Ga0307408_100144077 3300031548 Bacteria 1873
211 Ga0307408_100154530 3300031548 Bacteria 1815
212 Ga0307405_10854765 3300031731 Bacteria 766
213 Ga0307410_10025062 3300031852 Bacteria 3736
214 Ga0307410_10033764 3300031852 Archaea 3306
215 Ga0307410_10239996 3300031852 Bacteria 1404
216 Ga0307406_10068728 3300031901 Unclassified 2314
217 Ga0307406_10896345 3300031901 Unclassified 755
218 Ga0307412_10579243 3300031911 Bacteria 947
219 Ga0307409_100039685 3300031995 Unclassified 3496
220 Ga0307409_100263873 3300031995 Bacteria 1582
221 Ga0307416_100019317 3300032002 Bacteria 4828
222 Ga0307416_100543948 3300032002 Bacteria 1233
223 Ga0307411_10020572 3300032005 Bacteria 3842
224 Ga0307411_10068294 3300032005 Archaea 2395
225 Ga0307411_10287410 3300032005 Bacteria 1312
226 Ga0307411_12299594 3300032005 Bacteria 506
227 Ga0307415_100212304 3300032126 Unclassified 1545
228 Ga0373932_0102634 3300035112 Unclassified 932
229 Ga0373939_0139911 3300035114 Bacteria 872
230 Ga0373939_0212822 3300035114 Unclassified 736
231 Ga0373942_0128202 3300035207 Bacteria 798
232 Ga0373931_0003124 3300035691 Bacteria 7398
233 Ga0373931_0012710 3300035691 Bacteria 4085
234 Ga0373931_0082899 3300035691 Bacteria 1773
235 Ga0395899_0012086 3300037312 Bacteria 6614
236 Ga0395899_0669545 3300037312 Unclassified 654
237 Ga0395900_0013169 3300037418 Bacteria 8453
238 Ga0395900_0512962 3300037418 Unclassified 1148
239 Ga0395900_0730094 3300037418 Archaea 922
240 Ga0395900_1445008 3300037418 Unclassified 600
241 Ga0395898_0005775 3300037466 Bacteria 13317
242 Ga0395905_1489936 3300037471 Bacteria 581
243 Ga0395901_0001179 3300038443 Bacteria 27782
244 Ga0395901_1700128 3300038443 Unclassified 582
245 Ga0439453_0070725 3300041408 Unclassified 738
246 Ga0439460_0044899 3300042461 Bacteria 1309
247 Ga0451577_0112474 3300042876 Bacteria 2437
248 Ga0451577_0463747 3300042876 Bacteria 1150
249 Ga0453684_0305606 3300044712 Bacteria 1807
250 Ga0453684_2113850 3300044712 Bacteria 564
251 Ga0451576_0049265 3300045051 Bacteria 4421
252 Ga0451576_0668845 3300045051 Bacteria 1091
253 Ga0495603_0153073 3300046455 Bacteria 1339
254 Ga0495580_0002425 3300046472 Bacteria 16291
255 Ga0495584_0671574 3300046491 Bacteria 528
256 Ga0495594_0123069 3300046499 Bacteria 1467
257 Ga0495633_0077429 3300046558 Bacteria 1549
258 Ga0495656_0052358 3300046615 Bacteria 1750
259 Ga0495659_0338771 3300046664 Unclassified 641
260 Ga0495669_0170960 3300046684 Unclassified 1034
261 Ga0495670_0756532 3300046691 Unclassified 530
262 Ga0495636_0063893 3300047318 Unclassified 1561
263 Ga0496102_0244146 3300048905 Bacteria 1693
264 Ga0496106_0038039 3300048909 Bacteria 3600
265 Ga0496106_0651622 3300048909 Unclassified 841
266 Ga0496108_0766601 3300048911 Bacteria 834
267 Ga0501297_015691 3300049520 Bacteria 908
268 Ga0501033_0417406 3300049570 Bacteria 935
269 Ga0501036_0192846 3300049572 Bacteria 1714
270 Ga0501036_0193912 3300049572 Unclassified 1709
271 Ga0501036_0195914 3300049572 Unclassified 1700
272 Ga0501036_1087050 3300049572 Bacteria 653
273 Ga0501038_0115414 3300049574 Bacteria 2220
274 Ga0501038_0133553 3300049574 Bacteria 2035
275 Ga0501038_0463133 3300049574 Bacteria 973
276 Ga0501038_0543890 3300049574 Bacteria 884
