metagRoot

F450790

General Info

Members	Datasets	Scaffolds	Average Seq Length
472	282	452	409

Family's Representative Sequence

Representative Sequence	3300009101\|Ga0105247_10001770\|Ga0105247_100017701
Length	454
Sequence	LSSRFRLGAKEEDCGSRVKHGATLDMIGGRRDDRHMTGMFHPRRRDLFAGAAAAGLAAMLPMRGLAAGPALAPLTGGVVPIGVAERTRRIERAQALMAEHGIGAVLIEPGASLTYFTGVQWHRSERLTAAVLPSKGEALIVTPFFEEPSVRETLAIPAEVRVWQEHESPLALIADWLRARKLQDGLIGIEETVRFFASNGLASALAGARFVSADPVVRGCRMIKSPAEIALMKTAADVTIAAYAHTWKRIEVGMTPKDIGAIMNDATRALGGDPEFALILLGEASAYPHGSGKPQAVRPGEVVLMDCGCTVEGYQSDISRSFVFGEPTAEQRKVWTHVREGQEIAFGAAKIGAPAGSVDDAVRRHYEKLGYGPGYRLPGLSHRTGHGIGLDGHEPVNFVHGEATRLAPGMCFSDEPGLYLPGQFGIRLEDCLHMTDTGPAWFSVPPPSIDRPFG

Samples

	Sample ID	Description	Type	Environment
1	2512564014	Sphingobium sp. AP49	Isolate	Rhizosphere
2	2582581305	Rhizorhabdus wittichii YR128	Isolate	Rhizosphere
3	2643221541	Sphingomonas sp. Root50	Isolate	Unclassified
4	2643221560	Sphingopyxis sp. Root1497	Isolate	Unclassified
5	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
6	2643221606	Sphingomonas sp. Root720	Isolate	Unclassified
7	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
8	2643221622	Sphingomonas sp. Root241	Isolate	Unclassified
9	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
10	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
11	2643221671	Sphingomonas sp. Root1294	Isolate	Unclassified
12	2830075706	Sphingomonas jinjuensis DSM 21457	Isolate	Rhizosphere
13	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
14	2852653556	Sphingopyxis sp. JAI108	Isolate	Rhizosphere
15	2852680915	Sphingopyxis sp. JAI128	Isolate	Rhizosphere
16	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
17	2896429255	Sphingomonas rhizophila KACC 19189	Isolate	Rhizosphere
18	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
19	2990265787	Sphingomonas sp. SORGH_AS802	Isolate	Aerial Root
20	2993693658	Sphingomonas sp. SORGH_AS438	Isolate	Aerial Root
21	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
22	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
23	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
24	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
25	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
26	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
27	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
28	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
29	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
30	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
31	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
32	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
33	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
34	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
35	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
36	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
37	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
38	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
39	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
40	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
41	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
42	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
43	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
44	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
45	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
46	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
47	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
48	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
49	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
50	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
51	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
52	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
53	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
54	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
55	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
56	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
57	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
58	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
59	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
60	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
61	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
62	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
63	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
64	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
65	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
66	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
67	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
68	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
69	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
70	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
71	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
72	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
73	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
74	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
75	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
76	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
77	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
78	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
79	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
80	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
81	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
82	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
83	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
84	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
87	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
91	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
92	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
101	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
102	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
103	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
104	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
106	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
107	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
108	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
114	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
117	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
163	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
164	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
165	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
166	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
167	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
168	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
169	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
170	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
171	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
172	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
173	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
174	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
175	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
176	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
177	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
178	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
179	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
180	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
181	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
182	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
183	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
184	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
185	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
186	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
187	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
188	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
189	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
190	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
191	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
192	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
193	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
194	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
195	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
196	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
197	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
198	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
199	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
200	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
201	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
202	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
203	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
204	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
205	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
206	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
207	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
208	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
209	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
210	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
211	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
212	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
213	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
214	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
215	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
216	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
217	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
218	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
219	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
220	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
221	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
222	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
223	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
224	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
240	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
241	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
242	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
243	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
248	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
252	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
253	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
254	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
255	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
256	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
257	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
258	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
259	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
260	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
261	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
262	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
263	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
264	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
265	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
266	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
267	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
268	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
269	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
270	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
271	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
272	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
273	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
274	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
275	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
276	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
277	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
278	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
279	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
280	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
281	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
282	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.34
Metatranscriptomes	0.42
Isolates	4.24

Biome Distribution

Category	Percentage (%)
Aerial Root	0.42
Bulb	0
Endosphere	18.01
Nodule	0
Rhizoplane	1.27
Rhizosphere	73.31
Stem	0
Stem Tuber	0
Unclassified	6.99

