F450896

General Info

Members Datasets Scaffolds Average Seq Length
472 287 448 183

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0076797|Ga0501034_0076797_1354_1980
Length 208
Sequence MTVDGLIVADNGPARRYAWPSFHEALSMSLTPGGRIDEDLPRKAVRVAVLTISDTRDEESDTSGHILADRVTGAGHALAGKTLVRDDIEAIRGQVRSWIGSGEVDAIVTTGGTGLTGRDVTVEALQPLFDKTIDGFGVVFHLVSYQTVGLSTLQSRATAGIIDGVFVFCLPGSNGAVKDGWDKVIAAQLDSRHRPCNMVELMPRLLEA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
14 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
15 2818991435 Caulobacter henricii 536 Isolate Unclassified
16 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
22 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
23 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
24 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
269 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
270 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
271 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
286 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.53
Nodule 0
Rhizoplane 2.12
Rhizosphere 72.03
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10157629 3300003320 Bacteria 1061
2 rootL2_10009868 3300003322 Bacteria 3537
3 rootL2_10043368 3300003322 Bacteria 2974
4 rootH1_10037398 3300003323 Bacteria 2617
5 Ga0055526_1040699 3300003771 Bacteria 1168
6 Ga0055537_1009043 3300003773 Bacteria 2235
7 Ga0055524_1005249 3300003775 Bacteria 5821
8 Ga0055524_1020526 3300003775 Bacteria 2222
9 Ga0055536_1000500 3300003781 Bacteria 27105
10 Ga0055536_1000535 3300003781 Bacteria 26061
11 Ga0055536_1018970 3300003781 Bacteria 2181
12 Ga0055530_10000803 3300003791 Bacteria 26071
13 Ga0055530_10003327 3300003791 Bacteria 9276
14 Ga0055531_10000329 3300003794 Bacteria 46869
15 Ga0055531_10006615 3300003794 Bacteria 6531
16 Ga0065165_1000345 3300005262 Bacteria 76072
17 Ga0065165_1010924 3300005262 Bacteria 3858
18 Ga0070658_10003619 3300005327 Bacteria 12661
19 Ga0070666_10534435 3300005335 Bacteria 852
20 Ga0070680_100050475 3300005336 Bacteria 3393
21 Ga0070680_100227363 3300005336 Bacteria 1575
22 Ga0070660_100000914 3300005339 Bacteria 19736
23 Ga0070689_100462460 3300005340 Bacteria 1081
24 Ga0070691_10002573 3300005341 Bacteria 8087
25 Ga0070691_10007718 3300005341 Bacteria 4927
26 Ga0070691_10417215 3300005341 Bacteria 760
27 Ga0070668_100032800 3300005347 Bacteria 3952
28 Ga0070659_100060921 3300005366 Bacteria 2982
29 Ga0070709_10005190 3300005434 Bacteria 7044
30 Ga0070714_100010355 3300005435 Bacteria 7369
31 Ga0070714_100037568 3300005435 Bacteria 4070
32 Ga0070714_100224014 3300005435 Bacteria 1730
33 Ga0070713_100000189 3300005436 Bacteria 40693
34 Ga0070663_100032601 3300005455 Bacteria 3593
35 Ga0070681_10085550 3300005458 Bacteria 3105
36 Ga0070681_10118480 3300005458 Bacteria 2584
37 Ga0070681_10169713 3300005458 Bacteria 2104
38 Ga0070681_10276748 3300005458 Bacteria 1590
39 Ga0070681_10322928 3300005458 Bacteria 1453
40 Ga0070707_100087745 3300005468 Bacteria 3009
41 Ga0070698_101072528 3300005471 Bacteria 754
42 Ga0070699_100517151 3300005518 Bacteria 1085
43 Ga0070679_100027860 3300005530 Bacteria 5566
44 Ga0070679_100211317 3300005530 Bacteria 1904
45 Ga0070679_100352413 3300005530 Bacteria 1419
46 Ga0070697_100177806 3300005536 Bacteria 1803
47 Ga0068853_100068227 3300005539 Bacteria 3091
48 Ga0068853_100087026 3300005539 Bacteria 2741
49 Ga0070672_100842968 3300005543 Bacteria 808
50 Ga0070695_100152101 3300005545 Bacteria 1616
51 Ga0070693_100080856 3300005547 Bacteria 1937
52 Ga0070665_100795206 3300005548 Bacteria 959
53 Ga0068855_100004064 3300005563 Bacteria 17856
54 Ga0068855_100059872 3300005563 Bacteria 4455
55 Ga0068855_100169204 3300005563 Bacteria 2475
56 Ga0070664_100129635 3300005564 Bacteria 2215
57 Ga0068857_100002761 3300005577 Bacteria 14427
58 Ga0068856_100001854 3300005614 Bacteria 22070
59 Ga0068856_100007147 3300005614 Bacteria 10886
60 Ga0068856_100767856 3300005614 Bacteria 984
61 Ga0068856_101215899 3300005614 Bacteria 770
62 Ga0068852_100060226 3300005616 Bacteria 3295
63 Ga0068852_101137712 3300005616 Bacteria 801
64 Ga0068864_100522006 3300005618 Bacteria 1145
65 Ga0068858_100054835 3300005842 Bacteria 3686
66 Ga0068860_100337608 3300005843 Bacteria 1481
67 Ga0068862_100057317 3300005844 Bacteria 3341
68 Ga0068862_101240595 3300005844 Bacteria 745
69 Ga0070712_100001527 3300006175 Bacteria 14126
70 Ga0075362_10026943 3300006177 Bacteria 2458
71 Ga0075366_10069307 3300006195 Bacteria 2099
72 Ga0097621_100302417 3300006237 Bacteria 1413
73 Ga0068871_100161757 3300006358 Bacteria 1915
74 Ga0068871_100365876 3300006358 Bacteria 1278
75 Ga0075434_100290178 3300006871 Bacteria 1656
76 Ga0075436_100002177 3300006914 Bacteria 13507
77 Ga0105240_10004588 3300009093 Bacteria 20940
78 Ga0105240_10007152 3300009093 Bacteria 16260
79 Ga0105240_10007161 3300009093 Bacteria 16246
80 Ga0105240_10023142 3300009093 Bacteria 8226
81 Ga0105240_10044701 3300009093 Bacteria 5625
82 Ga0111539_10129564 3300009094 Bacteria 2954
83 Ga0105243_11337947 3300009148 Bacteria 735
84 Ga0105241_10008033 3300009174 Bacteria 7760
85 Ga0105241_10592585 3300009174 Bacteria 1000
86 Ga0105237_10006786 3300009545 Bacteria 12625
87 Ga0105237_10007748 3300009545 Bacteria 11719
88 Ga0105237_11012430 3300009545 Bacteria 838
89 Ga0105238_10013490 3300009551 Bacteria 8249
90 Ga0105238_10062940 3300009551 Bacteria 3710
91 Ga0105238_10117308 3300009551 Bacteria 2642
92 Ga0105239_10116956 3300010375 Bacteria 2959
93 Ga0105239_10149489 3300010375 Bacteria 2606
94 Ga0105239_10260627 3300010375 Bacteria 1948
95 Ga0157373_10050615 3300013100 Bacteria 2958
96 Ga0157370_10005804 3300013104 Bacteria 13798
97 Ga0157370_10023061 3300013104 Bacteria 6187
98 Ga0157370_10026865 3300013104 Bacteria 5678
99 Ga0157370_10092638 3300013104 Bacteria 2836
100 Ga0157369_10007922 3300013105 Bacteria 12215
101 Ga0157369_10012149 3300013105 Bacteria 9776
102 Ga0157369_10322648 3300013105 Bacteria 1605
103 Ga0157369_10410315 3300013105 Bacteria 1405
104 Ga0163162_10042513 3300013306 Bacteria 4549
105 Ga0157372_10012154 3300013307 Bacteria 9171
106 Ga0157372_10020909 3300013307 Bacteria 7065
107 Ga0157372_10128243 3300013307 Bacteria 2917
108 Ga0157372_10388797 3300013307 Bacteria 1625
109 Ga0157372_11738540 3300013307 Bacteria 717
110 Ga0157377_10930897 3300014745 Bacteria 652
111 Ga0157379_10003371 3300014968 Bacteria 13518
112 Ga0157379_10017038 3300014968 Bacteria 6396
113 Ga0157379_10108071 3300014968 Bacteria 2497
114 Ga0183365_10001 3300015684 Bacteria 2090444