277 Ga0501039_0021607 3300049575 Bacteria 4937
278 Ga0501039_0055713 3300049575 Bacteria 3063
279 Ga0501039_0336713 3300049575 Bacteria 1186
280 Ga0501039_0361336 3300049575 Bacteria 1141
281 Ga0501039_0674242 3300049575 Bacteria 809
282 Ga0501040_0034188 3300049576 Bacteria 3444
283 Ga0501040_0086099 3300049576 Bacteria 2182
284 Ga0501040_0218436 3300049576 Bacteria 1356
285 Ga0501040_1068880 3300049576 Unclassified 585
286 Ga0501041_0021152 3300049577 Bacteria 3898
287 Ga0501041_0032622 3300049577 Bacteria 3148
288 Ga0501041_0076453 3300049577 Bacteria 2060
289 Ga0501041_0105552 3300049577 Bacteria 1746
290 Ga0501041_0351744 3300049577 Bacteria 931
291 Ga0501042_0045424 3300049578 Bacteria 3131
292 Ga0501042_0096491 3300049578 Bacteria 2124
293 Ga0501042_0192875 3300049578 Bacteria 1469
294 Ga0501042_0210119 3300049578 Bacteria 1404
295 Ga0501042_0402413 3300049578 Viruses 992
296 Ga0501046_0156854 3300049580 Bacteria 1714
297 Ga0501046_0203753 3300049580 Unclassified 1471
298 Ga0501046_0448642 3300049580 Bacteria 928
299 Ga0501046_0485037 3300049580 Bacteria 886
300 Ga0501048_0062062 3300049582 Bacteria 2646
301 Ga0501048_0068490 3300049582 Bacteria 2507
302 Ga0501048_0351631 3300049582 Bacteria 1051
303 Ga0501048_1004708 3300049582 Unclassified 600
304 Ga0501067_0240651 3300049583 Unclassified 1007
305 Ga0501068_0039141 3300049584 Bacteria 2843
306 Ga0501068_0149549 3300049584 Bacteria 1467
307 Ga0501068_0235538 3300049584 Bacteria 1165
308 Ga0501068_0457556 3300049584 Bacteria 826
309 Ga0501068_0638369 3300049584 Unclassified 695
310 Ga0501069_0025072 3300049585 Unclassified 3257
311 Ga0501070_0061849 3300049586 Bacteria 3102
312 Ga0501070_0636393 3300049586 Unclassified 848
313 Ga0501071_0123113 3300049587 Bacteria 1923
314 Ga0501071_0183327 3300049587 Unclassified 1569
315 Ga0501071_0274483 3300049587 Bacteria 1275
316 Ga0501071_0324579 3300049587 Bacteria 1169
317 Ga0501071_0559661 3300049587 Bacteria 878
318 Ga0501071_1392742 3300049587 Unclassified 541
319 Ga0501072_0061151 3300049588 Bacteria 2970
320 Ga0501072_0073067 3300049588 Bacteria 2711
321 Ga0501072_0112126 3300049588 Bacteria 2171
322 Ga0501072_0200260 3300049588 Unclassified 1592
323 Ga0501072_0224634 3300049588 Bacteria 1496
324 Ga0501072_0583527 3300049588 Unclassified 882
325 Ga0501072_0733081 3300049588 Unclassified 776
326 Ga0501073_0150758 3300049589 Unclassified 1611
327 Ga0501074_0011980 3300049590 Bacteria 6304
328 Ga0501074_0040340 3300049590 Bacteria 3382
329 Ga0501074_0171588 3300049590 Bacteria 1548
330 Ga0501074_0174319 3300049590 Bacteria 1535
331 Ga0501074_0185898 3300049590 Bacteria 1482
332 Ga0501074_0229714 3300049590 Bacteria 1321
333 Ga0501074_0371689 3300049590 Unclassified 1014
334 Ga0501075_0008985 3300049591 Bacteria 6972
335 Ga0501075_0052247 3300049591 Bacteria 3073
336 Ga0501075_0067065 3300049591 Bacteria 2709
337 Ga0501075_0078175 3300049591 Unclassified 2504
338 Ga0501075_0181980 3300049591 Bacteria 1603
339 Ga0501075_0441096 3300049591 Bacteria 993
340 Ga0501076_0007136 3300049592 Bacteria 8122
341 Ga0501076_0045649 3300049592 Bacteria 3459
342 Ga0501076_0060430 3300049592 Bacteria 3015
343 Ga0501076_0107048 3300049592 Bacteria 2257
344 Ga0501076_0158529 3300049592 Unclassified 1843