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25150J39212_1000657	3300002774	Bacteria	12838
2	JGI25153J46596_10000266	3300003215	Bacteria	41550
3	rootL2_10112799	3300003322	Bacteria	4192
4	Ga0055526_1004679	3300003771	Bacteria	8128
5	Ga0055537_1000644	3300003773	Bacteria	18527
6	Ga0055524_1000255	3300003775	Bacteria	54719
7	Ga0055536_1003622	3300003781	Bacteria	8241
8	Ga0055536_1005303	3300003781	Bacteria	6341
9	Ga0055536_1020943	3300003781	Bacteria	2002
10	Ga0055530_10002187	3300003791	Bacteria	12936
11	Ga0055530_10006500	3300003791	Bacteria	5203
12	Ga0055530_10006595	3300003791	Bacteria	5138
13	Ga0055540_1000692	3300003792	Bacteria	23249
14	Ga0055531_10000444	3300003794	Bacteria	38720
15	Ga0055531_10003574	3300003794	Bacteria	9858
16	Ga0055531_10011654	3300003794	Bacteria	4213
17	Ga0065165_1000103	3300005262	Bacteria	140705
18	Ga0065165_1008797	3300005262	Bacteria	4651
19	Ga0065165_1011132	3300005262	Bacteria	3794
20	Ga0070676_10065916	3300005328	Bacteria	2163
21	Ga0070676_10071287	3300005328	Bacteria	2087
22	Ga0070690_100002243	3300005330	Bacteria	10362
23	Ga0070670_100025390	3300005331	Bacteria	5099
24	Ga0070677_10002451	3300005333	Bacteria	5932
25	Ga0070677_10017871	3300005333	Bacteria	2546
26	Ga0068869_100001173	3300005334	Bacteria	15377
27	Ga0070666_10108110	3300005335	Bacteria	1922
28	Ga0070680_100000396	3300005336	Bacteria	29609
29	Ga0068868_100000090	3300005338	Bacteria	55967
30	Ga0068868_100030953	3300005338	Bacteria	4106
31	Ga0070660_100001190	3300005339	Bacteria	17641
32	Ga0070689_100002757	3300005340	Bacteria	11526
33	Ga0070661_100000010	3300005344	Bacteria	175777
34	Ga0070661_100003125	3300005344	Bacteria	11393
35	Ga0070675_100014403	3300005354	Bacteria	6235
36	Ga0070675_100022866	3300005354	Bacteria	4995
37	Ga0070675_100029462	3300005354	Bacteria	4428
38	Ga0070674_100020901	3300005356	Bacteria	4192
39	Ga0070674_100022054	3300005356	Bacteria	4102
40	Ga0070673_100004230	3300005364	Bacteria	9057
41	Ga0070673_100024557	3300005364	Bacteria	4422
42	Ga0070673_100031130	3300005364	Bacteria	4001
43	Ga0070688_100005234	3300005365	Bacteria	6816
44	Ga0070688_100036850	3300005365	Bacteria	2977
45	Ga0070659_100000017	3300005366	Bacteria	163966
46	Ga0070667_100000114	3300005367	Bacteria	103351
47	Ga0070709_10007222	3300005434	Bacteria	6086
48	Ga0070701_10022762	3300005438	Bacteria	3008
49	Ga0070705_100003967	3300005440	Bacteria	7231
50	Ga0070700_100010356	3300005441	Bacteria	5146
51	Ga0070700_100021034	3300005441	Bacteria	3789
52	Ga0070700_100180090	3300005441	Bacteria	1470
53	Ga0070662_100002203	3300005457	Bacteria	11957
54	Ga0070662_100048283	3300005457	Bacteria	3066
55	Ga0070681_10120556	3300005458	Bacteria	2558
56	Ga0068867_100008204	3300005459	Bacteria	7378
57	Ga0070685_10011508	3300005466	Bacteria	4631
58	Ga0070679_100000005	3300005530	Bacteria	263201
59	Ga0070684_100005188	3300005535	Bacteria	9963
60	Ga0068853_100036735	3300005539	Bacteria	4167
61	Ga0068853_100322135	3300005539	Bacteria	1433
62	Ga0070672_100002415	3300005543	Bacteria	11837
63	Ga0070672_100019792	3300005543	Bacteria	4894
64	Ga0070672_100155572	3300005543	Bacteria	1893
65	Ga0070686_100001792	3300005544	Bacteria	11974
66	Ga0070695_100014402	3300005545	Bacteria	4767
67	Ga0070696_100113952	3300005546	Bacteria	1950
68	Ga0070665_100010037	3300005548	Bacteria	9579
69	Ga0070665_100015177	3300005548	Bacteria	7735
70	Ga0070665_100306026	3300005548	Bacteria	1593
71	Ga0070664_100000656	3300005564	Bacteria	26434
72	Ga0070702_100000479	3300005615	Bacteria	14318
73	Ga0070702_100001394	3300005615	Bacteria	9882
74	Ga0068852_100029061	3300005616	Bacteria	4535
75	Ga0068859_100001219	3300005617	Bacteria	26247
76	Ga0068859_100032412	3300005617	Bacteria	5250
77	Ga0068859_100065050	3300005617	Bacteria	3680
78	Ga0068859_100071022	3300005617	Bacteria	3517
79	Ga0068859_100472769	3300005617	Bacteria	1349
80	Ga0068864_100015357	3300005618	Bacteria	6367
81	Ga0068864_100016662	3300005618	Bacteria	6123
82	Ga0068866_10027922	3300005718	Bacteria	2684
83	Ga0068861_100001118	3300005719	Bacteria	16634
84	Ga0068861_100003115	3300005719	Bacteria	10956
85	Ga0068861_100010635	3300005719	Bacteria	6389
86	Ga0068861_100033787	3300005719	Bacteria	3776
87	Ga0068870_10000854	3300005840	Bacteria	11890
88	Ga0068870_10083825	3300005840	Bacteria	1768
89	Ga0068863_100006657	3300005841	Bacteria	11339
90	Ga0068863_100185125	3300005841	Bacteria	2000
91	Ga0068858_100054713	3300005842	Bacteria	3690
92	Ga0068860_100000172	3300005843	Bacteria	106249
93	Ga0068860_100029338	3300005843	Bacteria	5290
94	Ga0068860_100148940	3300005843	Bacteria	2253
95	Ga0068862_100000173	3300005844	Bacteria	71977
96	Ga0068862_100001154	3300005844	Bacteria	24972
97	Ga0068862_100010097	3300005844	Bacteria	7794
98	Ga0075368_10000480	3300006042	Bacteria	11830
99	Ga0075363_100065255	3300006048	Bacteria	1968
100	Ga0075367_10000387	3300006178	Bacteria	15983
101	Ga0075370_10008456	3300006353	Bacteria	5297
102	Ga0068871_100011926	3300006358	Bacteria	6398
103	Ga0068871_100046836	3300006358	Bacteria	3484
104	Ga0075430_100004465	3300006846	Bacteria	11801
105	Ga0075430_100019486	3300006846	Bacteria	5769
106	Ga0075431_100054461	3300006847	Bacteria	4125
107	Ga0075431_100108540	3300006847	Bacteria	2864
108	Ga0097620_100001184	3300006931	Bacteria	26620
109	Ga0097620_100001219	3300006931	Bacteria	26247
110	Ga0097620_100032412	3300006931	Bacteria	5250
111	Ga0097620_100065047	3300006931	Bacteria	3680
112	Ga0097620_100071022	3300006931	Bacteria	3517
113	Ga0097620_100472873	3300006931	Bacteria	1349
114	Ga0111539_10009098	3300009094	Bacteria	12572
115	Ga0111539_10079449	3300009094	Bacteria	3859
116	Ga0111539_10149900	3300009094	Bacteria	2730
117	Ga0105247_10001770	3300009101	Bacteria	15190
118	Ga0114129_10009440	3300009147	Bacteria	13905
119	Ga0105248_10004916	3300009177	Bacteria	14764
120	Ga0105248_10011005	3300009177	Bacteria	9980
121	Ga0105249_10000037	3300009553	Bacteria	197428
122	Ga0105239_10437905	3300010375	Unclassified	1482
123	Ga0105246_10212173	3300011119	Bacteria	1512
124	Ga0157369_10001604	3300013105	Bacteria	27701
125	Ga0157375_10114971	3300013308	Bacteria	2793
126	Ga0157375_10313653	3300013308	Bacteria	1732
127	Ga0163163_10179169	3300014325	Bacteria	2166
128	Ga0157380_10007494	3300014326	Bacteria	7749
129	Ga0157380_10020341	3300014326	Bacteria	4959
130	Ga0157380_10045603	3300014326	Bacteria	3441
131	Ga0157380_10281422	3300014326	Bacteria	1522
132	Ga0157380_10384090	3300014326	Bacteria	1326
133	Ga0157377_10022848	3300014745	Bacteria	3308
134	Ga0157379_10223727	3300014968	Bacteria	1705
135	Ga0157376_10062960	3300014969	Bacteria	3123
136	Ga0163161_10066577	3300017792	Bacteria	2631
137	Ga0163161_10167328	3300017792	Bacteria	1679
138	Ga0206354_10508836	3300020081	Bacteria	4195
139	Ga0206353_11353765	3300020082	Bacteria	5137
140	Ga0213873_10000006	3300021358	Bacteria	408723
141	Ga0213876_10000004	3300021384	Bacteria	943822
142	Ga0213876_10000123	3300021384	Bacteria	84497
143	Ga0209147_100442	3300025229	Bacteria	26409
144	Ga0207425_1000114	3300025245	Bacteria	77043
145	Ga0209026_1001629	3300025250	Bacteria	9547
146	Ga0209129_1004131	3300025258	Bacteria	5885
147	Ga0209565_1000010	3300025263	Bacteria	687724
148	Ga0209565_1000298	3300025263	Bacteria	47155
149	Ga0209673_1006185	3300025273	Bacteria	5853
150	Ga0209673_1012044	3300025273	Bacteria	3515
151	Ga0209675_1000138	3300025291	Bacteria	98074
152	Ga0209676_1000155	3300025292	Bacteria	165151
153	Ga0209676_1000175	3300025292	Bacteria	153258
154	Ga0209676_1002382	3300025292	Bacteria	13499
155	Ga0209676_1007714	3300025292	Bacteria	4975
156	Ga0209676_1027197	3300025292	Bacteria	1804
157	Ga0209025_1001326	3300025294	Bacteria	33497
158	Ga0209564_1001139	3300025295	Bacteria	31226
159	Ga0209564_1012171	3300025295	Bacteria	3774
160	Ga0209758_1000004	3300025297	Bacteria	1375322
161	Ga0209758_1001365	3300025297	Bacteria	29147
162	Ga0209050_1000001	3300025298	Bacteria	3563507
163	Ga0209050_1000026	3300025298	Bacteria	499134
164	Ga0209050_1000038	3300025298	Bacteria	412635
165	Ga0209050_1001472	3300025298	Bacteria	25156
166	Ga0209050_1002895	3300025298	Bacteria	13504
167	Ga0209050_1004499	3300025298	Bacteria	9379
168	Ga0209050_1009719	3300025298	Bacteria	4872
169	Ga0209256_1000034	3300025299	Bacteria	388475
170	Ga0207426_1018235	3300025302	Bacteria	2477
171	Ga0209051_1000336	3300025303	Bacteria	70491
172	Ga0209257_1000009	3300025304	Bacteria	1205047
173	Ga0209257_1000138	3300025304	Bacteria	204131