115 Ga0213872_10000379 3300021361 Bacteria 37422
116 Ga0213872_10026397 3300021361 Bacteria 2667
117 Ga0213876_10001100 3300021384 Bacteria 17303
118 Ga0209565_1000192 3300025263 Bacteria 74812
119 Ga0209565_1000416 3300025263 Bacteria 35062
120 Ga0209673_1001784 3300025273 Bacteria 17817
121 Ga0209675_1004310 3300025291 Bacteria 6381
122 Ga0209676_1000261 3300025292 Bacteria 111202
123 Ga0209676_1000376 3300025292 Bacteria 82203
124 Ga0209676_1000615 3300025292 Bacteria 52037
125 Ga0209676_1053621 3300025292 Bacteria 1045
126 Ga0209564_1001173 3300025295 Bacteria 30456
127 Ga0209564_1016064 3300025295 Bacteria 3005
128 Ga0209564_1041022 3300025295 Bacteria 1248
129 Ga0209758_1000917 3300025297 Bacteria 39944
130 Ga0209050_1000515 3300025298 Bacteria 65209
131 Ga0209050_1000737 3300025298 Bacteria 47468
132 Ga0209050_1016092 3300025298 Unclassified 3086
133 Ga0209050_1045230 3300025298 Bacteria 1169
134 Ga0209256_1002646 3300025299 Bacteria 14093
135 Ga0209256_1005783 3300025299 Bacteria 6901
136 Ga0209256_1007560 3300025299 Bacteria 5309
137 Ga0209256_1019114 3300025299 Bacteria 2196
138 Ga0209051_1000637 3300025303 Bacteria 40331
139 Ga0209257_1000698 3300025304 Bacteria 52037
140 Ga0209257_1001835 3300025304 Bacteria 23178
141 Ga0209257_1003447 3300025304 Bacteria 13566
142 Ga0207699_10000313 3300025906 Bacteria 25978
143 Ga0207705_10001841 3300025909 Bacteria 16684
144 Ga0207705_10109141 3300025909 Bacteria 2043
145 Ga0207705_10303198 3300025909 Bacteria 1225
146 Ga0207707_10001750 3300025912 Bacteria 19952
147 Ga0207707_10082416 3300025912 Bacteria 2809
148 Ga0207707_10180214 3300025912 Bacteria 1845
149 Ga0207695_10002278 3300025913 Bacteria 28735
150 Ga0207695_10012685 3300025913 Bacteria 10093
151 Ga0207695_10014728 3300025913 Bacteria 9247
152 Ga0207695_10015141 3300025913 Bacteria 9095
153 Ga0207695_10060239 3300025913 Bacteria 3931
154 Ga0207695_10078007 3300025913 Bacteria 3362
155 Ga0207695_10088074 3300025913 Bacteria 3126
156 Ga0207671_10036509 3300025914 Bacteria 3645
157 Ga0207671_10132935 3300025914 Bacteria 1911
158 Ga0207671_10162624 3300025914 Bacteria 1729
159 Ga0207693_10003172 3300025915 Bacteria 14126
160 Ga0207693_10180099 3300025915 Bacteria 1663
161 Ga0207660_10001100 3300025917 Bacteria 18058
162 Ga0207657_10001764 3300025919 Bacteria 23354
163 Ga0207657_10152018 3300025919 Bacteria 1885
164 Ga0207652_10001532 3300025921 Bacteria 20384
165 Ga0207652_10135240 3300025921 Bacteria 2201
166 Ga0207652_10151924 3300025921 Bacteria 2074
167 Ga0207646_10140890 3300025922 Bacteria 2172
168 Ga0207681_10396909 3300025923 Bacteria 1113
169 Ga0207694_10006056 3300025924 Bacteria 9255
170 Ga0207694_10053967 3300025924 Bacteria 3117
171 Ga0207694_10229088 3300025924 Bacteria 1517
172 Ga0207694_10319612 3300025924 Bacteria 1281
173 Ga0207650_10385733 3300025925 Bacteria 1158
174 Ga0207700_10000055 3300025928 Bacteria 71870
175 Ga0207664_10009645 3300025929 Bacteria 6783
176 Ga0207690_10035025 3300025932 Bacteria 3238
177 Ga0207669_10581530 3300025937 Bacteria 908
178 Ga0207679_10250307 3300025945 Bacteria 1506
179 Ga0207667_10004958 3300025949 Bacteria 16261
180 Ga0207667_10023616 3300025949 Bacteria 6769
181 Ga0207667_10027805 3300025949 Bacteria 6150
182 Ga0207667_10344353 3300025949 Bacteria 1521
183 Ga0207668_10002763 3300025972 Bacteria 10260
184 Ga0207640_10208511 3300025981 Bacteria 1487
185 Ga0207703_10039154 3300026035 Bacteria 3787
186 Ga0207703_11208329 3300026035 Bacteria 727
187 Ga0207639_10023725 3300026041 Bacteria 4432
188 Ga0207639_10053614 3300026041 Bacteria 3078
189 Ga0207639_10096275 3300026041 Bacteria 2381
190 Ga0207639_10732423 3300026041 Bacteria 919
191 Ga0207678_10044220 3300026067 Bacteria 3853
192 Ga0207702_10000193 3300026078 Bacteria 72492
193 Ga0207702_10001279 3300026078 Bacteria 25257
194 Ga0207702_10698872 3300026078 Bacteria 999
195 Ga0207648_10194409 3300026089 Bacteria 1798
196 Ga0207676_10462944 3300026095 Bacteria 1198
197 Ga0207674_10000003 3300026116 Bacteria 241674
198 Ga0207674_10433173 3300026116 Bacteria 1271
199 Ga0207674_10653273 3300026116 Bacteria 1016
200 Ga0207698_10059086 3300026142 Bacteria 2975
201 Ga0207698_10074806 3300026142 Bacteria 2704
202 Ga0268266_10721804 3300028379 Bacteria 961
203 Ga0268266_10963078 3300028379 Bacteria 826
204 Ga0268265_10046353 3300028380 Bacteria 3249
205 Ga0265337_1008718 3300028556 Bacteria 3664
206 Ga0307515_10011587 3300028794 Bacteria 16720
207 Ga0307515_10040884 3300028794 Bacteria 7316
208 Ga0307515_10059114 3300028794 Bacteria 5502
209 Ga0265338_10017032 3300028800 Bacteria 7860
210 Ga0307511_10287518 3300030521 Bacteria 754
211 Ga0265330_10182430 3300031235 Bacteria 889
212 Ga0265325_10005432 3300031241 Bacteria 7865
213 Ga0265325_10135695 3300031241 Unclassified 1174
214 Ga0265340_10255945 3300031247 Bacteria 780
215 Ga0265339_10004149 3300031249 Bacteria 9970
216 Ga0265331_10086528 3300031250 Bacteria 1452
217 Ga0265327_10000757 3300031251 Bacteria 50106
218 Ga0307513_10000127 3300031456 Bacteria 107100
219 Ga0307513_10002443 3300031456 Bacteria 25770
220 Ga0307513_10381032 3300031456 Bacteria 1150
221 Ga0307408_100166592 3300031548 Bacteria 1756
222 Ga0307408_100556568 3300031548 Bacteria 1013
223 Ga0265314_10004762 3300031711 Bacteria 12436
224 Ga0265342_10053355 3300031712 Unclassified 2406
225 Ga0316576_10794726 3300031727 Bacteria 681
226 Ga0316578_10026995 3300031728 Bacteria 3242
227 Ga0307410_10663773 3300031852 Bacteria 876
228 Ga0307406_10920122 3300031901 Bacteria 746
229 Ga0307407_10112299 3300031903 Bacteria 1713
230 Ga0307409_100621117 3300031995 Bacteria 1071
231 Ga0307416_100532860 3300032002 Bacteria 1245
232 Ga0307414_10109335 3300032004 Bacteria 2100
233 Ga0307411_10513322 3300032005 Bacteria 1016
234 Ga0373955_0019524 3300035172 Bacteria 3390
235 Ga0316574_0013168 3300035398 Bacteria 4750
236 Ga0373931_0182926 3300035691 Bacteria 1242
237 Ga0373935_0213106 3300035692 Bacteria 1339
238 Ga0373933_0044555 3300035724 Bacteria 2628
239 Ga0373937_0068040 3300036401 Bacteria 3283
240 Ga0373937_0498937 3300036401 Bacteria 1156
241 Ga0316584_0041037 3300036712 Bacteria 3450
242 Ga0373925_0200203 3300037068 Bacteria 1588
243 Ga0395899_0000013 3300037312 Bacteria 510397
244 Ga0395899_0271258 3300037312 Unclassified 1157
245 Ga0395899_0299123 3300037312 Bacteria 1089
246 Ga0395900_0080029 3300037418 Bacteria 3358
247 Ga0395900_0147923 3300037418 Bacteria 2401
248 Ga0395898_0039768 3300037466 Bacteria 4653
249 Ga0395898_0059968 3300037466 Bacteria 3699
