F450771

General Info

Members Datasets Scaffolds Average Seq Length
472 293 456 218

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100159168|Ga0070716_1001591682
Length 254
Sequence MDVSDKSAKDVLTNILISDTGIGIIQSKFERRQTMALHIGEEAPNFTAETTEGTVNFHEWIGNGWAILFSHPKDFTPVCTTELGYMAGLKSEFEKRNCKVIGLSIDPVTDHKKWSKDIEETQGHAVNYPIIGDSDLKVAKLYDMIHPSASGTSEGRTAADNATVRSVFVVGPDKKIKLMLTYPMTTGRNFDEVLRVVDSMQLTAKHQVATPVNWKQGDDVIIVTSVSDEEAKKKYPSGWKTLKSYLRLVSQPKE

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
5 2643221580 Devosia sp. Root635 Isolate Unclassified
6 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
7 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
8 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
9 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
10 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
11 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
12 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
13 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
14 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
15 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
16 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
257 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
258 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
259 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
260 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
263 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
264 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
268 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
274 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
275 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 92.16
Metatranscriptomes 4.45
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0.85
Rhizoplane 1.27
Rhizosphere 93.86
Stem 0
Stem Tuber 0.21
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1002771 3300003503 Bacteria 1071
2 Ga0058861_12055236 3300004800 Bacteria 799
3 Ga0058862_12740080 3300004803 Bacteria 762
4 Ga0065704_10175272 3300005289 Bacteria 1268
5 Ga0065707_10345144 3300005295 Bacteria 927
6 Ga0065707_10432466 3300005295 Bacteria 819
7 Ga0070658_10136553 3300005327 Bacteria 2046
8 Ga0070676_10104717 3300005328 Bacteria 1753
9 Ga0070670_100101582 3300005331 Bacteria 2476
10 Ga0068869_100071294 3300005334 Bacteria 2573
11 Ga0068869_100453695 3300005334 Bacteria 1063
12 Ga0070666_10228803 3300005335 Bacteria 1313
13 Ga0070660_100122919 3300005339 Bacteria 2072
14 Ga0070691_10375761 3300005341 Bacteria 795
15 Ga0070692_10059026 3300005345 Bacteria 2016
16 Ga0070668_100125193 3300005347 Bacteria 2058
17 Ga0070668_100298403 3300005347 Bacteria 1351
18 Ga0070669_100592841 3300005353 Bacteria 928
19 Ga0070673_100043420 3300005364 Bacteria 3474
20 Ga0070673_100523400 3300005364 Bacteria 1075
21 Ga0070659_100060912 3300005366 Bacteria 2982
22 Ga0070659_100072056 3300005366 Bacteria 2749