174	Ga0209257_1001103	3300025304	Bacteria	35112
175	Ga0209257_1001718	3300025304	Bacteria	24492
176	Ga0209257_1001896	3300025304	Bacteria	22606
177	Ga0209257_1002344	3300025304	Bacteria	19055
178	Ga0209257_1004237	3300025304	Bacteria	11333
179	Ga0209257_1009793	3300025304	Bacteria	5021
180	Ga0207682_10000181	3300025893	Bacteria	28554
181	Ga0207682_10007738	3300025893	Bacteria	4269
182	Ga0207682_10009029	3300025893	Bacteria	3939
183	Ga0207682_10023446	3300025893	Bacteria	2438
184	Ga0207642_10019420	3300025899	Bacteria	2631
185	Ga0207710_10007042	3300025900	Bacteria	4776
186	Ga0207688_10010493	3300025901	Bacteria	5039
187	Ga0207647_10001778	3300025904	Bacteria	16531
188	Ga0207699_10004906	3300025906	Bacteria	6400
189	Ga0207643_10010315	3300025908	Bacteria	5029
190	Ga0207643_10036712	3300025908	Bacteria	2748
191	Ga0207707_10084726	3300025912	Bacteria	2768
192	Ga0207660_10000363	3300025917	Bacteria	29576
193	Ga0207662_10103128	3300025918	Bacteria	1770
194	Ga0207657_10003258	3300025919	Bacteria	17381
195	Ga0207652_10000005	3300025921	Bacteria	343384
196	Ga0207652_10000006	3300025921	Bacteria	302991
197	Ga0207652_10000007	3300025921	Bacteria	301303
198	Ga0207652_10000009	3300025921	Bacteria	257234
199	Ga0207650_10024534	3300025925	Bacteria	4288
200	Ga0207659_10004488	3300025926	Bacteria	8441
201	Ga0207659_10020505	3300025926	Bacteria	4370
202	Ga0207659_10021406	3300025926	Bacteria	4291
203	Ga0207690_10000035	3300025932	Bacteria	149201
204	Ga0207706_10003404	3300025933	Bacteria	15195
205	Ga0207706_10024548	3300025933	Bacteria	5404
206	Ga0207670_10002762	3300025936	Bacteria	9243
207	Ga0207669_10004781	3300025937	Bacteria	6007
208	Ga0207704_10100961	3300025938	Bacteria	1923
209	Ga0207691_10003370	3300025940	Bacteria	15547
210	Ga0207691_10004232	3300025940	Bacteria	13942
211	Ga0207691_10007986	3300025940	Bacteria	10176
212	Ga0207691_10090531	3300025940	Bacteria	2742
213	Ga0207691_10099964	3300025940	Bacteria	2589
214	Ga0207711_10018916	3300025941	Bacteria	5729
215	Ga0207711_10022629	3300025941	Bacteria	5258
216	Ga0207689_10010772	3300025942	Bacteria	7869
217	Ga0207689_10224162	3300025942	Bacteria	1554
218	Ga0207679_10005550	3300025945	Bacteria	7905
219	Ga0207651_10018609	3300025960	Bacteria	4140
220	Ga0207651_10044988	3300025960	Bacteria	2958
221	Ga0207712_10000035	3300025961	Bacteria	201152
222	Ga0207712_10015569	3300025961	Bacteria	4910
223	Ga0207668_10003601	3300025972	Bacteria	9106
224	Ga0207658_10000018	3300025986	Bacteria	213853
225	Ga0207677_10000317	3300026023	Bacteria	35378
226	Ga0207677_10061576	3300026023	Bacteria	2599
227	Ga0207703_10074435	3300026035	Bacteria	2812
228	Ga0207639_10285385	3300026041	Bacteria	1453
229	Ga0207708_10035256	3300026075	Bacteria	3808
230	Ga0207641_10009607	3300026088	Bacteria	7972
231	Ga0207641_10042949	3300026088	Bacteria	3794
232	Ga0207648_10007175	3300026089	Bacteria	10984
233	Ga0207648_10061599	3300026089	Unclassified	3271
234	Ga0207676_10008823	3300026095	Bacteria	7177
235	Ga0207676_10126612	3300026095	Bacteria	2164
236	Ga0207674_10050881	3300026116	Bacteria	4230
237	Ga0207675_100001315	3300026118	Bacteria	24901
238	Ga0207675_100011312	3300026118	Bacteria	8353
239	Ga0207675_100015380	3300026118	Bacteria	7136
240	Ga0207675_100015967	3300026118	Bacteria	7008
241	Ga0207675_100147490	3300026118	Bacteria	2238
242	Ga0207683_10004214	3300026121	Bacteria	12430
243	Ga0207683_10007244	3300026121	Bacteria	9506
244	Ga0207683_10007737	3300026121	Bacteria	9201
245	Ga0207683_10257222	3300026121	Bacteria	1594
246	Ga0209813_10000111	3300027866	Bacteria	29673
247	Ga0207428_10018476	3300027907	Bacteria	5953
248	Ga0268266_10036079	3300028379	Bacteria	4206
249	Ga0268266_10163021	3300028379	Bacteria	2018
250	Ga0268265_10000302	3300028380	Bacteria	55065
251	Ga0268265_10002175	3300028380	Bacteria	15165
252	Ga0268265_10030940	3300028380	Bacteria	3861
253	Ga0268264_10000111	3300028381	Bacteria	204718
254	Ga0268264_10029726	3300028381	Bacteria	4478
255	Ga0268264_10129132	3300028381	Bacteria	2238
256	Ga0307511_10030436	3300030521	Bacteria	4850
257	Ga0265327_10001963	3300031251	Bacteria	23543
258	Ga0307513_10004766	3300031456	Bacteria	18014
259	Ga0307513_10026074	3300031456	Bacteria	6749
260	Ga0307513_10034714	3300031456	Bacteria	5654
261	Ga0307509_10152359	3300031507	Bacteria	2225
262	Ga0307509_10282563	3300031507	Bacteria	1420
263	Ga0307408_100071361	3300031548	Bacteria	2567
264	Ga0307413_10002244	3300031824	Bacteria	7791
265	Ga0307413_10004148	3300031824	Bacteria	6252
266	Ga0307413_10011761	3300031824	Bacteria	4321
267	Ga0307413_10020165	3300031824	Bacteria	3539
268	Ga0307413_10051377	3300031824	Bacteria	2483
269	Ga0307413_10125244	3300031824	Bacteria	1748
270	Ga0307410_10004738	3300031852	Bacteria	7086
271	Ga0307410_10012974	3300031852	Bacteria	4841
272	Ga0307410_10019844	3300031852	Bacteria	4099
273	Ga0307410_10029685	3300031852	Bacteria	3485
274	Ga0307406_10067598	3300031901	Bacteria	2330
275	Ga0307407_10004537	3300031903	Bacteria	5910
276	Ga0307407_10006862	3300031903	Bacteria	5108
277	Ga0307412_10021149	3300031911	Bacteria	3970
278	Ga0307412_10034590	3300031911	Bacteria	3221
279	Ga0307412_10103198	3300031911	Bacteria	2021
280	Ga0307409_100048371	3300031995	Bacteria	3235
281	Ga0307409_100083655	3300031995	Bacteria	2588
282	Ga0307416_100010546	3300032002	Bacteria	6109
283	Ga0307416_100075118	3300032002	Bacteria	2827
284	Ga0307414_10000856	3300032004	Bacteria	15517
285	Ga0307414_10005160	3300032004	Bacteria	7166
286	Ga0307414_10009549	3300032004	Bacteria	5580
287	Ga0307414_10011240	3300032004	Bacteria	5241
288	Ga0307414_10019277	3300032004	Bacteria	4223
289	Ga0307411_10003638	3300032005	Bacteria	7208
290	Ga0307411_10037443	3300032005	Bacteria	3050
291	Ga0307411_10038466	3300032005	Bacteria	3018
292	Ga0307411_10090725	3300032005	Bacteria	2132
293	Ga0307411_10103039	3300032005	Bacteria	2023
294	Ga0307415_100001740	3300032126	Bacteria	10610
295	Ga0316584_0073095	3300036712	Unclassified	2570
296	Ga0316584_0202300	3300036712	Unclassified	1465
297	Ga0395900_0001997	3300037418	Bacteria	23048
298	Ga0395905_0001037	3300037471	Bacteria	35267
299	Ga0395905_0303257	3300037471	Bacteria	1485
300	Ga0436364_0942379	3300037853	Bacteria	1206
301	Ga0395901_0001476	3300038443	Bacteria	24466
302	Ga0237819_02029	3300038705	Bacteria	4478
303	Ga0436365_0354346	3300039437	Bacteria	23652
304	Ga0436365_0643552	3300039437	Bacteria	27729
305	Ga0436365_1208129	3300039437	Bacteria	8649
306	Ga0436365_1920122	3300039437	Bacteria	1716
307	Ga0436362_1290848	3300039453	Bacteria	47963
308	Ga0439465_0002246	3300041413	Bacteria	6344
309	Ga0439465_0011611	3300041413	Bacteria	2764
310	Ga0439442_002717	3300042002	Bacteria	3473
311	Ga0439445_0006963	3300042004	Bacteria	2612
312	Ga0439445_0011614	3300042004	Bacteria	2103
313	Ga0439432_000411	3300042006	Bacteria	15940
314	Ga0439457_012222	3300042014	Bacteria	1937
315	Ga0439462_0001042	3300042015	Bacteria	5960
316	Ga0439462_0003607	3300042015	Bacteria	3725
317	Ga0439434_0031623	3300042435	Bacteria	1609
318	Ga0439435_0005439	3300042436	Bacteria	2802
319	Ga0451576_0023307	3300045051	Bacteria	6703
320	Ga0495627_000157	3300046453	Bacteria	78082
321	Ga0495627_000318	3300046453	Bacteria	47190
322	Ga0495638_0046206	3300046460	Bacteria	2736
323	Ga0495584_0041362	3300046491	Bacteria	2327
324	Ga0495596_0006539	3300046500	Bacteria	5352
325	Ga0495606_0003288	3300046507	Bacteria	17300
326	Ga0495610_0000389	3300046512	Bacteria	45473
327	Ga0495610_0004089	3300046512	Bacteria	10938
328	Ga0495632_0000957	3300046519	Bacteria	25235
329	Ga0495637_0001877	3300046520	Bacteria	11992
330	Ga0495637_0054904	3300046520	Bacteria	1653
331	Ga0495643_0000014	3300046522	Bacteria	314632
332	Ga0495648_0006149	3300046524	Bacteria	9840
333	Ga0495648_0037696	3300046524	Bacteria	3103
334	Ga0495663_0000007	3300046525	Bacteria	262438
335	Ga0495633_0000064	3300046558	Bacteria	140407
336	Ga0495633_0006074	3300046558	Bacteria	7237
337	Ga0495668_0000002	3300046616	Bacteria	763179
338	Ga0495668_0088742	3300046616	Bacteria	1695
339	Ga0495625_0000977	3300046660	Bacteria	37974
340	Ga0495670_0036185	3300046691	Bacteria	2460
341	Ga0495671_0000032	3300046692	Bacteria	201185
342	Ga0495649_0040412	3300046694	Bacteria	2554
343	Ga0495681_0000006	3300047470	Bacteria	221565
344	Ga0495681_0007989	3300047470	Bacteria	6682
345	Ga0495681_0031567	3300047470	Bacteria	2679
346	Ga0495686_0002098	3300047472	Bacteria	19541
347	Ga0495686_0009906	3300047472	Bacteria	6825