250 Ga0395905_0000022 3300037471 Bacteria 321527
251 Ga0395905_0005437 3300037471 Bacteria 13012
252 Ga0436364_0594698 3300037853 Bacteria 1127
253 Ga0436364_1190936 3300037853 Bacteria 1064
254 Ga0395901_0100606 3300038443 Bacteria 3032
255 Ga0395901_0776412 3300038443 Bacteria 949
256 Ga0400483_105414 3300039062 Bacteria 2823
257 Ga0400483_248936 3300039062 Bacteria 1565
258 Ga0436365_0052875 3300039437 Bacteria 1141
259 Ga0436365_0596913 3300039437 Bacteria 843
260 Ga0436365_0794411 3300039437 Bacteria 78184
261 Ga0436365_1198557 3300039437 Bacteria 2663
262 Ga0436361_0217762 3300039447 Bacteria 5326
263 Ga0436361_0443049 3300039447 Bacteria 1414
264 Ga0436361_0681087 3300039447 Bacteria 8656
265 Ga0436361_0865915 3300039447 Bacteria 886
266 Ga0436361_1016532 3300039447 Bacteria 20016
267 Ga0436363_1579351 3300039450 Bacteria 1245
268 Ga0436362_0553624 3300039453 Bacteria 947
269 Ga0439465_0023693 3300041413 Bacteria 1932
270 Ga0451853_0560300 3300041512 Bacteria 1418
271 Ga0439445_0049981 3300042004 Bacteria 1127
272 Ga0439455_0030797 3300042012 Bacteria 1333
273 Ga0439435_0010166 3300042436 Bacteria 2226
274 Ga0439459_0004486 3300042438 Bacteria 2246
275 Ga0466969_0007030 3300044656 Bacteria 5981
276 Ga0466972_0124267 3300044658 Bacteria 1216
277 Ga0466965_0241425 3300044683 Bacteria 967
278 Ga0466966_0000195 3300044684 Bacteria 40710
279 Ga0466961_0018259 3300044693 Bacteria 4509
280 Ga0466963_0017602 3300044694 Bacteria 4457
281 Ga0466971_0002249 3300044719 Bacteria 8169
282 Ga0466970_0022555 3300044765 Bacteria 3285
283 Ga0466957_0030236 3300044842 Bacteria 3233
284 Ga0466960_0105665 3300044901 Bacteria 1456
285 Ga0466959_0022315 3300045049 Bacteria 4678
286 Ga0466959_0097162 3300045049 Bacteria 2111
287 Ga0466959_0109252 3300045049 Bacteria 1975
288 Ga0466958_0000584 3300045836 Bacteria 15553
289 Ga0466958_0022648 3300045836 Bacteria 3682
290 Ga0495627_001445 3300046453 Bacteria 13910
291 Ga0495590_0000421 3300046457 Bacteria 21382
292 Ga0495638_0000185 3300046460 Bacteria 95220
293 Ga0495638_0000639 3300046460 Bacteria 38450
294 Ga0495638_0000972 3300046460 Bacteria 28909
295 Ga0495638_0001365 3300046460 Bacteria 22403
296 Ga0495638_0002308 3300046460 Bacteria 15708
297 Ga0495638_0098201 3300046460 Bacteria 1755
298 Ga0495650_0000468 3300046471 Bacteria 62149
299 Ga0495650_0036678 3300046471 Bacteria 2142
300 Ga0495650_0065713 3300046471 Bacteria 1438
301 Ga0495580_0419723 3300046472 Bacteria 900
302 Ga0495585_0018010 3300046492 Bacteria 4076
303 Ga0495583_0000003 3300046506 Bacteria 709273
304 Ga0495610_0000663 3300046512 Bacteria 33505
305 Ga0495610_0000985 3300046512 Bacteria 26266
306 Ga0495610_0009070 3300046512 Bacteria 6341
307 Ga0495616_0000747 3300046513 Bacteria 23766
308 Ga0495616_0134119 3300046513 Bacteria 1132
309 Ga0495620_0025962 3300046515 Bacteria 2762
310 Ga0495631_0047264 3300046518 Bacteria 1890
311 Ga0495632_0002517 3300046519 Bacteria 13876
312 Ga0495637_0003037 3300046520 Bacteria 8974
313 Ga0495637_0012594 3300046520 Bacteria 4040
314 Ga0495643_0288941 3300046522 Bacteria 751
315 Ga0495648_0000191 3300046524 Bacteria 70452
316 Ga0495648_0252215 3300046524 Bacteria 851
317 Ga0495663_0043846 3300046525 Bacteria 1367
318 Ga0495663_0201017 3300046525 Bacteria 695
319 Ga0495654_0010175 3300046530 Bacteria 5128
320 Ga0495654_0115680 3300046530 Bacteria 1219
321 Ga0495598_0068095 3300046537 Bacteria 1115
322 Ga0495621_0061408 3300046539 Bacteria 1365
323 Ga0495597_0049682 3300046542 Bacteria 1853
324 Ga0495597_0080252 3300046542 Bacteria 1396
325 Ga0495667_0126422 3300046559 Bacteria 1649
326 Ga0495668_0002216 3300046616 Bacteria 16535
327 Ga0495668_0008293 3300046616 Bacteria 6508
328 Ga0495625_0000152 3300046660 Bacteria 105589
329 Ga0495625_0001773 3300046660 Bacteria 24941
330 Ga0495625_0009565 3300046660 Bacteria 8098
331 Ga0495625_0014695 3300046660 Bacteria 6236
332 Ga0495625_0056994 3300046660 Bacteria 2780
333 Ga0495657_0058488 3300046675 Bacteria 2560
334 Ga0495623_0052804 3300046679 Bacteria 2568
335 Ga0495670_0289096 3300046691 Bacteria 877
336 Ga0495670_0415742 3300046691 Bacteria 727
337 Ga0495589_0007253 3300046794 Bacteria 5808
338 Ga0495660_0092613 3300046810 Bacteria 1568
339 Ga0495636_0272810 3300047318 Bacteria 786
340 Ga0495672_0001471 3300047320 Bacteria 23126
341 Ga0495679_009455 3300047446 Bacteria 3902
342 Ga0495673_0000312 3300047469 Bacteria 63724
343 Ga0495673_0000433 3300047469 Bacteria 47031
344 Ga0495673_0002747 3300047469 Bacteria 12052
345 Ga0495681_0013308 3300047470 Bacteria 4782
346 Ga0495681_0195182 3300047470 Bacteria 824
347 Ga0495686_0000850 3300047472 Bacteria 39221
348 Ga0495686_0135111 3300047472 Bacteria 1459
349 Ga0495686_0254963 3300047472 Bacteria 984
350 Ga0496102_1235791 3300048905 Bacteria 666
351 Ga0496106_0002485 3300048909 Bacteria 13733
352 Ga0496106_0147913 3300048909 Bacteria 1852
353 Ga0496107_0000209 3300048910 Bacteria 30900
354 Ga0496109_0104674 3300048912 Bacteria 2628
355 Ga0496110_0172758 3300048913 Bacteria 1961
356 Ga0496110_1205534 3300048913 Bacteria 666
357 Ga0496112_0149529 3300048915 Bacteria 2303
358 Ga0496113_0424341 3300048916 Bacteria 1068
359 Ga0496115_0016590 3300048918 Bacteria 5611
360 Ga0496121_0003463 3300048924 Bacteria 22495
361 Ga0496121_0167274 3300048924 Bacteria 1601
362 Ga0496124_0112603 3300048927 Bacteria 2188
363 Ga0496124_0211254 3300048927 Bacteria 1468
364 Ga0496124_0318642 3300048927 Bacteria 1114
365 Ga0496125_0080930 3300048928 Bacteria 2484
366 Ga0496126_0009275 3300048929 Bacteria 10482
367 Ga0495678_002738 3300049459 Bacteria 11584
368 Ga0501031_0444866 3300049568 Bacteria 837
369 Ga0501032_0130786 3300049569 Bacteria 1656
370 Ga0501032_0292254 3300049569 Bacteria 1054
371 Ga0501032_0428413 3300049569 Bacteria 848
372 Ga0501033_0005521 3300049570 Bacteria 10004
373 Ga0501033_0008383 3300049570 Bacteria 8005
374 Ga0501033_0026774 3300049570 Bacteria 4338
375 Ga0501033_0076340 3300049570 Bacteria 2460
376 Ga0501034_0000205 3300049571 Bacteria 112180
377 Ga0501034_0076797 3300049571 Bacteria 3346
378 Ga0501034_0715142 3300049571 Bacteria 899
379 Ga0501036_0250982 3300049572 Bacteria 1483
380 Ga0501037_0045562 3300049573 Bacteria 3220
381 Ga0501037_0064899 3300049573 Bacteria 2660
382 Ga0501038_0045732 3300049574 Bacteria 3799
383 Ga0501038_0053806 3300049574 Bacteria 3464
384 Ga0501038_0218597 3300049574 Bacteria 1521
385 Ga0501038_0695585 3300049574 Bacteria 762
386 Ga0501038_0804855 3300049574 Bacteria 698
387 Ga0501042_0363358 3300049578 Bacteria 1048
388 Ga0501046_0574314 3300049580 Bacteria 802