345 Ga0501076_0270677 3300049592 Bacteria 1391
346 Ga0501077_0020029 3300049593 Bacteria 4233
347 Ga0501077_0061978 3300049593 Bacteria 2373
348 Ga0501077_0158098 3300049593 Bacteria 1439
349 Ga0501077_0333023 3300049593 Unclassified 968
350 Ga0501077_0371941 3300049593 Unclassified 913
351 Ga0501077_0479624 3300049593 Unclassified 797
352 Ga0501225_0067345 3300049705 Bacteria 1014
353 Ga0501079_0015871 3300049741 Bacteria 5756
354 Ga0501079_0017497 3300049741 Bacteria 5474
355 Ga0501079_0081289 3300049741 Bacteria 2505
356 Ga0501079_0312000 3300049741 Bacteria 1231
357 Ga0501079_0358655 3300049741 Bacteria 1142
358 Ga0501080_0026983 3300049742 Bacteria 5340
359 Ga0501080_0108045 3300049742 Bacteria 2579
360 Ga0501081_0001313 3300049743 Bacteria 15163
361 Ga0501081_0005389 3300049743 Bacteria 8254
362 Ga0501081_0020566 3300049743 Bacteria 4399
363 Ga0501081_0086952 3300049743 Unclassified 2195
364 Ga0501081_0259214 3300049743 Bacteria 1270
365 Ga0501081_0324114 3300049743 Bacteria 1133
366 Ga0501081_0671283 3300049743 Bacteria 777
367 Ga0501083_0041240 3300049744 Bacteria 3131
368 Ga0501083_1085071 3300049744 Viruses 521
369 Ga0501035_0159464 3300049822 Bacteria 1954
370 Ga0501035_0653763 3300049822 Unclassified 852
371 Ga0501045_0050750 3300049824 Bacteria 3027
372 Ga0501045_0074934 3300049824 Bacteria 2492
373 Ga0501045_0108349 3300049824 Bacteria 2059
374 Ga0501045_0141938 3300049824 Bacteria 1786
375 Ga0501045_0281085 3300049824 Unclassified 1239
376 Ga0501045_0327865 3300049824 Bacteria 1139
377 Ga0501045_0527911 3300049824 Bacteria 876
378 Ga0501045_0562340 3300049824 Bacteria 846
379 Ga0501045_0740915 3300049824 Bacteria 724
380 Ga0501045_0744893 3300049824 Unclassified 722
381 nmdc:mga05p37_10416_c1 3300050507 Bacteria 11034
382 nmdc:mga05p37_117431_c1 3300050507 Bacteria 3269
383 nmdc:mga05p37_1243278_c1 3300050507 Unclassified 765
384 nmdc:mga05p37_157818_c1 3300050507 Bacteria 2772
385 nmdc:mga05p37_205_c1 3300050507 Bacteria 59326
386 nmdc:mga05p37_308599_c1 3300050507 Bacteria 1876
387 nmdc:mga05p37_31395_c1 3300050507 Bacteria 6488
388 nmdc:mga05p37_33138_c1 3300050507 Bacteria 6326
389 nmdc:mga05p37_42489_c1 3300050507 Bacteria 5585
390 nmdc:mga05p37_570636_c1 3300050507 Bacteria 1284
391 nmdc:mga05p37_658628_c1 3300050507 Bacteria 1171
392 nmdc:mga05p37_674959_c1 3300050507 Bacteria 1153
393 nmdc:mga05p37_71648_c1 3300050507 Bacteria 4264
394 nmdc:mga05p37_922191_c1 3300050507 Bacteria 939
395 nmdc:mga09592_130428_c1 3300050508 Unclassified 2162
396 nmdc:mga09592_199509_c1 3300050508 Bacteria 1733
397 nmdc:mga09592_24809_c1 3300050508 Bacteria 4958
398 nmdc:mga09592_27519_c1 3300050508 Bacteria 4718
399 nmdc:mga09592_29410_c1 3300050508 Bacteria 4570
400 nmdc:mga09592_34883_c1 3300050508 Bacteria 4208
401 nmdc:mga09592_4227_c1 3300050508 Bacteria 11595
402 nmdc:mga09592_483162_c1 3300050508 Bacteria 1067
403 nmdc:mga09592_562479_c1 3300050508 Unclassified 979
404 nmdc:mga09592_5739_c1 3300050508 Bacteria 10121
405 nmdc:mga09592_67610_c1 3300050508 Bacteria 3031
406 nmdc:mga09592_879948_c1 3300050508 Unclassified 754
407 nmdc:mga0qj67_11056_c1 3300050509 Bacteria 6758
408 nmdc:mga0qj67_129461_c1 3300050509 Bacteria 2044