23 Ga0070703_10000256 3300005406 Bacteria 25779
24 Ga0070703_10007796 3300005406 Bacteria 3012
25 Ga0070709_10317779 3300005434 Bacteria 1142
26 Ga0070711_100054539 3300005439 Bacteria 2759
27 Ga0070694_100004321 3300005444 Bacteria 8538
28 Ga0070694_100018410 3300005444 Bacteria 4432
29 Ga0070694_100196070 3300005444 Bacteria 1503
30 Ga0070708_100007789 3300005445 Bacteria 8584
31 Ga0070708_100242727 3300005445 Bacteria 1691
32 Ga0070662_100267477 3300005457 Bacteria 1379
33 Ga0070681_10591802 3300005458 Bacteria 1023
34 Ga0068867_100080206 3300005459 Bacteria 2457
35 Ga0070706_100016334 3300005467 Bacteria 6858
36 Ga0070706_100214924 3300005467 Bacteria 1795
37 Ga0070698_100018414 3300005471 Bacteria 7353
38 Ga0070698_100088655 3300005471 Bacteria 3078
39 Ga0070698_100156723 3300005471 Bacteria 2223
40 Ga0070699_100113751 3300005518 Bacteria 2377
41 Ga0070684_100065049 3300005535 Bacteria 3200
42 Ga0068853_100030652 3300005539 Bacteria 4544
43 Ga0068853_100377527 3300005539 Bacteria 1323
44 Ga0068853_100386340 3300005539 Bacteria 1308
45 Ga0070695_100000872 3300005545 Bacteria 16239
46 Ga0070695_100005643 3300005545 Bacteria 7375
47 Ga0070695_100077441 3300005545 Bacteria 2191
48 Ga0070693_100253730 3300005547 Bacteria 1167
49 Ga0070665_100000646 3300005548 Bacteria 47132
50 Ga0070704_100098946 3300005549 Bacteria 2192
51 Ga0070704_100298658 3300005549 Bacteria 1341
52 Ga0068855_100035031 3300005563 Bacteria 5981
53 Ga0068855_100035962 3300005563 Bacteria 5897
54 Ga0070664_100179822 3300005564 Bacteria 1879
55 Ga0068857_100415310 3300005577 Bacteria 1254
56 Ga0068857_100653576 3300005577 Bacteria 997
57 Ga0068856_100426905 3300005614 Bacteria 1345
58 Ga0068859_100292887 3300005617 Bacteria 1721
59 Ga0068864_100089130 3300005618 Bacteria 2718
60 Ga0068864_100248919 3300005618 Bacteria 1649
61 Ga0068860_100094120 3300005843 Bacteria 2856
62 Ga0068860_100504686 3300005843 Bacteria 1208
63 Ga0068862_100003295 3300005844 Bacteria 13970
64 Ga0068862_100131131 3300005844 Bacteria 2217
65 Ga0081455_10000513 3300005937 Bacteria 50176
66 Ga0081455_10086390 3300005937 Bacteria 2555
67 Ga0081538_10006443 3300005981 Bacteria 10332
68 Ga0070717_10384517 3300006028 Bacteria 1259
69 Ga0075365_10147489 3300006038 Bacteria 1635
70 Ga0075365_10300601 3300006038 Bacteria 1129
71 Ga0075432_10135782 3300006058 Bacteria 935
72 Ga0070716_100093335 3300006173 Bacteria 1827
73 Ga0070716_100120663 3300006173 Bacteria 1640
74 Ga0070716_100159168 3300006173 Bacteria 1461
75 Ga0070712_100233123 3300006175 Bacteria 1463
76 Ga0097621_100006576 3300006237 Bacteria 8255
77 Ga0068871_100007917 3300006358 Bacteria 7619
78 Ga0068871_100076603 3300006358 Bacteria 2763
79 Ga0075428_100008177 3300006844 Bacteria 11606
80 Ga0075428_100147898 3300006844 Bacteria 2553
81 Ga0075428_100168253 3300006844 Bacteria 2377
82 Ga0075428_100871880 3300006844 Bacteria 955