389 Ga0501047_0009411 3300049581 Bacteria 9232
390 Ga0501047_0059813 3300049581 Bacteria 3679
391 Ga0501047_0125105 3300049581 Bacteria 2452
392 Ga0501048_0245053 3300049582 Bacteria 1272
393 Ga0501069_0403552 3300049585 Bacteria 809
394 Ga0501070_0000033 3300049586 Bacteria 128626
395 Ga0501070_0642438 3300049586 Bacteria 843
396 Ga0501238_000522 3300049671 Bacteria 4394
397 Ga0501238_002142 3300049671 Bacteria 2332
398 Ga0501080_0000327 3300049742 Bacteria 36458
399 Ga0501080_0795217 3300049742 Bacteria 830
400 Ga0501035_0009624 3300049822 Bacteria 8988
401 Ga0501035_0021699 3300049822 Bacteria 5904
402 Ga0501044_0000592 3300049823 Bacteria 44003
403 Ga0501044_0002575 3300049823 Bacteria 20650
404 Ga0501044_0035588 3300049823 Bacteria 5213
405 Ga0501044_0038261 3300049823 Bacteria 5010
406 nmdc:mga03683_30891_c1 3300050489 Bacteria 2145
407 nmdc:mga03n38_31179_c1 3300050490 Bacteria 2247
408 nmdc:mga0k408_197179_c1 3300050493 Bacteria 1202
409 nmdc:mga0n895_807512_c1 3300050512 Bacteria 928
410 nmdc:mga0n895_85285_c1 3300050512 Bacteria 3153
411 nmdc:mga08x19_89_c1 3300050514 Bacteria 82051
412 Ga0500635_0000495 3300053080 Bacteria 10923
413 Ga0500578_0000015 3300053086 Bacteria 179217
414 Ga0500643_018024 3300053087 Bacteria 2352
415 Ga0500644_0000058 3300053088 Bacteria 64557
416 Ga0500644_0010721 3300053088 Bacteria 2487
417 Ga0500641_0000623 3300053096 Bacteria 12805
418 Ga0500554_000867 3300053102 Bacteria 5939
419 Ga0500555_033290 3300053103 Bacteria 1453
420 Ga0500555_036589 3300053103 Bacteria 1376
421 Ga0500556_0000300 3300053104 Bacteria 37857
422 Ga0500556_0090781 3300053104 Bacteria 1166
423 Ga0500557_169918 3300053105 Bacteria 712
424 Ga0500562_000218 3300053108 Bacteria 15430
425 Ga0500562_000349 3300053108 Bacteria 11114
426 Ga0500572_016345 3300053111 Bacteria 1888
427 Ga0500594_0000085 3300053118 Bacteria 28617
428 Ga0500595_038707 3300053119 Bacteria 1548
429 Ga0500608_000069 3300053122 Bacteria 43867
430 Ga0500608_000990 3300053122 Bacteria 10219
431 Ga0500618_000205 3300053125 Bacteria 46863
432 Ga0500658_0002593 3300053134 Bacteria 6987
433 Ga0500559_0000277 3300053136 Bacteria 39724
434 Ga0500559_0000279 3300053136 Bacteria 39412
435 Ga0500559_0017377 3300053136 Bacteria 3037
436 Ga0500564_000038 3300053138 Bacteria 36426
437 Ga0500577_0000406 3300053142 Bacteria 11030
438 Ga0500622_0001371 3300053156 Bacteria 19657
439 Ga0500622_0023855 3300053156 Bacteria 3238
440 Ga0500622_0034458 3300053156 Bacteria 2652
441 Ga0500627_0063348 3300053158 Bacteria 1629
442 Ga0500636_0178361 3300053177 Bacteria 1143
443 Ga0500611_025057 3300053727 Bacteria 1178
444 Ga0500645_001826 3300053730 Bacteria 10205
445 Ga0500645_037941 3300053730 Bacteria 1430
446 Ga0500609_000049 3300053731 Bacteria 15759
447 Ga0500552_062352 3300053733 Bacteria 654
448 Ga0466962_0001996 3300061719 Bacteria 9638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0178361 Ga0500636_0178361_598_1101 167
2 3300021384 Ga0213876_10001100 Ga0213876_1000110017 171
3 3300039437 Ga0436365_0794411 Ga0436365_0794411_3068_3589 171
4 3300009545 Ga0105237_11012430 Ga0105237_110124302 172
5 3300021361 Ga0213872_10026397 Ga0213872_100263973 172
6 3300025913 Ga0207695_10060239 Ga0207695_100602392 172
7 3300025914 Ga0207671_10162624 Ga0207671_101626242 172
8 3300025924 Ga0207694_10229088 Ga0207694_102290882 172
9 3300039447 Ga0436361_1016532 Ga0436361_1016532_16006_16554 172
10 3300047318 Ga0495636_0272810 Ga0495636_0272810_23_577 172
11 3300045049 Ga0466959_0109252 Ga0466959_0109252_344_865 173
12 3300049582 Ga0501048_0245053 Ga0501048_0245053_61_609 173
13 3300031548 Ga0307408_100166592 Ga0307408_1001665923 174
14 3300031852 Ga0307410_10663773 Ga0307410_106637732 174
15 3300031901 Ga0307406_10920122 Ga0307406_109201221 174
16 3300031903 Ga0307407_10112299 Ga0307407_101122992 174
17 3300031995 Ga0307409_100621117 Ga0307409_1006211172 174
18 3300032002 Ga0307416_100532860 Ga0307416_1005328602 174
19 3300006177 Ga0075362_10026943 Ga0075362_100269433 175
20 3300009148 Ga0105243_11337947 Ga0105243_113379472 175
21 3300014745 Ga0157377_10930897 Ga0157377_109308972 175
22 3300046559 Ga0495667_0126422 Ga0495667_0126422_835_1362 175
23 3300048913 Ga0496110_1205534 Ga0496110_1205534_35_574 175
24 3300050489 nmdc:mga03683_30891_c1 nmdc:mga03683_30891_c1_552_1097 175
25 3300050490 nmdc:mga03n38_31179_c1 nmdc:mga03n38_31179_c1_600_1145 175
26 3300003781 Ga0055536_1018970 Ga0055536_10189702 176
27 3300005327 Ga0070658_10003619 Ga0070658_1000361916 176
28 3300005336 Ga0070680_100050475 Ga0070680_1000504755 176
29 3300005339 Ga0070660_100000914 Ga0070660_10000091416 176
30 3300005341 Ga0070691_10002573 Ga0070691_100025737 176
31 3300005341 Ga0070691_10007718 Ga0070691_100077184 176
32 3300005366 Ga0070659_100060921 Ga0070659_1000609212 176
33 3300005434 Ga0070709_10005190 Ga0070709_100051904 176
34 3300005435 Ga0070714_100010355 Ga0070714_1000103558 176
35 3300005435 Ga0070714_100037568 Ga0070714_1000375683 176
36 3300005436 Ga0070713_100000189 Ga0070713_10000018934 176
37 3300005455 Ga0070663_100032601 Ga0070663_1000326016 176
38 3300005458 Ga0070681_10118480 Ga0070681_101184802 176
39 3300005458 Ga0070681_10322928 Ga0070681_103229281 176
40 3300005468 Ga0070707_100087745 Ga0070707_1000877454 176
41 3300005471 Ga0070698_101072528 Ga0070698_1010725281 176
42 3300005518 Ga0070699_100517151 Ga0070699_1005171512 176
43 3300005530 Ga0070679_100211317 Ga0070679_1002113172 176
44 3300005530 Ga0070679_100352413 Ga0070679_1003524133 176
45 3300005536 Ga0070697_100177806 Ga0070697_1001778062 176
46 3300005539 Ga0068853_100068227 Ga0068853_1000682272 176
47 3300005545 Ga0070695_100152101 Ga0070695_1001521012 176
48 3300005547 Ga0070693_100080856 Ga0070693_1000808562 176
49 3300005548 Ga0070665_100795206 Ga0070665_1007952062 176
50 3300005563 Ga0068855_100004064 Ga0068855_1000040643 176
51 3300005563 Ga0068855_100059872 Ga0068855_1000598727 176
52 3300005564 Ga0070664_100129635 Ga0070664_1001296352 176
53 3300005577 Ga0068857_100002761 Ga0068857_10000276115 176
54 3300005614 Ga0068856_100001854 Ga0068856_1000018548 176
55 3300005614 Ga0068856_100007147 Ga0068856_10000714710 176
56 3300005616 Ga0068852_101137712 Ga0068852_1011377122 176
57 3300005618 Ga0068864_100522006 Ga0068864_1005220062 176
58 3300005842 Ga0068858_100054835 Ga0068858_1000548354 176
59 3300006175 Ga0070712_100001527 Ga0070712_1000015272 176
60 3300006871 Ga0075434_100290178 Ga0075434_1002901782 176
61 3300006914 Ga0075436_100002177 Ga0075436_10000217710 176