409 nmdc:mga0qj67_297761_c1 3300050509 Unclassified 1307
410 nmdc:mga0qj67_384_c1 3300050509 Bacteria 30480
411 nmdc:mga0qj67_745863_c1 3300050509 Bacteria 777
412 nmdc:mga06r32_1016_c1 3300050510 Bacteria 25205
413 nmdc:mga06r32_15530_c1 3300050510 Bacteria 6915
414 nmdc:mga06r32_164957_c1 3300050510 Bacteria 2198
415 nmdc:mga06r32_16821_c1 3300050510 Bacteria 6669
416 nmdc:mga06r32_177916_c1 3300050510 Bacteria 2112
417 nmdc:mga06r32_205759_c1 3300050510 Bacteria 1956
418 nmdc:mga06r32_312988_c1 3300050510 Bacteria 1556
419 nmdc:mga06r32_42140_c1 3300050510 Bacteria 4339
420 nmdc:mga06r32_4336_c1 3300050510 Bacteria 12703
421 nmdc:mga06r32_4515_c1 3300050510 Bacteria 12470
422 nmdc:mga06r32_829084_c1 3300050510 Bacteria 884
423 nmdc:mga08y16_22166_c1 3300050511 Bacteria 6705
424 nmdc:mga08y16_7328_c1 3300050511 Bacteria 11575
425 nmdc:mga08y16_92810_c1 3300050511 Bacteria 3146
426 nmdc:mga0n895_119216_c1 3300050512 Bacteria 2660
427 nmdc:mga0n895_159246_c1 3300050512 Bacteria 2289
428 nmdc:mga0n895_179226_c1 3300050512 Bacteria 2150
429 nmdc:mga0n895_232056_c1 3300050512 Bacteria 1873
430 nmdc:mga0n895_48183_c1 3300050512 Bacteria 4170
431 nmdc:mga0n895_59080_c1 3300050512 Bacteria 3784
432 nmdc:mga0n895_622260_c1 3300050512 Bacteria 1080
433 nmdc:mga0n895_88604_c1 3300050512 Bacteria 3095
434 nmdc:mga0n895_916908_c1 3300050512 Bacteria 861
435 nmdc:mga0rr50_1025349_c1 3300050513 Bacteria 703
436 nmdc:mga0rr50_160796_c1 3300050513 Bacteria 1823
437 nmdc:mga0rr50_1866777_c1 3300050513 Unclassified 505
438 nmdc:mga0rr50_288360_c1 3300050513 Bacteria 1371
439 nmdc:mga0rr50_58036_c1 3300050513 Bacteria 2899
440 nmdc:mga0rr50_59390_c1 3300050513 Bacteria 2871
441 nmdc:mga08x19_210135_c1 3300050514 Unclassified 1336
442 nmdc:mga08x19_3577_c1 3300050514 Bacteria 9250
443 nmdc:mga08x19_401267_c1 3300050514 Bacteria 962
444 nmdc:mga0a205_1447641_c1 3300050515 Unclassified 535
445 nmdc:mga0a205_17626_c1 3300050515 Bacteria 6701
446 nmdc:mga0a205_1983_c1 3300050515 Bacteria 17834
447 nmdc:mga0a205_2142_c1 3300050515 Bacteria 17341
448 nmdc:mga0a205_29761_c1 3300050515 Bacteria 5226
449 nmdc:mga0a205_30748_c1 3300050515 Bacteria 5143
450 nmdc:mga0a205_36865_c1 3300050515 Bacteria 4701
451 nmdc:mga0a205_43913_c1 3300050515 Bacteria 4308
452 nmdc:mga0a205_700480_c1 3300050515 Bacteria 863
453 nmdc:mga0a205_93999_c1 3300050515 Bacteria 2896
454 nmdc:mga0a205_99189_c1 3300050515 Bacteria 2811
455 Ga0501084_0004567 3300054114 Bacteria 11318
456 Ga0501084_0033602 3300054114 Bacteria 4290
457 Ga0501084_0215479 3300054114 Bacteria 1620
458 Ga0501084_0345710 3300054114 Bacteria 1256
459 Ga0501084_0356547 3300054114 Bacteria 1236
460 Ga0590071_026871 3300059421 Bacteria 1366
461 Ga0590074_042568 3300059423 Bacteria 819
462 Ga0590074_123079 3300059423 Bacteria 517
463 Ga0590075_089302 3300059424 Bacteria 799
464 Ga0501082_0022395 3300060353 Bacteria 5443
465 Ga0501082_0140568 3300060353 Bacteria 2095
466 Ga0501082_0342798 3300060353 Bacteria 1302
467 Ga0501082_0387060 3300060353 Bacteria 1220
468 Ga0501082_0459821 3300060353 Bacteria 1112
469 Ga0501082_0516858 3300060353 Bacteria 1044
470 Ga0501082_1264072 3300060353 Unclassified 645
471 Ga0530510_0042689 3300061734 Bacteria 3276