83 Ga0075430_100276839 3300006846 Bacteria 1389
84 Ga0075431_100017845 3300006847 Bacteria 7216
85 Ga0075431_100023576 3300006847 Bacteria 6299
86 Ga0075431_100141753 3300006847 Bacteria 2477
87 Ga0075431_100603913 3300006847 Bacteria 1081
88 Ga0075433_10004196 3300006852 Bacteria 11181
89 Ga0075433_10080388 3300006852 Bacteria 2873
90 Ga0075433_10083978 3300006852 Bacteria 2811
91 Ga0075433_10302418 3300006852 Bacteria 1417
92 Ga0075433_10574281 3300006852 Bacteria 990
93 Ga0075433_10611500 3300006852 Bacteria 956
94 Ga0075434_100000893 3300006871 Bacteria 23903
95 Ga0075434_100017723 3300006871 Bacteria 6865
96 Ga0075434_100018271 3300006871 Bacteria 6770
97 Ga0075434_100090394 3300006871 Bacteria 3063
98 Ga0075434_100144970 3300006871 Bacteria 2395
99 Ga0075434_100275326 3300006871 Bacteria 1702
100 Ga0075429_100011612 3300006880 Bacteria 7640
101 Ga0075429_100057654 3300006880 Bacteria 3381
102 Ga0075429_100077851 3300006880 Bacteria 2889
103 Ga0075429_100287500 3300006880 Bacteria 1439
104 Ga0068865_100203135 3300006881 Bacteria 1539
105 Ga0075436_100027435 3300006914 Bacteria 3919
106 Ga0075436_100029555 3300006914 Bacteria 3769
107 Ga0075436_100042341 3300006914 Bacteria 3141
108 Ga0097620_100292862 3300006931 Bacteria 1721
109 Ga0075435_100205719 3300007076 Bacteria 1668
110 Ga0075435_100274495 3300007076 Bacteria 1438
111 Ga0075435_100292360 3300007076 Bacteria 1392
112 Ga0105251_10000194 3300009011 Bacteria 61392
113 Ga0105240_10695610 3300009093 Bacteria 1110
114 Ga0111539_10007267 3300009094 Bacteria 14181
115 Ga0111539_10160930 3300009094 Bacteria 2625
116 Ga0105247_10369902 3300009101 Bacteria 1013
117 Ga0114129_10024444 3300009147 Bacteria 8560
118 Ga0114129_10082020 3300009147 Bacteria 4482
119 Ga0114129_10406565 3300009147 Bacteria 1793
120 Ga0114129_11038099 3300009147 Bacteria 1030
121 Ga0114129_11213239 3300009147 Bacteria 939
122 Ga0105243_10107861 3300009148 Bacteria 2324
123 Ga0105241_10000634 3300009174 Bacteria 26487
124 Ga0105241_10031866 3300009174 Bacteria 3948
125 Ga0105242_10151407 3300009176 Bacteria 2023
126 Ga0105242_10209412 3300009176 Bacteria 1737
127 Ga0105242_10367883 3300009176 Bacteria 1333
128 Ga0105248_10022006 3300009177 Bacteria 7063
129 Ga0105238_10033329 3300009551 Bacteria 5243
130 Ga0105238_10936085 3300009551 Bacteria 886
131 Ga0105249_10189117 3300009553 Bacteria 2008
132 Ga0105249_10552057 3300009553 Bacteria 1203
133 Ga0105249_10810742 3300009553 Bacteria 1000
134 Ga0105239_10099722 3300010375 Bacteria 3212
135 Ga0157370_10002788 3300013104 Bacteria 20877
136 Ga0157370_10100210 3300013104 Bacteria 2714
137 Ga0157369_10000278 3300013105 Bacteria 68926
138 Ga0157369_10000884 3300013105 Bacteria 38185
139 Ga0157374_10257527 3300013296 Bacteria 1718
140 Ga0163162_10168852 3300013306 Bacteria 2312
141 Ga0157372_10036009 3300013307 Bacteria 5452
142 Ga0157375_11260214 3300013308 Bacteria 868