348	Ga0495686_0024526	3300047472	Bacteria	3961
349	Ga0495686_0032373	3300047472	Bacteria	3384
350	Ga0495626_0000963	3300048091	Bacteria	24947
351	Ga0496102_0004318	3300048905	Bacteria	12023
352	Ga0496102_0088043	3300048905	Bacteria	2870
353	Ga0496109_0038400	3300048912	Bacteria	4329
354	Ga0496111_0084094	3300048914	Bacteria	2326
355	Ga0496112_0221927	3300048915	Bacteria	1846
356	Ga0496115_0000382	3300048918	Bacteria	36611
357	Ga0496117_0010686	3300048920	Bacteria	8309
358	Ga0496118_0008618	3300048921	Bacteria	10494
359	Ga0496118_0045894	3300048921	Bacteria	3404
360	Ga0496119_0054506	3300048922	Bacteria	2434
361	Ga0496121_0000674	3300048924	Bacteria	63672
362	Ga0496125_0091438	3300048928	Bacteria	2280
363	Ga0501033_0034186	3300049570	Bacteria	3815
364	Ga0501033_0082503	3300049570	Bacteria	2357
365	Ga0501034_0000903	3300049571	Bacteria	43233
366	Ga0501034_0016379	3300049571	Bacteria	7609
367	Ga0501036_0027323	3300049572	Bacteria	4821
368	Ga0501037_0053705	3300049573	Bacteria	2947
369	Ga0501038_0020630	3300049574	Bacteria	5923
370	Ga0501038_0059708	3300049574	Bacteria	3266
371	Ga0501038_0097313	3300049574	Bacteria	2455
372	Ga0501039_0010052	3300049575	Bacteria	7213
373	Ga0501039_0126314	3300049575	Bacteria	2006
374	Ga0501040_0008291	3300049576	Bacteria	6760
375	Ga0501041_0000294	3300049577	Bacteria	24066
376	Ga0501042_0004381	3300049578	Bacteria	9001
377	Ga0501042_0009806	3300049578	Bacteria	6395
378	Ga0501043_0130936	3300049579	Bacteria	1966
379	Ga0501046_0028692	3300049580	Bacteria	4530
380	Ga0501048_0002576	3300049582	Bacteria	13868
381	Ga0501068_0000568	3300049584	Bacteria	18814
382	Ga0501070_0004068	3300049586	Bacteria	12570
383	Ga0501071_0012013	3300049587	Bacteria	5853
384	Ga0501071_0018644	3300049587	Bacteria	4809
385	Ga0501072_0000673	3300049588	Bacteria	24689
386	Ga0501072_0023699	3300049588	Bacteria	4769
387	Ga0501073_0001940	3300049589	Bacteria	15409
388	Ga0501074_0001023	3300049590	Bacteria	18214
389	Ga0501074_0076908	3300049590	Bacteria	2395
390	Ga0501075_0000352	3300049591	Bacteria	26186
391	Ga0501075_0009398	3300049591	Bacteria	6839
392	Ga0501076_0006518	3300049592	Bacteria	8467
393	Ga0501076_0075360	3300049592	Bacteria	2704
394	Ga0501077_0002389	3300049593	Bacteria	11266
395	Ga0501077_0007146	3300049593	Bacteria	6885
396	Ga0501077_0236033	3300049593	Bacteria	1162
397	Ga0501079_0000548	3300049741	Bacteria	24527
398	Ga0501079_0004967	3300049741	Bacteria	9863
399	Ga0501080_0001036	3300049742	Bacteria	22876
400	Ga0501080_0001600	3300049742	Bacteria	19217
401	Ga0501081_0011861	3300049743	Bacteria	5709
402	Ga0501081_0024601	3300049743	Bacteria	4044
403	Ga0501083_0019564	3300049744	Bacteria	4716
404	Ga0501035_0009266	3300049822	Bacteria	9154
405	Ga0501035_0156468	3300049822	Bacteria	1975
406	Ga0501044_0034374	3300049823	Bacteria	5316
407	Ga0501044_0056677	3300049823	Bacteria	4023
408	Ga0501045_0000675	3300049824	Bacteria	21663
409	Ga0501045_0026903	3300049824	Bacteria	4140
410	nmdc:mga03n38_45836_c1	3300050490	Bacteria	1927
411	nmdc:mga06z11_195_c1	3300050494	Bacteria	24343
412	nmdc:mga04h51_445_c1	3300050495	Bacteria	9971
413	nmdc:mga05p37_52067_c1	3300050507	Bacteria	5035
414	nmdc:mga09592_31425_c1	3300050508	Bacteria	4425
415	nmdc:mga0qj67_16386_c1	3300050509	Bacteria	5620
416	nmdc:mga0qj67_39609_c1	3300050509	Bacteria	3701
417	nmdc:mga0qj67_9059_c1	3300050509	Bacteria	7387
418	nmdc:mga06r32_474_c1	3300050510	Bacteria	34479
419	nmdc:mga06r32_91201_c1	3300050510	Bacteria	2978
420	nmdc:mga08y16_106389_c1	3300050511	Bacteria	2920
421	nmdc:mga08y16_1766_c1	3300050511	Bacteria	21907
422	nmdc:mga0a205_164772_c1	3300050515	Bacteria	2112
423	Ga0500643_000175	3300053087	Bacteria	63148
424	Ga0500643_004400	3300053087	Bacteria	6390
425	Ga0500643_026908	3300053087	Bacteria	1794
426	Ga0500651_0001360	3300053093	Bacteria	12260
427	Ga0500641_0011546	3300053096	Bacteria	3207
428	Ga0500555_000335	3300053103	Bacteria	20168
429	Ga0500562_009005	3300053108	Bacteria	2522
430	Ga0500595_002207	3300053119	Bacteria	9888
431	Ga0500618_004426	3300053125	Bacteria	4506
432	Ga0500655_000036	3300053133	Bacteria	38186
433	Ga0500658_0001650	3300053134	Bacteria	8875
434	Ga0500658_0002578	3300053134	Bacteria	7004
435	Ga0500559_0002524	3300053136	Bacteria	9403
436	Ga0500559_0005182	3300053136	Bacteria	6020
437	Ga0500568_0008688	3300053139	Bacteria	4875
438	Ga0500590_001248	3300053148	Bacteria	10182
439	Ga0500616_0001591	3300053153	Bacteria	21177
440	Ga0500622_0027847	3300053156	Bacteria	2977
441	Ga0500624_000021	3300053157	Bacteria	117511
442	Ga0500627_0000002	3300053158	Bacteria	235747
443	Ga0500570_008774	3300053724	Bacteria	5595
444	Ga0500645_002591	3300053730	Bacteria	7950
445	Ga0501084_0011339	3300054114	Bacteria	7382
446	Ga0501084_0056838	3300054114	Bacteria	3274
447	Ga0501084_0063836	3300054114	Bacteria	3083
448	Ga0500661_001367	3300055283	Bacteria	4546
449	Ga0501082_0007435	3300060353	Bacteria	9452
450	Ga0501082_0013884	3300060353	Bacteria	6925
451	Ga0501082_0028560	3300060353	Bacteria	4805
452	Ga0530510_0010713	3300061734	Bacteria	6431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048915	Ga0496112_0221927	Ga0496112_0221927_15_1061	347
2	3300049575	Ga0501039_0126314	Ga0501039_0126314_882_1958	355
3	3300049593	Ga0501077_0236033	Ga0501077_0236033_67_1143	355
4	3300005844	Ga0068862_100010097	Ga0068862_1000100972	365
5	3300014326	Ga0157380_10007494	Ga0157380_100074945	365
6	3300025933	Ga0207706_10003404	Ga0207706_100034049	365
7	3300025937	Ga0207669_10004781	Ga0207669_100047814	365
8	3300025961	Ga0207712_10015569	Ga0207712_100155692	365
9	3300025972	Ga0207668_10003601	Ga0207668_100036018	365
10	3300028380	Ga0268265_10002175	Ga0268265_100021759	365
11	3300042436	Ga0439435_0005439	Ga0439435_0005439_1382_2482	365
12	3300005718	Ga0068866_10027922	Ga0068866_100279223	366
13	3300025899	Ga0207642_10019420	Ga0207642_100194203	366
14	3300025933	Ga0207706_10024548	Ga0207706_100245483	366
15	3300048905	Ga0496102_0004318	Ga0496102_0004318_5496_6749	367
16	3300006846	Ga0075430_100019486	Ga0075430_1000194862	369
17	3300006847	Ga0075431_100054461	Ga0075431_1000544614	369
18	3300009094	Ga0111539_10149900	Ga0111539_101499002	369
19	3300009147	Ga0114129_10009440	Ga0114129_100094409	369
20	3300050507	nmdc:mga05p37_52067_c1	nmdc:mga05p37_52067_c1_1703_2914	369
21	3300050508	nmdc:mga09592_31425_c1	nmdc:mga09592_31425_c1_719_1930	369
22	3300050509	nmdc:mga0qj67_9059_c1	nmdc:mga0qj67_9059_c1_250_1461	369
23	3300050510	nmdc:mga06r32_91201_c1	nmdc:mga06r32_91201_c1_878_2089	369
24	3300021384	Ga0213876_10000123	Ga0213876_1000012370	372
25	3300039437	Ga0436365_0354346	Ga0436365_0354346_4806_6065	372
26	3300025904	Ga0207647_10001778	Ga0207647_1000177813	373
27	3300005543	Ga0070672_100155572	Ga0070672_1001555722	377
28	3300025940	Ga0207691_10099964	Ga0207691_100999643	377
29	3300005335	Ga0070666_10108110	Ga0070666_101081102	378
30	3300017792	Ga0163161_10066577	Ga0163161_100665772	378
31	3300037853	Ga0436364_0942379	Ga0436364_0942379_54_1196	378
32	3300050515	nmdc:mga0a205_164772_c1	nmdc:mga0a205_164772_c1_879_2090	378
33	3300006846	Ga0075430_100004465	Ga0075430_10000446515	380
34	3300006847	Ga0075431_100108540	Ga0075431_1001085404	380
35	3300050509	nmdc:mga0qj67_16386_c1	nmdc:mga0qj67_16386_c1_2269_3480	380
36	3300050510	nmdc:mga06r32_474_c1	nmdc:mga06r32_474_c1_1021_2232	380
37	3300005616	Ga0068852_100029061	Ga0068852_1000290612	381
38	3300032002	Ga0307416_100075118	Ga0307416_1000751182	382
39	3300048914	Ga0496111_0084094	Ga0496111_0084094_420_1661	382
40	3300027907	Ga0207428_10018476	Ga0207428_100184765	383
41	3300009094	Ga0111539_10009098	Ga0111539_100090987	385
42	3300049823	Ga0501044_0056677	Ga0501044_0056677_1561_2811	385
43	3300050511	nmdc:mga08y16_1766_c1	nmdc:mga08y16_1766_c1_2331_3614	385
44	3300005331	Ga0070670_100025390	Ga0070670_1000253906	386
45	3300005334	Ga0068869_100001173	Ga0068869_1000011733	386
46	3300005338	Ga0068868_100030953	Ga0068868_1000309533	386
47	3300005340	Ga0070689_100002757	Ga0070689_1000027575	386
48	3300005344	Ga0070661_100003125	Ga0070661_10000312511	386
49	3300005354	Ga0070675_100029462	Ga0070675_1000294623	386
50	3300005356	Ga0070674_100020901	Ga0070674_1000209013	386
51	3300005364	Ga0070673_100004230	Ga0070673_1000042307	386
52	3300005365	Ga0070688_100005234	Ga0070688_1000052343	386
53	3300005440	Ga0070705_100003967	Ga0070705_1000039673	386
54	3300005441	Ga0070700_100021034	Ga0070700_1000210342	386