472 Ga0530510_0053700 3300061734 Bacteria 2911
473 Ga0530510_0101299 3300061734 Bacteria 2106
474 Ga0530510_0301305 3300061734 Bacteria 1199
475 Ga0530510_0407778 3300061734 Bacteria 1025
476 Ga0068865_101510557
477 Ga0065707_11047831
478 Ga0070680_100098925
479 Ga0070680_100411650
480 Ga0070689_100165673
481 Ga0070692_10217563
482 Ga0070668_100212798
483 Ga0070669_100472885
484 Ga0070659_101429653
485 Ga0070705_100808644
486 Ga0070700_100447451
487 Ga0070708_100003786
488 Ga0070708_100020484
489 Ga0070708_100181298
490 Ga0070708_100488773
491 Ga0070708_100489902
492 Ga0070708_100580558
493 Ga0070663_100720796
494 Ga0070662_100181166
495 Ga0070662_101165282
496 Ga0070681_10497503
497 Ga0068867_100117810
498 Ga0068867_100146795
499 Ga0068867_100658511
500 Ga0070706_100112241
501 Ga0070707_100009148
502 Ga0070707_100091405
503 Ga0070707_100118384
504 Ga0070707_100793608
505 Ga0070698_100022913
506 Ga0070698_101867600
507 Ga0070699_100004242
508 Ga0070699_100030615
509 Ga0070699_100053460
510 Ga0070699_100119207
511 Ga0070699_100130914
512 Ga0070699_100319067
513 Ga0070697_100159801
514 Ga0070697_100503190
515 Ga0070697_100745256
516 Ga0070697_100972736
517 Ga0070672_100040719
518 Ga0070695_100168107
519 Ga0070695_100536464
520 Ga0070695_100772647
521 Ga0070695_100899050
522 Ga0070696_100052583
523 Ga0070696_100835983
524 Ga0070704_100273652
525 Ga0070704_100725808
526 Ga0070702_100040602
527 Ga0068859_100179447
528 Ga0068866_10571662
529 Ga0068861_100067918
530 Ga0068861_100872617
531 Ga0068870_10375474
532 Ga0068863_100146703
533 Ga0068858_100710816
534 Ga0068860_100081412
535 Ga0068860_100862886
536 Ga0068862_100052398
537 Ga0068862_100350976
538 Ga0068862_100525950
539 Ga0068862_100597382
540 Ga0081539_10000005
541 Ga0075432_10028009
542 Ga0075428_100001426
543 Ga0075428_100001646
544 Ga0075428_100070391
545 Ga0075428_100184772
546 Ga0075428_100466020
547 Ga0075428_100677936
548 Ga0075428_100990309
549 Ga0075428_101801954
550 Ga0075430_100000068
551 Ga0075430_100001067
552 Ga0075430_100122738
553 Ga0075430_100269146
554 Ga0075430_100437217
555 Ga0075430_100629726
556 Ga0075430_100917370
557 Ga0075431_100000238
558 Ga0075431_100001186
559 Ga0075431_100001913
560 Ga0075431_100009868
561 Ga0075431_100018321
562 Ga0075431_100018791
563 Ga0075431_100028973
564 Ga0075431_100036911
565 Ga0075431_100120671
566 Ga0075431_100532949
567 Ga0075431_100863512
568 Ga0075431_100922959
569 Ga0075433_10000659
570 Ga0075433_10002564
571 Ga0075433_10072065
572 Ga0075433_10134873
573 Ga0075433_10171279
574 Ga0075433_10612038
575 Ga0075433_10760229
576 Ga0075434_100001544
577 Ga0075434_100027702
578 Ga0075434_100068788
579 Ga0075434_100072689
580 Ga0075434_100164811
581 Ga0075434_100542202
582 Ga0075434_100583207
583 Ga0075434_100677390
584 Ga0075434_101904295
585 Ga0075434_101963603
586 Ga0075429_100002287
587 Ga0075429_100005572
588 Ga0075429_100011747
589 Ga0075429_100015396
590 Ga0075429_100015625
591 Ga0075429_100065601
592 Ga0075429_100189778
593 Ga0075429_100566099
594 Ga0075429_101263504
595 Ga0068865_100057225
596 Ga0075436_100003846
597 Ga0075436_100167284
598 Ga0075436_100221004
599 Ga0075436_100690248
600 Ga0097620_100179448
601 Ga0075435_100032641
602 Ga0075435_100042019