143 Ga0163163_10027081 3300014325 Bacteria 5485
144 Ga0163163_10035713 3300014325 Bacteria 4824
145 Ga0163163_10074171 3300014325 Bacteria 3394
146 Ga0163163_10098969 3300014325 Bacteria 2938
147 Ga0163163_10175799 3300014325 Bacteria 2188
148 Ga0163163_10221720 3300014325 Bacteria 1940
149 Ga0157376_10000014 3300014969 Bacteria 303001
150 Ga0157376_10000713 3300014969 Bacteria 21503
151 Ga0183361_10004 3300016635 Bacteria 484183
152 Ga0197907_10243966 3300020069 Bacteria 1505
153 Ga0206356_10612726 3300020070 Bacteria 2667
154 Ga0206349_1585616 3300020075 Bacteria 1009
155 Ga0206355_1069331 3300020076 Bacteria 825
156 Ga0206351_10379826 3300020077 Bacteria 853
157 Ga0206351_10534409 3300020077 Bacteria 1345
158 Ga0206352_10471761 3300020078 Bacteria 917
159 Ga0206352_11245840 3300020078 Bacteria 970
160 Ga0206350_11239942 3300020080 Bacteria 1219
161 Ga0206354_11328338 3300020081 Bacteria 1564
162 Ga0206354_11444182 3300020081 Bacteria 2168
163 Ga0206353_10090539 3300020082 Bacteria 3313
164 Ga0206353_10635380 3300020082 Bacteria 1187
165 Ga0154015_1663104 3300020610 Bacteria 787
166 Ga0224712_10002203 3300022467 Bacteria 4757
167 Ga0224712_10135579 3300022467 Bacteria 1079
168 Ga0224712_10139681 3300022467 Bacteria 1065
169 Ga0224712_10205408 3300022467 Bacteria 897
170 Ga0207653_10002105 3300025885 Bacteria 6344
171 Ga0207653_10025775 3300025885 Bacteria 1882
172 Ga0207692_10345961 3300025898 Bacteria 915
173 Ga0207642_10162773 3300025899 Bacteria 1200
174 Ga0207699_10115930 3300025906 Bacteria 1724
175 Ga0207705_10000720 3300025909 Bacteria 27227
176 Ga0207684_10004828 3300025910 Bacteria 12613
177 Ga0207684_10005115 3300025910 Bacteria 12218
178 Ga0207684_10345876 3300025910 Bacteria 1280
179 Ga0207654_10039439 3300025911 Bacteria 2656
180 Ga0207707_10295572 3300025912 Bacteria 1401
181 Ga0207695_10289269 3300025913 Bacteria 1531
182 Ga0207695_10656752 3300025913 Bacteria 929
183 Ga0207671_10097047 3300025914 Bacteria 2228
184 Ga0207671_10316772 3300025914 Bacteria 1234
185 Ga0207693_10131319 3300025915 Bacteria 1969
186 Ga0207693_10237654 3300025915 Bacteria 1430
187 Ga0207663_10038733 3300025916 Bacteria 2884
188 Ga0207657_10192740 3300025919 Bacteria 1643
189 Ga0207657_10219037 3300025919 Bacteria 1525
190 Ga0207649_10014807 3300025920 Bacteria 4374
191 Ga0207646_10001173 3300025922 Bacteria 33196
192 Ga0207646_10006313 3300025922 Bacteria 12284
193 Ga0207681_10483096 3300025923 Bacteria 1012
194 Ga0207694_10089082 3300025924 Bacteria 2433
195 Ga0207694_10092273 3300025924 Bacteria 2390
196 Ga0207694_10658408 3300025924 Bacteria 882
197 Ga0207687_10173020 3300025927 Bacteria 1667
198 Ga0207700_10339793 3300025928 Bacteria 1305
199 Ga0207664_10210276 3300025929 Bacteria 1683
200 Ga0207644_10012039 3300025931 Bacteria 5737
201 Ga0207690_10200962 3300025932 Bacteria 1514
202 Ga0207706_10043744 3300025933 Bacteria 3968