55	3300005457	Ga0070662_100048283	Ga0070662_1000482833	386
56	3300005459	Ga0068867_100008204	Ga0068867_1000082043	386
57	3300005466	Ga0070685_10011508	Ga0070685_100115083	386
58	3300005535	Ga0070684_100005188	Ga0070684_1000051886	386
59	3300005544	Ga0070686_100001792	Ga0070686_10000179212	386
60	3300005548	Ga0070665_100015177	Ga0070665_1000151779	386
61	3300005564	Ga0070664_100000656	Ga0070664_10000065615	386
62	3300005615	Ga0070702_100000479	Ga0070702_1000004798	386
63	3300005617	Ga0068859_100001219	Ga0068859_10000121914	386
64	3300005618	Ga0068864_100016662	Ga0068864_1000166622	386
65	3300005719	Ga0068861_100001118	Ga0068861_10000111819	386
66	3300005841	Ga0068863_100006657	Ga0068863_1000066572	386
67	3300005842	Ga0068858_100054713	Ga0068858_1000547133	386
68	3300005844	Ga0068862_100001154	Ga0068862_10000115414	386
69	3300006931	Ga0097620_100001219	Ga0097620_10000121914	386
70	3300009177	Ga0105248_10004916	Ga0105248_1000491613	386
71	3300010375	Ga0105239_10437905	Ga0105239_104379051	386
72	3300013308	Ga0157375_10114971	Ga0157375_101149712	386
73	3300014745	Ga0157377_10022848	Ga0157377_100228483	386
74	3300014968	Ga0157379_10223727	Ga0157379_102237272	386
75	3300025901	Ga0207688_10010493	Ga0207688_100104936	386
76	3300025925	Ga0207650_10024534	Ga0207650_100245342	386
77	3300025926	Ga0207659_10021406	Ga0207659_100214063	386
78	3300025936	Ga0207670_10002762	Ga0207670_100027623	386
79	3300025940	Ga0207691_10007986	Ga0207691_100079867	386
80	3300025941	Ga0207711_10018916	Ga0207711_100189163	386
81	3300025942	Ga0207689_10010772	Ga0207689_100107723	386
82	3300025945	Ga0207679_10005550	Ga0207679_100055507	386
83	3300025960	Ga0207651_10044988	Ga0207651_100449883	386
84	3300026023	Ga0207677_10061576	Ga0207677_100615762	386
85	3300026035	Ga0207703_10074435	Ga0207703_100744353	386
86	3300026075	Ga0207708_10035256	Ga0207708_100352562	386
87	3300026088	Ga0207641_10009607	Ga0207641_100096076	386
88	3300026089	Ga0207648_10007175	Ga0207648_100071753	386
89	3300026095	Ga0207676_10008823	Ga0207676_100088235	386
90	3300026116	Ga0207674_10050881	Ga0207674_100508812	386
91	3300026118	Ga0207675_100001315	Ga0207675_10000131513	386
92	3300028379	Ga0268266_10163021	Ga0268266_101630212	386
93	3300031251	Ga0265327_10001963	Ga0265327_1000196313	386
94	3300045051	Ga0451576_0023307	Ga0451576_0023307_3999_5240	386
95	3300048912	Ga0496109_0038400	Ga0496109_0038400_2790_4031	386
96	3300053103	Ga0500555_000335	Ga0500555_000335_3956_5239	386
97	iso_pu_bacteria	2896429255	2896430432	386
98	3300005356	Ga0070674_100022054	Ga0070674_1000220542	387
99	3300026121	Ga0207683_10007244	Ga0207683_100072445	387
100	3300026121	Ga0207683_10007737	Ga0207683_100077373	388
101	3300047472	Ga0495686_0002098	Ga0495686_0002098_5996_7228	389
102	3300025926	Ga0207659_10004488	Ga0207659_100044884	391
103	3300047472	Ga0495686_0032373	Ga0495686_0032373_844_2025	391
104	3300048928	Ga0496125_0091438	Ga0496125_0091438_983_2245	393
105	3300037471	Ga0395905_0303257	Ga0395905_0303257_66_1295	394
106	3300003781	Ga0055536_1003622	Ga0055536_10036228	395
107	3300003781	Ga0055536_1005303	Ga0055536_10053033	395
108	3300005434	Ga0070709_10007222	Ga0070709_100072226	395
109	3300005545	Ga0070695_100014402	Ga0070695_1000144022	395
110	3300025292	Ga0209676_1000155	Ga0209676_1000155127	395
111	3300025906	Ga0207699_10004906	Ga0207699_100049063	395
112	3300005328	Ga0070676_10065916	Ga0070676_100659162	396
113	3300005457	Ga0070662_100002203	Ga0070662_1000022035	396
114	3300011119	Ga0105246_10212173	Ga0105246_102121732	396
115	3300026118	Ga0207675_100015380	Ga0207675_1000153804	396
116	3300036712	Ga0316584_0073095	Ga0316584_0073095_1306_2544	396
117	3300046507	Ga0495606_0003288	Ga0495606_0003288_3759_5012	396
118	3300014325	Ga0163163_10179169	Ga0163163_101791693	397
119	3300050509	nmdc:mga0qj67_39609_c1	nmdc:mga0qj67_39609_c1_418_1641	397
120	3300032004	Ga0307414_10005160	Ga0307414_100051605	398
121	3300031824	Ga0307413_10125244	Ga0307413_101252442	399
122	3300032005	Ga0307411_10103039	Ga0307411_101030392	399
123	3300053136	Ga0500559_0002524	Ga0500559_0002524_3506_4759	399
124	3300006353	Ga0075370_10008456	Ga0075370_100084564	401
125	3300026041	Ga0207639_10285385	Ga0207639_102853852	401
126	3300030521	Ga0307511_10030436	Ga0307511_100304364	401
127	3300047472	Ga0495686_0009906	Ga0495686_0009906_3351_4619	401
128	3300005333	Ga0070677_10017871	Ga0070677_100178712	402
129	3300025893	Ga0207682_10023446	Ga0207682_100234462	402
130	3300046694	Ga0495649_0040412	Ga0495649_0040412_1269_2489	402
131	iso_pu_bacteria	2848297114	2848299732	402
132	3300031507	Ga0307509_10282563	Ga0307509_102825632	403
133	3300049571	Ga0501034_0016379	Ga0501034_0016379_3202_4452	403
134	iso_pu_bacteria	2582581305	2585260680	403
135	3300005367	Ga0070667_100000114	Ga0070667_10000011455	404
136	3300005843	Ga0068860_100000172	Ga0068860_10000017258	404
137	3300006358	Ga0068871_100046836	Ga0068871_1000468362	404
138	3300025938	Ga0207704_10100961	Ga0207704_101009613	404
139	3300025986	Ga0207658_10000018	Ga0207658_10000018183	404
140	3300028381	Ga0268264_10000111	Ga0268264_10000111145	404
141	iso_pu_bacteria	2919709256	2919711694	404
142	3300003775	Ga0055524_1000255	Ga0055524_100025517	405
143	3300005262	Ga0065165_1011132	Ga0065165_10111323	405
144	3300025263	Ga0209565_1000010	Ga0209565_1000010527	405
145	3300025273	Ga0209673_1006185	Ga0209673_10061853	405
146	3300025298	Ga0209050_1004499	Ga0209050_10044992	405
147	3300025299	Ga0209256_1000034	Ga0209256_1000034383	405
148	3300031507	Ga0307509_10152359	Ga0307509_101523592	405
149	3300031824	Ga0307413_10011761	Ga0307413_100117614	405
150	3300031824	Ga0307413_10020165	Ga0307413_100201652	405
151	3300031824	Ga0307413_10051377	Ga0307413_100513773	405
152	3300031852	Ga0307410_10012974	Ga0307410_100129742	405
153	3300031903	Ga0307407_10006862	Ga0307407_100068622	405
154	3300031911	Ga0307412_10021149	Ga0307412_100211494	405
155	3300031995	Ga0307409_100048371	Ga0307409_1000483712	405
156	3300032002	Ga0307416_100010546	Ga0307416_1000105464	405
157	3300032004	Ga0307414_10009549	Ga0307414_100095494	405
158	3300032004	Ga0307414_10019277	Ga0307414_100192773	405
159	3300032005	Ga0307411_10003638	Ga0307411_100036386	405
160	3300032005	Ga0307411_10037443	Ga0307411_100374433	405
161	3300032126	Ga0307415_100001740	Ga0307415_1000017402	405
162	3300041413	Ga0439465_0011611	Ga0439465_0011611_586_1851	405
163	3300042004	Ga0439445_0006963	Ga0439445_0006963_627_1892	405
164	3300042014	Ga0439457_012222	Ga0439457_012222_540_1805	405
165	3300042015	Ga0439462_0003607	Ga0439462_0003607_740_2005	405
166	3300047470	Ga0495681_0031567	Ga0495681_0031567_416_1681	405
167	3300049573	Ga0501037_0053705	Ga0501037_0053705_78_1328	405
168	3300049574	Ga0501038_0020630	Ga0501038_0020630_3333_4583	405
169	3300049823	Ga0501044_0034374	Ga0501044_0034374_2506_3756	405
170	3300053087	Ga0500643_004400	Ga0500643_004400_2765_4030	405
171	3300053134	Ga0500658_0001650	Ga0500658_0001650_1533_2798	405
172	3300053134	Ga0500658_0002578	Ga0500658_0002578_2776_4041	405
173	3300053139	Ga0500568_0008688	Ga0500568_0008688_1842_3107	405
174	iso_pu_bacteria	2512564014	2512643035	405
175	3300003794	Ga0055531_10000444	Ga0055531_1000044418	406
176	3300005539	Ga0068853_100322135	Ga0068853_1003221351	406
177	3300025298	Ga0209050_1000026	Ga0209050_1000026231	406
178	3300025304	Ga0209257_1000009	Ga0209257_1000009231	406
179	3300031548	Ga0307408_100071361	Ga0307408_1000713612	406
180	3300031824	Ga0307413_10002244	Ga0307413_100022442	406
181	3300031852	Ga0307410_10029685	Ga0307410_100296852	406
182	3300031911	Ga0307412_10103198	Ga0307412_101031982	406
183	3300032005	Ga0307411_10038466	Ga0307411_100384662	406
184	3300037418	Ga0395900_0001997	Ga0395900_0001997_14158_15420	406
185	3300037471	Ga0395905_0001037	Ga0395905_0001037_15382_16644	406
186	3300038443	Ga0395901_0001476	Ga0395901_0001476_529_1791	406
187	3300053093	Ga0500651_0001360	Ga0500651_0001360_4710_5942	406
188	3300053096	Ga0500641_0011546	Ga0500641_0011546_1073_2305	406
189	3300053133	Ga0500655_000036	Ga0500655_000036_6853_8085	406
190	3300053148	Ga0500590_001248	Ga0500590_001248_5677_6909	406
191	3300053156	Ga0500622_0027847	Ga0500622_0027847_1202_2434	406
192	3300053724	Ga0500570_008774	Ga0500570_008774_1657_2889	406
193	3300003791	Ga0055530_10002187	Ga0055530_100021873	407
194	3300003794	Ga0055531_10003574	Ga0055531_100035743	407
195	3300005262	Ga0065165_1000103	Ga0065165_100010386	407
196	3300005262	Ga0065165_1008797	Ga0065165_10087974	407