603 Ga0075435_100083043
604 Ga0075435_100310474
605 Ga0075435_100356317
606 Ga0075435_100920931
607 Ga0099794_10000256
608 Ga0099794_10506569
609 Ga0111539_10001624
610 Ga0111539_10002856
611 Ga0111539_10465969
612 Ga0114129_10000018
613 Ga0114129_10000536
614 Ga0114129_10001708
615 Ga0114129_10002375
616 Ga0114129_10025346
617 Ga0114129_10030019
618 Ga0114129_10035200
619 Ga0114129_10041969
620 Ga0114129_10095730
621 Ga0114129_10105726
622 Ga0114129_10116045
623 Ga0114129_10138232
624 Ga0114129_10282808
625 Ga0114129_10621785
626 Ga0114129_11035679
627 Ga0114129_11309178
628 Ga0105243_10235982
629 Ga0105241_10070077
630 Ga0105242_11822219
631 Ga0105242_12967770
632 Ga0105249_10379993
633 Ga0105249_10382537
634 Ga0105249_10570327
635 Ga0105246_11570235
636 Ga0157378_10271079
637 Ga0163162_10159491
638 Ga0163162_11280471
639 Ga0157375_10158936
640 Ga0157380_10165428
641 Ga0157380_10274035
642 Ga0163161_10762857
643 Ga0207642_10381482
644 Ga0207642_10561479
645 Ga0207684_10003573
646 Ga0207684_10009370
647 Ga0207684_10016060
648 Ga0207684_10344996
649 Ga0207654_10030592
650 Ga0207660_10304314
651 Ga0207660_10339468
652 Ga0207662_10123042
653 Ga0207646_10002385
654 Ga0207646_10064552
655 Ga0207646_10261072
656 Ga0207706_10205611
657 Ga0207709_10028246
658 Ga0207709_11066745
659 Ga0207704_10051119
660 Ga0207691_10064137
661 Ga0207712_10329670
662 Ga0207668_10234681
663 Ga0207708_10476524
664 Ga0207641_10077494
665 Ga0207648_10111392
666 Ga0207648_10429384
667 Ga0207675_100053315
668 Ga0207675_101155189
669 Ga0207675_101675395
670 Ga0209588_1039677
671 Ga0209998_10023217
672 Ga0209974_10024713
673 Ga0207428_10000340
674 Ga0207428_10068904
675 Ga0207428_10136920
676 Ga0268265_10034781
677 Ga0268265_10724069
678 Ga0268265_10737207
679 Ga0268265_11976408
680 Ga0268264_10600927
681 Ga0268264_11380191
682 Ga0307408_100031983
683 Ga0307408_100060152
684 Ga0307408_100120690
685 Ga0307408_100144077
686 Ga0307408_100154530
687 Ga0307405_10854765
688 Ga0307410_10025062
689 Ga0307410_10033764
690 Ga0307410_10239996
691 Ga0307406_10068728
692 Ga0307406_10896345
693 Ga0307412_10579243
694 Ga0307409_100039685
695 Ga0307409_100263873
696 Ga0307416_100019317
697 Ga0307416_100543948
698 Ga0307411_10020572
699 Ga0307411_10068294
700 Ga0307411_10287410
701 Ga0307411_12299594
702 Ga0307415_100212304
703 Ga0373932_0102634
704 Ga0373939_0139911
705 Ga0373939_0212822
706 Ga0373942_0128202
707 Ga0373931_0003124
708 Ga0373931_0012710
709 Ga0373931_0082899
710 Ga0395899_0012086
711 Ga0395899_0669545
712 Ga0395900_0013169
713 Ga0395900_0512962
714 Ga0395900_0730094
715 Ga0395900_1445008
716 Ga0395898_0005775
717 Ga0395905_1489936
718 Ga0395901_0001179
719 Ga0395901_1700128
720 Ga0439453_0070725
721 Ga0439460_0044899
722 Ga0451577_0112474
723 Ga0451577_0463747
724 Ga0453684_0305606
725 Ga0453684_2113850
726 Ga0451576_0049265
727 Ga0451576_0668845
728 Ga0495603_0153073
729 Ga0495580_0002425
730 Ga0495584_0671574
731 Ga0495594_0123069
732 Ga0495633_0077429
733 Ga0495656_0052358
734 Ga0495659_0338771
735 Ga0495669_0170960
736 Ga0495670_0756532
737 Ga0495636_0063893
738 Ga0496102_0244146
739 Ga0496106_0038039
740 Ga0496106_0651622
741 Ga0496108_0766601
742 Ga0501297_015691
743 Ga0501033_0417406