62 3300009093 Ga0105240_10023142 Ga0105240_100231428 176
63 3300009094 Ga0111539_10129564 Ga0111539_101295643 176
64 3300009174 Ga0105241_10008033 Ga0105241_100080333 176
65 3300009174 Ga0105241_10592585 Ga0105241_105925852 176
66 3300009545 Ga0105237_10007748 Ga0105237_100077488 176
67 3300009551 Ga0105238_10013490 Ga0105238_100134907 176
68 3300009551 Ga0105238_10117308 Ga0105238_101173086 176
69 3300013100 Ga0157373_10050615 Ga0157373_100506153 176
70 3300013104 Ga0157370_10005804 Ga0157370_100058047 176
71 3300013104 Ga0157370_10023061 Ga0157370_100230612 176
72 3300013104 Ga0157370_10026865 Ga0157370_100268654 176
73 3300013105 Ga0157369_10007922 Ga0157369_100079228 176
74 3300013306 Ga0163162_10042513 Ga0163162_100425132 176
75 3300013307 Ga0157372_10012154 Ga0157372_1001215416 176
76 3300013307 Ga0157372_10020909 Ga0157372_100209094 176
77 3300014968 Ga0157379_10003371 Ga0157379_100033712 176
78 3300014968 Ga0157379_10017038 Ga0157379_100170389 176
79 3300014968 Ga0157379_10108071 Ga0157379_101080714 176
80 3300021361 Ga0213872_10000379 Ga0213872_100003792 176
81 3300025292 Ga0209676_1000261 Ga0209676_100026168 176
82 3300025298 Ga0209050_1016092 Ga0209050_10160922 176
83 3300025906 Ga0207699_10000313 Ga0207699_1000031312 176
84 3300025909 Ga0207705_10001841 Ga0207705_100018414 176
85 3300025912 Ga0207707_10001750 Ga0207707_100017509 176
86 3300025913 Ga0207695_10015141 Ga0207695_100151416 176
87 3300025914 Ga0207671_10036509 Ga0207671_100365096 176
88 3300025915 Ga0207693_10003172 Ga0207693_100031722 176
89 3300025917 Ga0207660_10001100 Ga0207660_1000110012 176
90 3300025919 Ga0207657_10001764 Ga0207657_1000176414 176
91 3300025921 Ga0207652_10001532 Ga0207652_1000153215 176
92 3300025922 Ga0207646_10140890 Ga0207646_101408902 176
93 3300025923 Ga0207681_10396909 Ga0207681_103969092 176
94 3300025924 Ga0207694_10006056 Ga0207694_100060569 176
95 3300025924 Ga0207694_10319612 Ga0207694_103196123 176
96 3300025925 Ga0207650_10385733 Ga0207650_103857332 176
97 3300025928 Ga0207700_10000055 Ga0207700_1000005543 176
98 3300025929 Ga0207664_10009645 Ga0207664_100096452 176
99 3300025932 Ga0207690_10035025 Ga0207690_100350253 176
100 3300025945 Ga0207679_10250307 Ga0207679_102503072 176
101 3300025949 Ga0207667_10004958 Ga0207667_1000495814 176
102 3300025949 Ga0207667_10027805 Ga0207667_100278053 176
103 3300025981 Ga0207640_10208511 Ga0207640_102085111 176
104 3300026035 Ga0207703_10039154 Ga0207703_100391542 176
105 3300026041 Ga0207639_10023725 Ga0207639_100237251 176
106 3300026041 Ga0207639_10053614 Ga0207639_100536144 176
107 3300026041 Ga0207639_10732423 Ga0207639_107324232 176
108 3300026067 Ga0207678_10044220 Ga0207678_100442207 176
109 3300026078 Ga0207702_10000193 Ga0207702_1000019335 176
110 3300026078 Ga0207702_10001279 Ga0207702_1000127920 176
111 3300026078 Ga0207702_10698872 Ga0207702_106988723 176
112 3300026089 Ga0207648_10194409 Ga0207648_101944092 176
113 3300026095 Ga0207676_10462944 Ga0207676_104629442 176
114 3300026116 Ga0207674_10000003 Ga0207674_1000000334 176
115 3300026116 Ga0207674_10433173 Ga0207674_104331731 176
116 3300026142 Ga0207698_10074806 Ga0207698_100748061 176
117 3300028379 Ga0268266_10721804 Ga0268266_107218042 176
118 3300028379 Ga0268266_10963078 Ga0268266_109630782 176
119 3300031727 Ga0316576_10794726 Ga0316576_107947261 176
120 3300031728 Ga0316578_10026995 Ga0316578_100269951 176
121 3300032005 Ga0307411_10513322 Ga0307411_105133222 176
122 3300035172 Ga0373955_0019524 Ga0373955_0019524_1817_2368 176
123 3300035398 Ga0316574_0013168 Ga0316574_0013168_1127_1675 176
124 3300035691 Ga0373931_0182926 Ga0373931_0182926_611_1162 176
125 3300035692 Ga0373935_0213106 Ga0373935_0213106_215_763 176
126 3300035724 Ga0373933_0044555 Ga0373933_0044555_1763_2314 176
127 3300036401 Ga0373937_0498937 Ga0373937_0498937_550_1101 176
128 3300036712 Ga0316584_0041037 Ga0316584_0041037_2790_3338 176
129 3300037068 Ga0373925_0200203 Ga0373925_0200203_828_1379 176
130 3300037312 Ga0395899_0299123 Ga0395899_0299123_499_1053 176
131 3300037418 Ga0395900_0147923 Ga0395900_0147923_482_1036 176
132 3300037466 Ga0395898_0059968 Ga0395898_0059968_1494_2048 176
133 3300037853 Ga0436364_0594698 Ga0436364_0594698_528_1061 176
134 3300038443 Ga0395901_0100606 Ga0395901_0100606_974_1528 176
135 3300039062 Ga0400483_105414 Ga0400483_105414_1785_2327 176
136 3300039062 Ga0400483_248936 Ga0400483_248936_429_971 176
137 3300039437 Ga0436365_0052875 Ga0436365_0052875_441_989 176
138 3300039437 Ga0436365_1198557 Ga0436365_1198557_774_1325 176
139 3300039447 Ga0436361_0217762 Ga0436361_0217762_16_561 176
140 3300039447 Ga0436361_0681087 Ga0436361_0681087_335_880 176
141 3300039447 Ga0436361_0865915 Ga0436361_0865915_254_802 176
142 3300039450 Ga0436363_1579351 Ga0436363_1579351_288_833 176
143 3300039453 Ga0436362_0553624 Ga0436362_0553624_122_673 176
144 3300042012 Ga0439455_0030797 Ga0439455_0030797_169_717 176
145 3300042438 Ga0439459_0004486 Ga0439459_0004486_1459_2007 176
146 3300045836 Ga0466958_0000584 Ga0466958_0000584_7532_8068 176
147 3300046472 Ga0495580_0419723 Ga0495580_0419723_290_841 176
148 3300046675 Ga0495657_0058488 Ga0495657_0058488_136_687 176
149 3300046679 Ga0495623_0052804 Ga0495623_0052804_1764_2315 176
150 3300048905 Ga0496102_1235791 Ga0496102_1235791_11_562 176
151 3300049569 Ga0501032_0130786 Ga0501032_0130786_152_694 176
152 3300049569 Ga0501032_0428413 Ga0501032_0428413_257_787 176
153 3300049570 Ga0501033_0008383 Ga0501033_0008383_7342_7887 176
154 3300049571 Ga0501034_0000205 Ga0501034_0000205_31198_31740 176
155 3300049571 Ga0501034_0715142 Ga0501034_0715142_58_603 176
156 3300049573 Ga0501037_0045562 Ga0501037_0045562_1867_2397 176
157 3300049574 Ga0501038_0045732 Ga0501038_0045732_3201_3746 176
158 3300049574 Ga0501038_0053806 Ga0501038_0053806_2002_2532 176
159 3300049574 Ga0501038_0218597 Ga0501038_0218597_211_741 176
160 3300049574 Ga0501038_0695585 Ga0501038_0695585_32_574 176
161 3300049581 Ga0501047_0125105 Ga0501047_0125105_378_908 176
162 3300049585 Ga0501069_0403552 Ga0501069_0403552_190_720 176
163 3300049586 Ga0501070_0000033 Ga0501070_0000033_90831_91361 176
164 3300049586 Ga0501070_0642438 Ga0501070_0642438_33_578 176
165 3300049742 Ga0501080_0000327 Ga0501080_0000327_31463_31993 176
166 3300049742 Ga0501080_0795217 Ga0501080_0795217_13_570 176
167 3300049822 Ga0501035_0009624 Ga0501035_0009624_8124_8654 176
168 3300049823 Ga0501044_0002575 Ga0501044_0002575_4361_4891 176
169 3300049823 Ga0501044_0035588 Ga0501044_0035588_948_1478 176