197	3300005617	Ga0068859_100071022	Ga0068859_1000710222	407
198	3300006042	Ga0075368_10000480	Ga0075368_100004807	407
199	3300006048	Ga0075363_100065255	Ga0075363_1000652552	407
200	3300006178	Ga0075367_10000387	Ga0075367_100003874	407
201	3300006931	Ga0097620_100071022	Ga0097620_1000710222	407
202	3300025229	Ga0209147_100442	Ga0209147_1004425	407
203	3300025250	Ga0209026_1001629	Ga0209026_10016294	407
204	3300025297	Ga0209758_1001365	Ga0209758_100136517	407
205	3300025298	Ga0209050_1000038	Ga0209050_1000038203	407
206	3300025304	Ga0209257_1000138	Ga0209257_100013892	407
207	3300025304	Ga0209257_1002344	Ga0209257_10023447	407
208	3300027866	Ga0209813_10000111	Ga0209813_100001117	407
209	3300031852	Ga0307410_10004738	Ga0307410_100047385	407
210	3300031903	Ga0307407_10004537	Ga0307407_100045376	407
211	3300031995	Ga0307409_100083655	Ga0307409_1000836551	407
212	3300046453	Ga0495627_000157	Ga0495627_000157_7571_8830	407
213	3300046453	Ga0495627_000318	Ga0495627_000318_13680_14939	407
214	3300046491	Ga0495584_0041362	Ga0495584_0041362_739_1998	407
215	3300046512	Ga0495610_0000389	Ga0495610_0000389_40768_42027	407
216	3300046519	Ga0495632_0000957	Ga0495632_0000957_8688_9947	407
217	3300046520	Ga0495637_0001877	Ga0495637_0001877_9190_10449	407
218	3300046520	Ga0495637_0054904	Ga0495637_0054904_257_1516	407
219	3300046522	Ga0495643_0000014	Ga0495643_0000014_257401_258660	407
220	3300046524	Ga0495648_0006149	Ga0495648_0006149_781_2040	407
221	3300046524	Ga0495648_0037696	Ga0495648_0037696_1511_2770	407
222	3300046525	Ga0495663_0000007	Ga0495663_0000007_206649_207908	407
223	3300046558	Ga0495633_0000064	Ga0495633_0000064_79910_81169	407
224	3300046558	Ga0495633_0006074	Ga0495633_0006074_4103_5362	407
225	3300046616	Ga0495668_0088742	Ga0495668_0088742_354_1586	407
226	3300046692	Ga0495671_0000032	Ga0495671_0000032_143954_145213	407
227	3300047470	Ga0495681_0000006	Ga0495681_0000006_192601_193860	407
228	3300047470	Ga0495681_0007989	Ga0495681_0007989_721_1980	407
229	3300047472	Ga0495686_0024526	Ga0495686_0024526_1744_3003	407
230	3300048905	Ga0496102_0088043	Ga0496102_0088043_820_2070	407
231	3300048920	Ga0496117_0010686	Ga0496117_0010686_1239_2489	407
232	3300048921	Ga0496118_0008618	Ga0496118_0008618_5960_7210	407
233	3300048922	Ga0496119_0054506	Ga0496119_0054506_749_1999	407
234	3300049570	Ga0501033_0034186	Ga0501033_0034186_1611_2864	407
235	3300049574	Ga0501038_0097313	Ga0501038_0097313_519_1772	407
236	3300049578	Ga0501042_0009806	Ga0501042_0009806_4491_5744	407
237	3300049579	Ga0501043_0130936	Ga0501043_0130936_41_1294	407
238	3300049580	Ga0501046_0028692	Ga0501046_0028692_1363_2616	407
239	3300049587	Ga0501071_0012013	Ga0501071_0012013_4285_5538	407
240	3300049590	Ga0501074_0076908	Ga0501074_0076908_625_1878	407
241	3300049591	Ga0501075_0009398	Ga0501075_0009398_5006_6259	407
242	3300049743	Ga0501081_0024601	Ga0501081_0024601_1596_2849	407
243	3300049822	Ga0501035_0009266	Ga0501035_0009266_3634_4887	407
244	3300049824	Ga0501045_0026903	Ga0501045_0026903_2571_3824	407
245	3300050490	nmdc:mga03n38_45836_c1	nmdc:mga03n38_45836_c1_543_1802	407
246	3300050494	nmdc:mga06z11_195_c1	nmdc:mga06z11_195_c1_15251_16510	407
247	3300050495	nmdc:mga04h51_445_c1	nmdc:mga04h51_445_c1_7832_9091	407
248	3300053157	Ga0500624_000021	Ga0500624_000021_49870_51126	407
249	3300053730	Ga0500645_002591	Ga0500645_002591_3388_4623	407
250	3300054114	Ga0501084_0056838	Ga0501084_0056838_1569_2822	407
251	3300060353	Ga0501082_0028560	Ga0501082_0028560_2533_3786	407
252	iso_pu_bacteria	2643221560	2643821094	407
253	3300025893	Ga0207682_10000181	Ga0207682_1000018114	408
254	3300049570	Ga0501033_0082503	Ga0501033_0082503_1035_2291	408
255	3300049572	Ga0501036_0027323	Ga0501036_0027323_496_1752	408
256	3300049574	Ga0501038_0059708	Ga0501038_0059708_1924_3180	408
257	3300049575	Ga0501039_0010052	Ga0501039_0010052_837_2093	408
258	3300049576	Ga0501040_0008291	Ga0501040_0008291_1017_2273	408
259	3300049577	Ga0501041_0000294	Ga0501041_0000294_18699_19955	408
260	3300049578	Ga0501042_0004381	Ga0501042_0004381_6508_7764	408
261	3300049582	Ga0501048_0002576	Ga0501048_0002576_3396_4652	408
262	3300049587	Ga0501071_0018644	Ga0501071_0018644_39_1295	408
263	3300049588	Ga0501072_0000673	Ga0501072_0000673_20285_21541	408
264	3300049591	Ga0501075_0000352	Ga0501075_0000352_20579_21835	408
265	3300049592	Ga0501076_0006518	Ga0501076_0006518_2442_3698	408
266	3300049593	Ga0501077_0002389	Ga0501077_0002389_9363_10619	408
267	3300049741	Ga0501079_0004967	Ga0501079_0004967_847_2103	408
268	3300049742	Ga0501080_0001600	Ga0501080_0001600_16160_17416	408
269	3300049744	Ga0501083_0019564	Ga0501083_0019564_1570_2826	408
270	3300049822	Ga0501035_0156468	Ga0501035_0156468_594_1850	408
271	3300049824	Ga0501045_0000675	Ga0501045_0000675_1237_2493	408
272	3300054114	Ga0501084_0063836	Ga0501084_0063836_1108_2364	408
273	3300060353	Ga0501082_0013884	Ga0501082_0013884_3370_4626	408
274	3300061734	Ga0530510_0010713	Ga0530510_0010713_2479_3735	408
275	iso_pu_bacteria	2643221563	2643832774	408
276	iso_pu_bacteria	2643221608	2644053431	408
277	iso_pu_bacteria	2852653556	2852657119	408
278	iso_pu_bacteria	2852680915	2852683777	408
279	3300005330	Ga0070690_100002243	Ga0070690_1000022439	409
280	3300005438	Ga0070701_10022762	Ga0070701_100227621	409
281	3300005546	Ga0070696_100113952	Ga0070696_1001139523	409
282	3300005615	Ga0070702_100001394	Ga0070702_1000013946	409
283	3300005617	Ga0068859_100032412	Ga0068859_1000324123	409
284	3300005618	Ga0068864_100015357	Ga0068864_1000153575	409
285	3300005719	Ga0068861_100003115	Ga0068861_1000031154	409
286	3300005719	Ga0068861_100033787	Ga0068861_1000337873	409
287	3300005843	Ga0068860_100148940	Ga0068860_1001489403	409
288	3300006931	Ga0097620_100032412	Ga0097620_1000324123	409
289	3300014326	Ga0157380_10020341	Ga0157380_100203412	409
290	3300025918	Ga0207662_10103128	Ga0207662_101031282	409
291	3300025926	Ga0207659_10020505	Ga0207659_100205053	409
292	3300026095	Ga0207676_10126612	Ga0207676_101266122	409
293	3300026118	Ga0207675_100011312	Ga0207675_1000113124	409
294	3300026118	Ga0207675_100147490	Ga0207675_1001474903	409
295	3300028380	Ga0268265_10030940	Ga0268265_100309403	409
296	3300028381	Ga0268264_10129132	Ga0268264_101291323	409
297	3300036712	Ga0316584_0202300	Ga0316584_0202300_110_1351	409
298	3300049584	Ga0501068_0000568	Ga0501068_0000568_6997_8235	409
299	3300049586	Ga0501070_0004068	Ga0501070_0004068_5658_6896	409
300	3300049588	Ga0501072_0023699	Ga0501072_0023699_2061_3299	409
301	3300049589	Ga0501073_0001940	Ga0501073_0001940_4964_6202	409
302	3300049590	Ga0501074_0001023	Ga0501074_0001023_7770_9008	409
303	3300049592	Ga0501076_0075360	Ga0501076_0075360_991_2229	409
304	3300049593	Ga0501077_0007146	Ga0501077_0007146_3062_4300	409
305	3300049741	Ga0501079_0000548	Ga0501079_0000548_8548_9786	409
306	3300049742	Ga0501080_0001036	Ga0501080_0001036_6554_7792	409
307	3300049743	Ga0501081_0011861	Ga0501081_0011861_705_1943	409
308	3300054114	Ga0501084_0011339	Ga0501084_0011339_3259_4497	409
309	3300060353	Ga0501082_0007435	Ga0501082_0007435_3907_5145	409
310	3300005548	Ga0070665_100010037	Ga0070665_1000100378	410
311	3300005617	Ga0068859_100065050	Ga0068859_1000650503	410
312	3300005617	Ga0068859_100472769	Ga0068859_1004727692	410
313	3300005843	Ga0068860_100029338	Ga0068860_1000293382	410
314	3300005844	Ga0068862_100000173	Ga0068862_1000001731	410
315	3300006358	Ga0068871_100011926	Ga0068871_1000119263	410
316	3300006931	Ga0097620_100065047	Ga0097620_1000650473	410
317	3300006931	Ga0097620_100472873	Ga0097620_1004728731	410
318	3300025900	Ga0207710_10007042	Ga0207710_100070423	410
319	3300025961	Ga0207712_10000035	Ga0207712_1000003531	410
320	3300028379	Ga0268266_10036079	Ga0268266_100360794	410
321	3300028380	Ga0268265_10000302	Ga0268265_100003021	410
322	3300028381	Ga0268264_10029726	Ga0268264_100297261	410
323	3300031456	Ga0307513_10026074	Ga0307513_100260743	410
324	3300031456	Ga0307513_10034714	Ga0307513_100347144	410
325	3300038705	Ga0237819_02029	Ga0237819_02029_2286_3533	410
326	3300053087	Ga0500643_026908	Ga0500643_026908_476_1720	410
327	3300003791	Ga0055530_10006595	Ga0055530_100065952	411
328	3300003794	Ga0055531_10011654	Ga0055531_100116543	411
329	3300005354	Ga0070675_100014403	Ga0070675_1000144033	411
330	3300005354	Ga0070675_100022866	Ga0070675_1000228662	411
331	3300005364	Ga0070673_100024557	Ga0070673_1000245571	411