744 Ga0501036_0192846
745 Ga0501036_0193912
746 Ga0501036_0195914
747 Ga0501036_1087050
748 Ga0501038_0115414
749 Ga0501038_0133553
750 Ga0501038_0463133
751 Ga0501038_0543890
752 Ga0501039_0021607
753 Ga0501039_0055713
754 Ga0501039_0336713
755 Ga0501039_0361336
756 Ga0501039_0674242
757 Ga0501040_0034188
758 Ga0501040_0086099
759 Ga0501040_0218436
760 Ga0501040_1068880
761 Ga0501041_0021152
762 Ga0501041_0032622
763 Ga0501041_0076453
764 Ga0501041_0105552
765 Ga0501041_0351744
766 Ga0501042_0045424
767 Ga0501042_0096491
768 Ga0501042_0192875
769 Ga0501042_0210119
770 Ga0501042_0402413
771 Ga0501046_0156854
772 Ga0501046_0203753
773 Ga0501046_0448642
774 Ga0501046_0485037
775 Ga0501048_0062062
776 Ga0501048_0068490
777 Ga0501048_0351631
778 Ga0501048_1004708
779 Ga0501067_0240651
780 Ga0501068_0039141
781 Ga0501068_0149549
782 Ga0501068_0235538
783 Ga0501068_0457556
784 Ga0501068_0638369
785 Ga0501069_0025072
786 Ga0501070_0061849
787 Ga0501070_0636393
788 Ga0501071_0123113
789 Ga0501071_0183327
790 Ga0501071_0274483
791 Ga0501071_0324579
792 Ga0501071_0559661
793 Ga0501071_1392742
794 Ga0501072_0061151
795 Ga0501072_0073067
796 Ga0501072_0112126
797 Ga0501072_0200260
798 Ga0501072_0224634
799 Ga0501072_0583527
800 Ga0501072_0733081
801 Ga0501073_0150758
802 Ga0501074_0011980
803 Ga0501074_0040340
804 Ga0501074_0171588
805 Ga0501074_0174319
806 Ga0501074_0185898
807 Ga0501074_0229714
808 Ga0501074_0371689
809 Ga0501075_0008985
810 Ga0501075_0052247
811 Ga0501075_0067065
812 Ga0501075_0078175
813 Ga0501075_0181980
814 Ga0501075_0441096
815 Ga0501076_0007136
816 Ga0501076_0045649
817 Ga0501076_0060430
818 Ga0501076_0107048
819 Ga0501076_0158529
820 Ga0501076_0270677
821 Ga0501077_0020029
822 Ga0501077_0061978
823 Ga0501077_0158098
824 Ga0501077_0333023
825 Ga0501077_0371941
826 Ga0501077_0479624
827 Ga0501225_0067345
828 Ga0501079_0015871
829 Ga0501079_0017497
830 Ga0501079_0081289
831 Ga0501079_0312000
832 Ga0501079_0358655
833 Ga0501080_0026983
834 Ga0501080_0108045
835 Ga0501081_0001313
836 Ga0501081_0005389
837 Ga0501081_0020566
838 Ga0501081_0086952
839 Ga0501081_0259214
840 Ga0501081_0324114
841 Ga0501081_0671283
842 Ga0501083_0041240
843 Ga0501083_1085071
844 Ga0501035_0159464
845 Ga0501035_0653763
846 Ga0501045_0050750
847 Ga0501045_0074934
848 Ga0501045_0108349
849 Ga0501045_0141938
850 Ga0501045_0281085
851 Ga0501045_0327865
852 Ga0501045_0527911
853 Ga0501045_0562340
854 Ga0501045_0740915
855 Ga0501045_0744893
856 nmdc:mga05p37_10416_c1
857 nmdc:mga05p37_117431_c1
858 nmdc:mga05p37_1243278_c1
859 nmdc:mga05p37_157818_c1
860 nmdc:mga05p37_205_c1
861 nmdc:mga05p37_308599_c1
862 nmdc:mga05p37_31395_c1
863 nmdc:mga05p37_33138_c1
864 nmdc:mga05p37_42489_c1
865 nmdc:mga05p37_570636_c1
866 nmdc:mga05p37_658628_c1
867 nmdc:mga05p37_674959_c1
868 nmdc:mga05p37_71648_c1
869 nmdc:mga05p37_922191_c1
870 nmdc:mga09592_130428_c1
871 nmdc:mga09592_199509_c1
872 nmdc:mga09592_24809_c1
873 nmdc:mga09592_27519_c1
874 nmdc:mga09592_29410_c1
875 nmdc:mga09592_34883_c1
876 nmdc:mga09592_4227_c1
877 nmdc:mga09592_483162_c1
878 nmdc:mga09592_562479_c1
879 nmdc:mga09592_5739_c1
880 nmdc:mga09592_67610_c1
881 nmdc:mga09592_879948_c1
882 nmdc:mga0qj67_11056_c1