203 Ga0207686_10123556 3300025934 Bacteria 1765
204 Ga0207686_10134141 3300025934 Bacteria 1702
205 Ga0207709_10058696 3300025935 Bacteria 2392
206 Ga0207665_10015178 3300025939 Bacteria 5059
207 Ga0207711_10026410 3300025941 Bacteria 4872
208 Ga0207689_10022906 3300025942 Bacteria 5246
209 Ga0207689_10220292 3300025942 Bacteria 1568
210 Ga0207667_10015774 3300025949 Bacteria 8567
211 Ga0207667_10017618 3300025949 Bacteria 8034
212 Ga0207651_10130988 3300025960 Bacteria 1920
213 Ga0207712_10586245 3300025961 Bacteria 963
214 Ga0207677_10266243 3300026023 Bacteria 1400
215 Ga0207703_10413985 3300026035 Bacteria 1253
216 Ga0207639_10135263 3300026041 Bacteria 2046
217 Ga0207639_10371117 3300026041 Bacteria 1283
218 Ga0207639_10770946 3300026041 Bacteria 895
219 Ga0207702_10118699 3300026078 Bacteria 2364
220 Ga0207702_10466006 3300026078 Bacteria 1228
221 Ga0207641_10433219 3300026088 Bacteria 1268
222 Ga0207648_10114772 3300026089 Bacteria 2366
223 Ga0207648_10250879 3300026089 Bacteria 1577
224 Ga0207676_10161019 3300026095 Bacteria 1944
225 Ga0207674_10031593 3300026116 Bacteria 5560
226 Ga0207674_10121661 3300026116 Bacteria 2577
227 Ga0207674_10162202 3300026116 Bacteria 2189
228 Ga0207674_10549444 3300026116 Bacteria 1116
229 Ga0207683_10107766 3300026121 Bacteria 2493
230 Ga0207698_10541299 3300026142 Bacteria 1140
231 Ga0209371_1009497 3300027312 Bacteria 3086
232 Ga0209969_1007355 3300027360 Bacteria 1555
233 Ga0209967_1009685 3300027364 Bacteria 1337
234 Ga0209981_1013652 3300027378 Bacteria 1131
235 Ga0209984_1009636 3300027424 Bacteria 1230
236 Ga0210000_1010095 3300027462 Bacteria 1395
237 Ga0209995_1008768 3300027471 Bacteria 1633
238 Ga0209968_1004399 3300027526 Bacteria 2115
239 Ga0209999_1008179 3300027543 Bacteria 1882
240 Ga0209970_1002040 3300027614 Bacteria 3464
241 Ga0210002_1013841 3300027617 Bacteria 1262
242 Ga0209983_1000006 3300027665 Bacteria 24144
243 Ga0209971_1000053 3300027682 Bacteria 37308
244 Ga0209966_1000266 3300027695 Bacteria 18647
245 Ga0209998_10002739 3300027717 Bacteria 3975
246 Ga0209974_10004512 3300027876 Bacteria 4958
247 Ga0207428_10010128 3300027907 Bacteria 8431
248 Ga0268266_10000349 3300028379 Bacteria 71878
249 Ga0268265_10004291 3300028380 Bacteria 9948
250 Ga0268265_10617194 3300028380 Bacteria 1038
251 Ga0268264_10098553 3300028381 Bacteria 2535
252 Ga0268264_10485916 3300028381 Bacteria 1202
253 Ga0268264_10899727 3300028381 Bacteria 888
254 Ga0265338_10002812 3300028800 Bacteria 25407
255 Ga0265325_10066771 3300031241 Bacteria 1813
256 Ga0316578_10010592 3300031728 Bacteria 4792
257 Ga0307405_10005003 3300031731 Bacteria 6335
258 Ga0307413_10050804 3300031824 Bacteria 2494
259 Ga0307413_10103250 3300031824 Bacteria 1889
260 Ga0307413_10108847 3300031824 Bacteria 1850
261 Ga0307410_10189146 3300031852 Bacteria 1564
262 Ga0307406_10036406 3300031901 Bacteria 3032
263 Ga0307406_10044493 3300031901 Bacteria 2782