170 3300050512 nmdc:mga0n895_85285_c1 nmdc:mga0n895_85285_c1_2279_2830 176
171 3300050514 nmdc:mga08x19_89_c1 nmdc:mga08x19_89_c1_20219_20770 176
172 3300005341 Ga0070691_10417215 Ga0070691_104172151 177
173 3300005458 Ga0070681_10085550 Ga0070681_100855502 177
174 3300005458 Ga0070681_10169713 Ga0070681_101697132 177
175 3300005530 Ga0070679_100027860 Ga0070679_1000278601 177
176 3300005614 Ga0068856_101215899 Ga0068856_1012158992 177
177 3300005844 Ga0068862_101240595 Ga0068862_1012405952 177
178 3300013105 Ga0157369_10012149 Ga0157369_100121495 177
179 3300013307 Ga0157372_11738540 Ga0157372_117385401 177
180 3300025909 Ga0207705_10109141 Ga0207705_101091412 177
181 3300025912 Ga0207707_10082416 Ga0207707_100824161 177
182 3300025921 Ga0207652_10135240 Ga0207652_101352401 177
183 3300025949 Ga0207667_10344353 Ga0207667_103443531 177
184 3300026116 Ga0207674_10653273 Ga0207674_106532731 177
185 3300036401 Ga0373937_0068040 Ga0373937_0068040_2596_3153 177
186 3300006237 Ga0097621_100302417 Ga0097621_1003024172 178
187 3300006358 Ga0068871_100161757 Ga0068871_1001617571 178
188 3300006358 Ga0068871_100365876 Ga0068871_1003658762 178
189 3300013307 Ga0157372_10128243 Ga0157372_101282432 178
190 3300031241 Ga0265325_10135695 Ga0265325_101356952 178
191 3300031712 Ga0265342_10053355 Ga0265342_100533553 178
192 3300037471 Ga0395905_0005437 Ga0395905_0005437_4913_5452 178
193 3300037853 Ga0436364_1190936 Ga0436364_1190936_195_731 178
194 3300038443 Ga0395901_0776412 Ga0395901_0776412_345_884 178
195 iso_pu_bacteria 2791355048 2792458850 178
196 iso_pu_bacteria 2843744320 2843745785 178
197 iso_pu_bacteria 2849560528 2849562301 178
198 3300005340 Ga0070689_100462460 Ga0070689_1004624602 179
199 3300010375 Ga0105239_10260627 Ga0105239_102606273 179
200 3300048912 Ga0496109_0104674 Ga0496109_0104674_204_761 179
201 3300048913 Ga0496110_0172758 Ga0496110_0172758_331_888 179
202 3300048915 Ga0496112_0149529 Ga0496112_0149529_1287_1844 179
203 3300048916 Ga0496113_0424341 Ga0496113_0424341_84_641 179
204 3300050512 nmdc:mga0n895_807512_c1 nmdc:mga0n895_807512_c1_324_881 179
205 iso_pu_bacteria 2582581280 2585151303 179
206 iso_pu_bacteria 2582581293 2585197172 179
207 iso_pu_bacteria 2643221545 2643747721 179
208 iso_pu_bacteria 2643221552 2643780843 179
209 iso_pu_bacteria 2643221584 2643930495 179
210 iso_pu_bacteria 2643221691 2644506896 179
211 iso_pu_bacteria 2739367756 2739792535 179
212 iso_pu_bacteria 2818991435 2819540152 179
213 iso_pu_bacteria 2818991454 2819647050 179
214 iso_pu_bacteria 2849573788 2849577223 179
215 iso_pu_bacteria 2851153111 2851153208 179
216 iso_pu_bacteria 2857504554 2857505839 179
217 iso_pu_bacteria 2884960567 2884963791 179
218 iso_pu_bacteria 2898329390 2898330405 179
219 iso_pu_bacteria 2510917020 2511122208 180
220 iso_pu_bacteria 2582581279 2585149870 180
221 iso_pu_bacteria 2585428106 2587919901 180
222 iso_pu_bacteria 2643221583 2643926831 180
223 iso_pu_bacteria 2643221640 2644223468 180
224 iso_pu_bacteria 2643221642 2644237210 180
225 iso_pu_bacteria 2928531327 2928532047 180
226 3300031235 Ga0265330_10182430 Ga0265330_101824302 181
227 3300031241 Ga0265325_10005432 Ga0265325_100054322 181
228 3300031247 Ga0265340_10255945 Ga0265340_102559452 181
229 3300031249 Ga0265339_10004149 Ga0265339_1000414916 181
230 3300031711 Ga0265314_10004762 Ga0265314_1000476216 181
231 3300049570 Ga0501033_0005521 Ga0501033_0005521_2812_3390 181
232 3300049573 Ga0501037_0064899 Ga0501037_0064899_1238_1816 181
233 3300049823 Ga0501044_0000592 Ga0501044_0000592_38046_38624 181
234 3300053096 Ga0500641_0000623 Ga0500641_0000623_3395_3940 181
235 3300003322 rootL2_10009868 rootL2_100098683 182
236 3300003323 rootH1_10037398 rootH1_100373982 182
237 3300005262 Ga0065165_1010924 Ga0065165_10109241 182
238 3300005335 Ga0070666_10534435 Ga0070666_105344352 182
239 3300005435 Ga0070714_100224014 Ga0070714_1002240142 182
240 3300005543 Ga0070672_100842968 Ga0070672_1008429682 182
241 3300005614 Ga0068856_100767856 Ga0068856_1007678562 182
242 3300009093 Ga0105240_10004588 Ga0105240_100045889 182
243 3300009093 Ga0105240_10007152 Ga0105240_100071528 182
244 3300009093 Ga0105240_10007161 Ga0105240_100071618 182
245 3300009545 Ga0105237_10006786 Ga0105237_100067863 182
246 3300009551 Ga0105238_10062940 Ga0105238_100629402 182
247 3300010375 Ga0105239_10116956 Ga0105239_101169563 182
248 3300013105 Ga0157369_10322648 Ga0157369_103226482 182
249 3300025299 Ga0209256_1019114 Ga0209256_10191143 182
250 3300025909 Ga0207705_10303198 Ga0207705_103031982 182
251 3300025913 Ga0207695_10014728 Ga0207695_100147289 182
252 3300025913 Ga0207695_10078007 Ga0207695_100780073 182
253 3300025913 Ga0207695_10088074 Ga0207695_100880742 182
254 3300025914 Ga0207671_10132935 Ga0207671_101329352 182
255 3300025915 Ga0207693_10180099 Ga0207693_101800992 182
256 3300025919 Ga0207657_10152018 Ga0207657_101520182 182
257 3300025921 Ga0207652_10151924 Ga0207652_101519242 182
258 3300025924 Ga0207694_10053967 Ga0207694_100539672 182
259 3300025949 Ga0207667_10023616 Ga0207667_100236165 182
260 3300028556 Ga0265337_1008718 Ga0265337_10087182 182
261 3300028800 Ga0265338_10017032 Ga0265338_100170327 182
262 3300032004 Ga0307414_10109335 Ga0307414_101093352 182
263 3300037312 Ga0395899_0271258 Ga0395899_0271258_401_958 182
264 3300037418 Ga0395900_0080029 Ga0395900_0080029_1595_2152 182
265 3300037466 Ga0395898_0039768 Ga0395898_0039768_1568_2125 182
266 3300037471 Ga0395905_0000022 Ga0395905_0000022_210796_211359 182
267 3300039447 Ga0436361_0443049 Ga0436361_0443049_545_1096 182
268 3300044658 Ga0466972_0124267 Ga0466972_0124267_274_837 182
269 3300045049 Ga0466959_0097162 Ga0466959_0097162_307_870 182
270 3300049570 Ga0501033_0026774 Ga0501033_0026774_1534_2097 182
271 3300049580 Ga0501046_0574314 Ga0501046_0574314_91_654 182
272 3300049581 Ga0501047_0009411 Ga0501047_0009411_3552_4115 182
273 3300049823 Ga0501044_0038261 Ga0501044_0038261_1022_1585 182
274 3300053108 Ga0500562_000349 Ga0500562_000349_7993_8541 182
275 3300053119 Ga0500595_038707 Ga0500595_038707_70_618 182
276 3300053730 Ga0500645_001826 Ga0500645_001826_6247_6795 182
277 3300003322 rootL2_10043368 rootL2_100433683 183
278 3300003771 Ga0055526_1040699 Ga0055526_10406992 183
279 3300003773 Ga0055537_1009043 Ga0055537_10090434 183
280 3300003775 Ga0055524_1005249 Ga0055524_10052493 183
281 3300003775 Ga0055524_1020526 Ga0055524_10205261 183
282 3300003794 Ga0055531_10006615 Ga0055531_100066157 183
283 3300005262 Ga0065165_1000345 Ga0065165_100034554 183