883 nmdc:mga0qj67_129461_c1
884 nmdc:mga0qj67_297761_c1
885 nmdc:mga0qj67_384_c1
886 nmdc:mga0qj67_745863_c1
887 nmdc:mga06r32_1016_c1
888 nmdc:mga06r32_15530_c1
889 nmdc:mga06r32_164957_c1
890 nmdc:mga06r32_16821_c1
891 nmdc:mga06r32_177916_c1
892 nmdc:mga06r32_205759_c1
893 nmdc:mga06r32_312988_c1
894 nmdc:mga06r32_42140_c1
895 nmdc:mga06r32_4336_c1
896 nmdc:mga06r32_4515_c1
897 nmdc:mga06r32_829084_c1
898 nmdc:mga08y16_22166_c1
899 nmdc:mga08y16_7328_c1
900 nmdc:mga08y16_92810_c1
901 nmdc:mga0n895_119216_c1
902 nmdc:mga0n895_159246_c1
903 nmdc:mga0n895_179226_c1
904 nmdc:mga0n895_232056_c1
905 nmdc:mga0n895_48183_c1
906 nmdc:mga0n895_59080_c1
907 nmdc:mga0n895_622260_c1
908 nmdc:mga0n895_88604_c1
909 nmdc:mga0n895_916908_c1
910 nmdc:mga0rr50_1025349_c1
911 nmdc:mga0rr50_160796_c1
912 nmdc:mga0rr50_1866777_c1
913 nmdc:mga0rr50_288360_c1
914 nmdc:mga0rr50_58036_c1
915 nmdc:mga0rr50_59390_c1
916 nmdc:mga08x19_210135_c1
917 nmdc:mga08x19_3577_c1
918 nmdc:mga08x19_401267_c1
919 nmdc:mga0a205_1447641_c1
920 nmdc:mga0a205_17626_c1
921 nmdc:mga0a205_1983_c1
922 nmdc:mga0a205_2142_c1
923 nmdc:mga0a205_29761_c1
924 nmdc:mga0a205_30748_c1
925 nmdc:mga0a205_36865_c1
926 nmdc:mga0a205_43913_c1
927 nmdc:mga0a205_700480_c1
928 nmdc:mga0a205_93999_c1
929 nmdc:mga0a205_99189_c1
930 Ga0501084_0004567
931 Ga0501084_0033602
932 Ga0501084_0215479
933 Ga0501084_0345710
934 Ga0501084_0356547
935 Ga0590071_026871
936 Ga0590074_042568
937 Ga0590074_123079
938 Ga0590075_089302
939 Ga0501082_0022395
940 Ga0501082_0140568
941 Ga0501082_0342798
942 Ga0501082_0387060
943 Ga0501082_0459821
944 Ga0501082_0516858
945 Ga0501082_1264072
946 Ga0530510_0042689
947 Ga0530510_0053700
948 Ga0530510_0101299
949 Ga0530510_0301305
950 Ga0530510_0407778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dtr-assembly1.cif.gz_A-2 structure of an acrif protein 0.7089 39 106
1wfr-assembly1.cif.gz_A solution structure of the conserved hypothetical protein tt1886, possibly sterol carrier protein, from thermus thermophilus hb8 0.65 84 111
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.6418 88 108
5yjj-assembly2.cif.gz_E crystal structure of pnpase from staphylococcus epidermidis 0.6233 42 106
7u2t-assembly1.cif.gz_A influenza neuraminidase n1-mi15-snap-174 0.5988 87 108
ID Description Score Start End Superfamily
af_A0A4V0INN0_63_187_2.60.120.290 Mainly Beta;Sandwich;Jelly Rolls;Spermadhesin, CUB domain 0.8158 42 65 2.60.120.290
af_Q10426_379_663_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7686 86 111 2.130.10.10
af_P90757_4_144_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7604 41 65 2.130.10.10
af_Q5AJA6_5_276_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7599 43 61 3.30.420.40
af_Q93518_12_136_2.60.120.290 Mainly Beta;Sandwich;Jelly Rolls;Spermadhesin, CUB domain 0.7582 40 65 2.60.120.290
ID Description Score Start End GO Terms
AF-A0A2V6WKI7-F1-model_v4 Uncharacterized protein 0.9957 43 121
AF-A0A2V6UHD9-F1-model_v4 Methyltransferase FkbM domain-containing protein 0.9953 1 120
AF-A0A1Q7PIN0-F1-model_v4 Uncharacterized protein 0.995 1 121
AF-A0A2V6UHD9-F1-model_v4 Methyltransferase FkbM domain-containing protein 0.979 1 120
AF-A0A6L8C7P3-F1-model_v4 Uncharacterized protein 0.976 5 121

Map