264 Ga0307406_10159456 3300031901 Bacteria 1620
265 Ga0307406_10188881 3300031901 Bacteria 1506
266 Ga0307407_10065128 3300031903 Bacteria 2144
267 Ga0307412_10025889 3300031911 Bacteria 3639
268 Ga0307412_10185417 3300031911 Bacteria 1569
269 Ga0307409_100048126 3300031995 Bacteria 3242
270 Ga0307409_100109999 3300031995 Bacteria 2308
271 Ga0307409_100372832 3300031995 Bacteria 1354
272 Ga0307416_100024960 3300032002 Bacteria 4374
273 Ga0307416_100118887 3300032002 Bacteria 2349
274 Ga0307416_100157819 3300032002 Bacteria 2091
275 Ga0307414_10007670 3300032004 Bacteria 6077
276 Ga0307414_10039518 3300032004 Bacteria 3178
277 Ga0307414_10121902 3300032004 Bacteria 2006
278 Ga0307411_10055954 3300032005 Bacteria 2597
279 Ga0307411_10250715 3300032005 Bacteria 1392
280 Ga0307411_10287122 3300032005 Bacteria 1313
281 Ga0307415_100017380 3300032126 Bacteria 4311
282 Ga0307415_100304082 3300032126 Bacteria 1322
283 Ga0373950_0010589 3300034818 Bacteria 1493
284 Ga0373937_0389658 3300036401 Bacteria 1322
285 Ga0316582_0041873 3300036647 Bacteria 2866
286 Ga0316584_0005782 3300036712 Bacteria 8339
287 Ga0395899_0000423 3300037312 Bacteria 48936
288 Ga0395899_0185322 3300037312 Bacteria 1459
289 Ga0395899_0273133 3300037312 Bacteria 1152
290 Ga0395900_0000607 3300037418 Bacteria 48936
291 Ga0395900_0001360 3300037418 Bacteria 29423
292 Ga0395900_0089292 3300037418 Bacteria 3168
293 Ga0395900_0205010 3300037418 Bacteria 1993
294 Ga0395900_0481509 3300037418 Bacteria 1193
295 Ga0395898_0000695 3300037466 Bacteria 60320
296 Ga0395898_0001367 3300037466 Bacteria 35066
297 Ga0395898_0024251 3300037466 Bacteria 6119
298 Ga0395898_0362242 3300037466 Bacteria 1382
299 Ga0395905_0000103 3300037471 Bacteria 143491
300 Ga0436364_1240134 3300037853 Bacteria 27720
301 Ga0395901_0000004 3300038443 Bacteria 657361
302 Ga0395901_0000045 3300038443 Bacteria 188874
303 Ga0395901_0005973 3300038443 Bacteria 12326
304 Ga0400483_023391 3300039062 Bacteria 5138
305 Ga0400483_265909 3300039062 Bacteria 8765
306 Ga0436365_0060709 3300039437 Bacteria 1868
307 Ga0439440_0042365 3300042993 Bacteria 1114
308 Ga0453683_0027447 3300044673 Bacteria 3611
309 Ga0453683_0255042 3300044673 Bacteria 1118
310 Ga0453683_0533242 3300044673 Bacteria 763
311 Ga0466966_0000017 3300044684 Bacteria 123642
312 Ga0466961_0000325 3300044693 Bacteria 31512
313 Ga0466963_0017483 3300044694 Bacteria 4470
314 Ga0466963_0024268 3300044694 Bacteria 3860
315 Ga0466971_0007513 3300044719 Bacteria 4749
316 Ga0466959_0037652 3300045049 Bacteria 3574
317 Ga0451576_0021995 3300045051 Bacteria 6923
318 Ga0451576_0118305 3300045051 Bacteria 2758
319 Ga0451576_0238168 3300045051 Bacteria 1901
320 Ga0451576_1220608 3300045051 Bacteria 785
321 Ga0466958_0004644 3300045836 Bacteria 7284
322 Ga0495603_0002695 3300046455 Bacteria 10470
323 Ga0495603_0008219 3300046455 Bacteria 6308
324 Ga0495590_0009434 3300046457 Bacteria 3703