332	3300005364	Ga0070673_100031130	Ga0070673_1000311303	411
333	3300005365	Ga0070688_100036850	Ga0070688_1000368502	411
334	3300005441	Ga0070700_100010356	Ga0070700_1000103562	411
335	3300005441	Ga0070700_100180090	Ga0070700_1001800901	411
336	3300005543	Ga0070672_100002415	Ga0070672_10000241513	411
337	3300005543	Ga0070672_100019792	Ga0070672_1000197923	411
338	3300005548	Ga0070665_100306026	Ga0070665_1003060262	411
339	3300005719	Ga0068861_100010635	Ga0068861_1000106353	411
340	3300005840	Ga0068870_10000854	Ga0068870_100008542	411
341	3300005840	Ga0068870_10083825	Ga0068870_100838251	411
342	3300005841	Ga0068863_100185125	Ga0068863_1001851251	411
343	3300009094	Ga0111539_10079449	Ga0111539_100794491	411
344	3300013308	Ga0157375_10313653	Ga0157375_103136531	411
345	3300014326	Ga0157380_10045603	Ga0157380_100456033	411
346	3300014326	Ga0157380_10384090	Ga0157380_103840901	411
347	3300014969	Ga0157376_10062960	Ga0157376_100629603	411
348	3300017792	Ga0163161_10167328	Ga0163161_101673283	411
349	3300025292	Ga0209676_1027197	Ga0209676_10271972	411
350	3300025304	Ga0209257_1001718	Ga0209257_10017188	411
351	3300025304	Ga0209257_1004237	Ga0209257_10042374	411
352	3300025893	Ga0207682_10007738	Ga0207682_100077382	411
353	3300025893	Ga0207682_10009029	Ga0207682_100090293	411
354	3300025908	Ga0207643_10010315	Ga0207643_100103153	411
355	3300025908	Ga0207643_10036712	Ga0207643_100367123	411
356	3300025940	Ga0207691_10003370	Ga0207691_1000337013	411
357	3300025940	Ga0207691_10004232	Ga0207691_100042328	411
358	3300025940	Ga0207691_10090531	Ga0207691_100905313	411
359	3300025960	Ga0207651_10018609	Ga0207651_100186093	411
360	3300026088	Ga0207641_10042949	Ga0207641_100429491	411
361	3300026089	Ga0207648_10061599	Ga0207648_100615993	411
362	3300026118	Ga0207675_100015967	Ga0207675_1000159674	411
363	3300026121	Ga0207683_10004214	Ga0207683_100042143	411
364	3300031824	Ga0307413_10004148	Ga0307413_100041485	411
365	3300031852	Ga0307410_10019844	Ga0307410_100198443	411
366	3300031901	Ga0307406_10067598	Ga0307406_100675983	411
367	3300031911	Ga0307412_10034590	Ga0307412_100345903	411
368	3300032004	Ga0307414_10000856	Ga0307414_100008567	411
369	3300032005	Ga0307411_10090725	Ga0307411_100907253	411
370	3300039437	Ga0436365_1208129	Ga0436365_1208129_2362_3615	411
371	3300046616	Ga0495668_0000002	Ga0495668_0000002_394798_396042	411
372	3300048924	Ga0496121_0000674	Ga0496121_0000674_17386_18648	411
373	3300050511	nmdc:mga08y16_106389_c1	nmdc:mga08y16_106389_c1_494_1738	411
374	3300053125	Ga0500618_004426	Ga0500618_004426_445_1707	411
375	iso_pu_bacteria	2643221541	2643731129	411
376	iso_pu_bacteria	2643221606	2644045365	411
377	iso_pu_bacteria	2643221671	2644391858	411
378	iso_pu_bacteria	2885429604	2885429988	411
379	3300003781	Ga0055536_1020943	Ga0055536_10209432	412
380	3300005328	Ga0070676_10071287	Ga0070676_100712871	412
381	3300005336	Ga0070680_100000396	Ga0070680_10000039620	412
382	3300005338	Ga0068868_100000090	Ga0068868_10000009041	412
383	3300005339	Ga0070660_100001190	Ga0070660_10000119022	412
384	3300005344	Ga0070661_100000010	Ga0070661_10000001032	412
385	3300005366	Ga0070659_100000017	Ga0070659_10000001725	412
386	3300005458	Ga0070681_10120556	Ga0070681_101205562	412
387	3300005530	Ga0070679_100000005	Ga0070679_100000005176	412
388	3300009101	Ga0105247_10001770	Ga0105247_100017701	412
389	3300009553	Ga0105249_10000037	Ga0105249_1000003730	412
390	3300013105	Ga0157369_10001604	Ga0157369_1000160428	412
391	3300020081	Ga0206354_10508836	Ga0206354_105088364	412
392	3300020082	Ga0206353_11353765	Ga0206353_113537654	412
393	3300021358	Ga0213873_10000006	Ga0213873_10000006200	412
394	3300021384	Ga0213876_10000004	Ga0213876_10000004706	412
395	3300025291	Ga0209675_1000138	Ga0209675_100013836	412
396	3300025292	Ga0209676_1000175	Ga0209676_1000175120	412
397	3300025292	Ga0209676_1002382	Ga0209676_10023824	412
398	3300025298	Ga0209050_1001472	Ga0209050_100147215	412
399	3300025298	Ga0209050_1002895	Ga0209050_100289513	412
400	3300025304	Ga0209257_1009793	Ga0209257_10097933	412
401	3300025912	Ga0207707_10084726	Ga0207707_100847262	412
402	3300025917	Ga0207660_10000363	Ga0207660_1000036320	412
403	3300025919	Ga0207657_10003258	Ga0207657_1000325823	412
404	3300025921	Ga0207652_10000005	Ga0207652_1000000548	412
405	3300025921	Ga0207652_10000006	Ga0207652_10000006232	412
406	3300025921	Ga0207652_10000007	Ga0207652_10000007233	412
407	3300025921	Ga0207652_10000009	Ga0207652_10000009193	412
408	3300025932	Ga0207690_10000035	Ga0207690_1000003525	412
409	3300026023	Ga0207677_10000317	Ga0207677_1000031725	412
410	3300031456	Ga0307513_10004766	Ga0307513_1000476615	412
411	3300032004	Ga0307414_10011240	Ga0307414_100112404	412
412	3300039437	Ga0436365_0643552	Ga0436365_0643552_5422_6672	412
413	3300039437	Ga0436365_1920122	Ga0436365_1920122_283_1533	412
414	3300039453	Ga0436362_1290848	Ga0436362_1290848_42676_43926	412
415	3300046460	Ga0495638_0046206	Ga0495638_0046206_1076_2326	412
416	3300046500	Ga0495596_0006539	Ga0495596_0006539_1004_2281	412
417	3300046512	Ga0495610_0004089	Ga0495610_0004089_7720_8997	412
418	3300046660	Ga0495625_0000977	Ga0495625_0000977_11824_13071	412
419	3300048091	Ga0495626_0000963	Ga0495626_0000963_6340_7617	412
420	3300053087	Ga0500643_000175	Ga0500643_000175_21514_22776	412
421	3300053108	Ga0500562_009005	Ga0500562_009005_1062_2309	412
422	3300053136	Ga0500559_0005182	Ga0500559_0005182_1491_2753	412
423	3300053158	Ga0500627_0000002	Ga0500627_0000002_36566_37813	412
424	3300055283	Ga0500661_001367	Ga0500661_001367_2528_3790	412
425	iso_pu_bacteria	2643221661	2644343785	412
426	iso_pu_bacteria	2643221666	2644368737	412
427	iso_pu_bacteria	2830075706	2830077630	412
428	iso_pu_bacteria	2990265787	2990266699	412
429	iso_pu_bacteria	2993693658	2993695500	412
430	3300005333	Ga0070677_10002451	Ga0070677_100024515	413
431	3300014326	Ga0157380_10281422	Ga0157380_102814222	413
432	3300025942	Ga0207689_10224162	Ga0207689_102241622	413
433	3300026121	Ga0207683_10257222	Ga0207683_102572222	413
434	3300048921	Ga0496118_0045894	Ga0496118_0045894_1480_2733	413
435	3300053153	Ga0500616_0001591	Ga0500616_0001591_4499_5761	413
436	3300003322	rootL2_10112799	rootL2_101127991	414
437	3300006931	Ga0097620_100001184	Ga0097620_10000118415	414
438	3300009177	Ga0105248_10011005	Ga0105248_100110053	414
439	3300025941	Ga0207711_10022629	Ga0207711_100226295	414
440	3300002774	JGI25150J39212_1000657	JGI25150J39212_100065710	415
441	3300003215	JGI25153J46596_10000266	JGI25153J46596_1000026613	415
442	3300003771	Ga0055526_1004679	Ga0055526_10046791	415
443	3300003773	Ga0055537_1000644	Ga0055537_100064415	415
444	3300003791	Ga0055530_10006500	Ga0055530_100065005	415
445	3300003792	Ga0055540_1000692	Ga0055540_100069220	415
446	3300005539	Ga0068853_100036735	Ga0068853_1000367352	415
447	3300025245	Ga0207425_1000114	Ga0207425_10001144	415
448	3300025258	Ga0209129_1004131	Ga0209129_10041312	415
449	3300025263	Ga0209565_1000298	Ga0209565_100029816	415
450	3300025273	Ga0209673_1012044	Ga0209673_10120442	415
451	3300025292	Ga0209676_1007714	Ga0209676_10077143	415
452	3300025294	Ga0209025_1001326	Ga0209025_10013262	415
453	3300025295	Ga0209564_1001139	Ga0209564_10011391	415
454	3300025295	Ga0209564_1012171	Ga0209564_10121711	415
455	3300025297	Ga0209758_1000004	Ga0209758_10000041255	415
456	3300025298	Ga0209050_1000001	Ga0209050_10000013258	415
457	3300025298	Ga0209050_1009719	Ga0209050_10097194	415
458	3300025302	Ga0207426_1018235	Ga0207426_10182351	415
459	3300025303	Ga0209051_1000336	Ga0209051_100033624	415
460	3300025304	Ga0209257_1001103	Ga0209257_100110315	415
461	3300025304	Ga0209257_1001896	Ga0209257_10018969	415
462	3300041413	Ga0439465_0002246	Ga0439465_0002246_1858_3123	415
463	3300042002	Ga0439442_002717	Ga0439442_002717_321_1586	415
464	3300042004	Ga0439445_0011614	Ga0439445_0011614_11_1276	415
465	3300042006	Ga0439432_000411	Ga0439432_000411_1103_2368	415
466	3300042015	Ga0439462_0001042	Ga0439462_0001042_928_2193	415
467	3300042435	Ga0439434_0031623	Ga0439434_0031623_10_1275	415
468	3300046691	Ga0495670_0036185	Ga0495670_0036185_628_1896	415
469	3300048918	Ga0496115_0000382	Ga0496115_0000382_26388_27638	415
470	3300049571	Ga0501034_0000903	Ga0501034_0000903_23729_25018	415
471	3300053119	Ga0500595_002207	Ga0500595_002207_3259_4512	415
472	iso_pu_bacteria	2643221622	2644126367	415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