284 3300005336 Ga0070680_100227363 Ga0070680_1002273633 183
285 3300005347 Ga0070668_100032800 Ga0070668_1000328004 183
286 3300005458 Ga0070681_10276748 Ga0070681_102767484 183
287 3300005563 Ga0068855_100169204 Ga0068855_1001692042 183
288 3300005616 Ga0068852_100060226 Ga0068852_1000602263 183
289 3300005843 Ga0068860_100337608 Ga0068860_1003376083 183
290 3300009093 Ga0105240_10044701 Ga0105240_100447018 183
291 3300013104 Ga0157370_10092638 Ga0157370_100926382 183
292 3300013105 Ga0157369_10410315 Ga0157369_104103153 183
293 3300013307 Ga0157372_10388797 Ga0157372_103887973 183
294 3300025263 Ga0209565_1000192 Ga0209565_100019214 183
295 3300025263 Ga0209565_1000416 Ga0209565_100041620 183
296 3300025273 Ga0209673_1001784 Ga0209673_100178410 183
297 3300025291 Ga0209675_1004310 Ga0209675_10043104 183
298 3300025295 Ga0209564_1001173 Ga0209564_100117310 183
299 3300025295 Ga0209564_1016064 Ga0209564_10160645 183
300 3300025297 Ga0209758_1000917 Ga0209758_100091723 183
301 3300025298 Ga0209050_1045230 Ga0209050_10452303 183
302 3300025299 Ga0209256_1002646 Ga0209256_100264614 183
303 3300025299 Ga0209256_1005783 Ga0209256_10057834 183
304 3300025304 Ga0209257_1001835 Ga0209257_10018357 183
305 3300025912 Ga0207707_10180214 Ga0207707_101802144 183
306 3300025913 Ga0207695_10012685 Ga0207695_100126859 183
307 3300025937 Ga0207669_10581530 Ga0207669_105815302 183
308 3300025972 Ga0207668_10002763 Ga0207668_100027634 183
309 3300026142 Ga0207698_10059086 Ga0207698_100590862 183
310 3300028380 Ga0268265_10046353 Ga0268265_100463531 183
311 3300030521 Ga0307511_10287518 Ga0307511_102875181 183
312 3300031456 Ga0307513_10000127 Ga0307513_1000012764 183
313 3300031456 Ga0307513_10002443 Ga0307513_1000244319 183
314 3300031548 Ga0307408_100556568 Ga0307408_1005565682 183
315 3300039437 Ga0436365_0596913 Ga0436365_0596913_176_730 183
316 3300041512 Ga0451853_0560300 Ga0451853_0560300_530_1081 183
317 3300042436 Ga0439435_0010166 Ga0439435_0010166_1511_2062 183
318 3300046460 Ga0495638_0000972 Ga0495638_0000972_3988_4539 183
319 3300046460 Ga0495638_0002308 Ga0495638_0002308_12324_12875 183
320 3300046471 Ga0495650_0000468 Ga0495650_0000468_1333_1884 183
321 3300046492 Ga0495585_0018010 Ga0495585_0018010_1090_1641 183
322 3300046512 Ga0495610_0000663 Ga0495610_0000663_20574_21125 183
323 3300046513 Ga0495616_0000747 Ga0495616_0000747_2531_3082 183
324 3300046513 Ga0495616_0134119 Ga0495616_0134119_169_720 183
325 3300046515 Ga0495620_0025962 Ga0495620_0025962_1218_1769 183
326 3300046519 Ga0495632_0002517 Ga0495632_0002517_12863_13414 183
327 3300046520 Ga0495637_0003037 Ga0495637_0003037_6584_7135 183
328 3300046522 Ga0495643_0288941 Ga0495643_0288941_70_621 183
329 3300046524 Ga0495648_0000191 Ga0495648_0000191_23061_23612 183
330 3300046524 Ga0495648_0252215 Ga0495648_0252215_186_737 183
331 3300046525 Ga0495663_0043846 Ga0495663_0043846_342_893 183
332 3300046530 Ga0495654_0010175 Ga0495654_0010175_3508_4059 183
333 3300046660 Ga0495625_0009565 Ga0495625_0009565_2607_3158 183
334 3300046660 Ga0495625_0014695 Ga0495625_0014695_3087_3638 183
335 3300046660 Ga0495625_0056994 Ga0495625_0056994_1798_2349 183
336 3300046691 Ga0495670_0289096 Ga0495670_0289096_211_762 183
337 3300046810 Ga0495660_0092613 Ga0495660_0092613_272_823 183
338 3300047320 Ga0495672_0001471 Ga0495672_0001471_18970_19521 183
339 3300047469 Ga0495673_0000433 Ga0495673_0000433_22715_23266 183
340 3300047469 Ga0495673_0002747 Ga0495673_0002747_10229_10780 183
341 3300047470 Ga0495681_0013308 Ga0495681_0013308_3268_3822 183
342 3300047470 Ga0495681_0195182 Ga0495681_0195182_33_584 183
343 3300048909 Ga0496106_0147913 Ga0496106_0147913_141_692 183
344 3300048918 Ga0496115_0016590 Ga0496115_0016590_2806_3357 183
345 3300048924 Ga0496121_0167274 Ga0496121_0167274_556_1107 183
346 3300048927 Ga0496124_0211254 Ga0496124_0211254_327_878 183
347 3300048928 Ga0496125_0080930 Ga0496125_0080930_1915_2466 183
348 3300048929 Ga0496126_0009275 Ga0496126_0009275_449_1000 183
349 3300049574 Ga0501038_0804855 Ga0501038_0804855_82_636 183
350 3300049671 Ga0501238_000522 Ga0501238_000522_1988_2539 183
351 3300049671 Ga0501238_002142 Ga0501238_002142_167_718 183
352 3300053087 Ga0500643_018024 Ga0500643_018024_969_1520 183
353 3300053088 Ga0500644_0000058 Ga0500644_0000058_38372_38923 183
354 3300053102 Ga0500554_000867 Ga0500554_000867_2164_2718 183
355 3300053103 Ga0500555_033290 Ga0500555_033290_347_898 183
356 3300053104 Ga0500556_0000300 Ga0500556_0000300_18082_18633 183
357 3300053111 Ga0500572_016345 Ga0500572_016345_900_1460 183
358 3300053122 Ga0500608_000069 Ga0500608_000069_27098_27649 183
359 3300053134 Ga0500658_0002593 Ga0500658_0002593_3559_4110 183
360 3300053136 Ga0500559_0000277 Ga0500559_0000277_13533_14084 183
361 3300053136 Ga0500559_0000279 Ga0500559_0000279_19224_19778 183
362 3300053136 Ga0500559_0017377 Ga0500559_0017377_457_1008 183
363 3300053138 Ga0500564_000038 Ga0500564_000038_22408_22959 183
364 3300053156 Ga0500622_0034458 Ga0500622_0034458_963_1514 183
365 3300053158 Ga0500627_0063348 Ga0500627_0063348_25_576 183
366 3300053731 Ga0500609_000049 Ga0500609_000049_12317_12868 183
367 3300053733 Ga0500552_062352 Ga0500552_062352_74_634 183
368 3300003320 rootH2_10157629 rootH2_101576292 184
369 3300003781 Ga0055536_1000500 Ga0055536_100050020 184
370 3300003781 Ga0055536_1000535 Ga0055536_100053519 184
371 3300003791 Ga0055530_10000803 Ga0055530_1000080313 184
372 3300003791 Ga0055530_10003327 Ga0055530_100033278 184
373 3300003794 Ga0055531_10000329 Ga0055531_1000032930 184
374 3300005539 Ga0068853_100087026 Ga0068853_1000870265 184
375 3300005844 Ga0068862_100057317 Ga0068862_1000573174 184
376 3300006195 Ga0075366_10069307 Ga0075366_100693072 184
377 3300010375 Ga0105239_10149489 Ga0105239_101494892 184
378 3300015684 Ga0183365_10001 Ga0183365_10001201 184
379 3300025292 Ga0209676_1000376 Ga0209676_100037616 184
380 3300025292 Ga0209676_1000615 Ga0209676_100061536 184
381 3300025292 Ga0209676_1053621 Ga0209676_10536212 184
382 3300025295 Ga0209564_1041022 Ga0209564_10410222 184
383 3300025298 Ga0209050_1000515 Ga0209050_100051543 184
384 3300025298 Ga0209050_1000737 Ga0209050_100073720 184
385 3300025299 Ga0209256_1007560 Ga0209256_10075604 184
386 3300025303 Ga0209051_1000637 Ga0209051_100063726 184
387 3300025304 Ga0209257_1000698 Ga0209257_100069836 184
388 3300025304 Ga0209257_1003447 Ga0209257_10034476 184
389 3300025913 Ga0207695_10002278 Ga0207695_1000227816 184
390 3300026035 Ga0207703_11208329 Ga0207703_112083292 184