230

436

0.92 PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

89

223

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5fch-assembly1.cif.gz_B	crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound	0.9683	32	415
5cde-assembly1.cif.gz_B	r372a mutant of xaa-pro dipeptidase from xanthomonas campestris	0.9681	32	415
5fcf-assembly1.cif.gz_B	crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound	0.9664	32	415
5fcf-assembly1.cif.gz_A	crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound	0.9628	32	415
5fcf-assembly1.cif.gz_B	crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound	0.9353	32	415

ID	Description	Score	Start	End	Superfamily
5fchB02	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9684	183	415	3.90.230.10
5fchB02	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9644	183	415	3.90.230.10
2howB02	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.958	183	409	3.90.230.10
1wy2A02	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9533	184	405	3.90.230.10
af_P9WHS7_144_374_3.90.230.10	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9483	182	409	3.90.230.10

ID	Description	Score	Start	End
AF-A0A2N7XUB1-F1-model_v4	Peptidase	0.9941	322	415
AF-A0A3D3CTI2-F1-model_v4	Peptidase M24 domain-containing protein	0.9905	183	415
AF-A0A7W1FXU2-F1-model_v4	M24 family metallopeptidase	0.9882	265	413
AF-A0A4R6QPY8-F1-model_v4	Xaa-Pro dipeptidase	0.9845	31	413
AF-A0A3B9LU07-F1-model_v4	X-Pro dipeptidase	0.9844	253	415

Feature Viewer

pLDDT	pTM	Quality
92.54	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450790

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00557

Peptidase_M24

Metallopeptidase family M24

230

436

0.92

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

89

223

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map