391 3300026041 Ga0207639_10096275 Ga0207639_100962752 184
392 3300028794 Ga0307515_10011587 Ga0307515_100115874 184
393 3300028794 Ga0307515_10040884 Ga0307515_1004088411 184
394 3300028794 Ga0307515_10059114 Ga0307515_100591144 184
395 3300031250 Ga0265331_10086528 Ga0265331_100865283 184
396 3300031251 Ga0265327_10000757 Ga0265327_1000075745 184
397 3300031456 Ga0307513_10381032 Ga0307513_103810321 184
398 3300037312 Ga0395899_0000013 Ga0395899_0000013_183401_183955 184
399 3300041413 Ga0439465_0023693 Ga0439465_0023693_21_575 184
400 3300042004 Ga0439445_0049981 Ga0439445_0049981_449_1003 184
401 3300044656 Ga0466969_0007030 Ga0466969_0007030_2596_3165 184
402 3300044683 Ga0466965_0241425 Ga0466965_0241425_226_780 184
403 3300044684 Ga0466966_0000195 Ga0466966_0000195_6673_7242 184
404 3300044693 Ga0466961_0018259 Ga0466961_0018259_406_975 184
405 3300044694 Ga0466963_0017602 Ga0466963_0017602_455_1024 184
406 3300044719 Ga0466971_0002249 Ga0466971_0002249_1338_1907 184
407 3300044765 Ga0466970_0022555 Ga0466970_0022555_1104_1673 184
408 3300044842 Ga0466957_0030236 Ga0466957_0030236_1297_1866 184
409 3300044901 Ga0466960_0105665 Ga0466960_0105665_331_885 184
410 3300045049 Ga0466959_0022315 Ga0466959_0022315_1017_1586 184
411 3300045836 Ga0466958_0022648 Ga0466958_0022648_2596_3165 184
412 3300046453 Ga0495627_001445 Ga0495627_001445_10000_10554 184
413 3300046457 Ga0495590_0000421 Ga0495590_0000421_9353_9907 184
414 3300046460 Ga0495638_0000185 Ga0495638_0000185_75920_76474 184
415 3300046460 Ga0495638_0000639 Ga0495638_0000639_19578_20132 184
416 3300046460 Ga0495638_0001365 Ga0495638_0001365_11785_12339 184
417 3300046460 Ga0495638_0098201 Ga0495638_0098201_813_1367 184
418 3300046471 Ga0495650_0036678 Ga0495650_0036678_498_1052 184
419 3300046471 Ga0495650_0065713 Ga0495650_0065713_402_956 184
420 3300046506 Ga0495583_0000003 Ga0495583_0000003_414448_415005 184
421 3300046512 Ga0495610_0000985 Ga0495610_0000985_23431_23985 184
422 3300046512 Ga0495610_0009070 Ga0495610_0009070_2292_2846 184
423 3300046518 Ga0495631_0047264 Ga0495631_0047264_761_1315 184
424 3300046520 Ga0495637_0012594 Ga0495637_0012594_2221_2775 184
425 3300046525 Ga0495663_0201017 Ga0495663_0201017_86_640 184
426 3300046530 Ga0495654_0115680 Ga0495654_0115680_166_720 184
427 3300046537 Ga0495598_0068095 Ga0495598_0068095_408_974 184
428 3300046539 Ga0495621_0061408 Ga0495621_0061408_291_857 184
429 3300046542 Ga0495597_0049682 Ga0495597_0049682_236_790 184
430 3300046542 Ga0495597_0080252 Ga0495597_0080252_526_1080 184
431 3300046616 Ga0495668_0002216 Ga0495668_0002216_8751_9305 184
432 3300046616 Ga0495668_0008293 Ga0495668_0008293_179_733 184
433 3300046660 Ga0495625_0000152 Ga0495625_0000152_29915_30469 184
434 3300046660 Ga0495625_0001773 Ga0495625_0001773_20828_21382 184
435 3300046691 Ga0495670_0415742 Ga0495670_0415742_133_687 184
436 3300046794 Ga0495589_0007253 Ga0495589_0007253_2057_2611 184
437 3300047446 Ga0495679_009455 Ga0495679_009455_518_1072 184
438 3300047469 Ga0495673_0000312 Ga0495673_0000312_21782_22336 184
439 3300047472 Ga0495686_0000850 Ga0495686_0000850_16978_17532 184
440 3300047472 Ga0495686_0135111 Ga0495686_0135111_750_1343 184
441 3300047472 Ga0495686_0254963 Ga0495686_0254963_83_637 184
442 3300048909 Ga0496106_0002485 Ga0496106_0002485_12605_13159 184
443 3300048910 Ga0496107_0000209 Ga0496107_0000209_16043_16597 184
444 3300048924 Ga0496121_0003463 Ga0496121_0003463_16206_16760 184
445 3300048927 Ga0496124_0112603 Ga0496124_0112603_671_1225 184
446 3300048927 Ga0496124_0318642 Ga0496124_0318642_393_947 184
447 3300049459 Ga0495678_002738 Ga0495678_002738_7672_8226 184
448 3300049568 Ga0501031_0444866 Ga0501031_0444866_186_755 184
449 3300049569 Ga0501032_0292254 Ga0501032_0292254_400_969 184
450 3300049570 Ga0501033_0076340 Ga0501033_0076340_1623_2192 184
451 3300049571 Ga0501034_0076797 Ga0501034_0076797_1354_1980 184
452 3300049572 Ga0501036_0250982 Ga0501036_0250982_609_1178 184
453 3300049578 Ga0501042_0363358 Ga0501042_0363358_222_779 184
454 3300049581 Ga0501047_0059813 Ga0501047_0059813_2736_3305 184
455 3300049822 Ga0501035_0021699 Ga0501035_0021699_1354_1923 184
456 3300050493 nmdc:mga0k408_197179_c1 nmdc:mga0k408_197179_c1_236_790 184
457 3300053080 Ga0500635_0000495 Ga0500635_0000495_2189_2758 184
458 3300053086 Ga0500578_0000015 Ga0500578_0000015_131384_131938 184
459 3300053088 Ga0500644_0010721 Ga0500644_0010721_53_607 184
460 3300053103 Ga0500555_036589 Ga0500555_036589_60_614 184
461 3300053104 Ga0500556_0090781 Ga0500556_0090781_392_946 184
462 3300053105 Ga0500557_169918 Ga0500557_169918_62_634 184
463 3300053108 Ga0500562_000218 Ga0500562_000218_2352_2906 184
464 3300053118 Ga0500594_0000085 Ga0500594_0000085_11199_11753 184
465 3300053122 Ga0500608_000990 Ga0500608_000990_5671_6264 184
466 3300053125 Ga0500618_000205 Ga0500618_000205_25432_25986 184
467 3300053142 Ga0500577_0000406 Ga0500577_0000406_8019_8573 184
468 3300053156 Ga0500622_0001371 Ga0500622_0001371_7803_8357 184
469 3300053156 Ga0500622_0023855 Ga0500622_0023855_458_1012 184
470 3300053727 Ga0500611_025057 Ga0500611_025057_328_882 184
471 3300053730 Ga0500645_037941 Ga0500645_037941_486_1058 184
472 3300061719 Ga0466962_0001996 Ga0466962_0001996_8629_9198 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

48

191

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9412 11 173
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9399 11 176
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9209 19 184
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.913 11 176
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.8991 19 184
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9389 11 176 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9238 19 181 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9116 11 176 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.89 19 181 3.40.980.10
af_Q57631_3_163_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.8746 19 184 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0V2F7T8-F1-model_v4 deleted 0.9768 4 184
AF-A0A2E0U6B2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9754 10 184 GO:0005829
GO:0006777
AF-A0A2D7IV39-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9732 10 184 GO:0005829
GO:0006777
AF-A0A2S7K322-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9722 10 184 GO:0005829
GO:0006777
AF-A0A520XJK7-F1-model_v4 deleted 0.9721 10 184

Feature Viewer

pLDDT pTM Quality
90.26 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map