325 Ga0495641_0117878 3300046461 Bacteria 1184
326 Ga0495582_0005047 3300046473 Bacteria 7397
327 Ga0495582_0035827 3300046473 Bacteria 2729
328 Ga0495639_0071288 3300046475 Bacteria 1605
329 Ga0495664_0258274 3300046477 Bacteria 1053
330 Ga0495594_0003021 3300046499 Bacteria 8718
331 Ga0495618_0004414 3300046514 Bacteria 8651
332 Ga0495618_0240620 3300046514 Bacteria 1138
333 Ga0495620_0205731 3300046515 Bacteria 756
334 Ga0495666_0001106 3300046526 Bacteria 12894
335 Ga0495666_0005970 3300046526 Bacteria 6137
336 Ga0495666_0106006 3300046526 Bacteria 1323
337 Ga0495665_0031036 3300046531 Bacteria 2860
338 Ga0495665_0036954 3300046531 Bacteria 2607
339 Ga0495640_0032847 3300046533 Bacteria 3693
340 Ga0495640_0063365 3300046533 Bacteria 2504
341 Ga0495586_0012495 3300046535 Bacteria 4504
342 Ga0495586_0035511 3300046535 Bacteria 2678
343 Ga0495587_0052826 3300046536 Bacteria 2397
344 Ga0495597_0002825 3300046542 Bacteria 10645
345 Ga0495634_0064131 3300046642 Bacteria 2436
346 Ga0495634_0210001 3300046642 Bacteria 1205
347 Ga0495647_0017183 3300046681 Bacteria 2556
348 Ga0495647_0051345 3300046681 Bacteria 1602
349 Ga0495658_0038624 3300046683 Bacteria 2644
350 Ga0495669_0087215 3300046684 Bacteria 1438
351 Ga0495613_0021790 3300046689 Bacteria 4775
352 Ga0495613_0268770 3300046689 Bacteria 1186
353 Ga0495670_0173626 3300046691 Bacteria 1136
354 Ga0495600_0386801 3300046809 Bacteria 872
355 Ga0495581_0010849 3300047315 Bacteria 5267
356 Ga0495636_0154274 3300047318 Bacteria 1032
357 Ga0495674_0012162 3300047319 Bacteria 8112
358 Ga0495674_0067214 3300047319 Bacteria 3106
359 Ga0495674_0304514 3300047319 Bacteria 1301
360 Ga0495674_0391855 3300047319 Bacteria 1122
361 Ga0495676_0088039 3300047321 Bacteria 2331
362 Ga0495676_0097295 3300047321 Bacteria 2186
363 Ga0495680_0056793 3300047322 Bacteria 3030
364 Ga0495680_0089832 3300047322 Bacteria 2306
365 Ga0495687_002912 3300047443 Bacteria 13024
366 Ga0495684_0307315 3300047471 Bacteria 1137
367 Ga0495614_0085836 3300048089 Bacteria 1366
368 Ga0496103_0463924 3300048906 Bacteria 812
369 Ga0496110_0710656 3300048913 Bacteria 907
370 Ga0496115_0025705 3300048918 Bacteria 4588
371 Ga0496115_0056761 3300048918 Bacteria 3147
372 Ga0496115_0103415 3300048918 Bacteria 2336
373 Ga0496119_0003345 3300048922 Bacteria 16706
374 Ga0496125_0125431 3300048928 Bacteria 1820
375 Ga0496126_0015367 3300048929 Bacteria 7700
376 Ga0496126_0033492 3300048929 Bacteria 4833
377 Ga0501033_0013128 3300049570 Bacteria 6311
378 Ga0501034_0000815 3300049571 Bacteria 46393
379 Ga0501039_0003167 3300049575 Bacteria 12305
380 Ga0501039_0123875 3300049575 Bacteria 2027
381 Ga0501039_0260537 3300049575 Bacteria 1363
382 Ga0501040_0002517 3300049576 Bacteria 11808
383 Ga0501041_0089395 3300049577 Bacteria 1901
384 Ga0501042_0006696 3300049578 Bacteria 7506
385 Ga0501043_0099494 3300049579 Bacteria 2286
386 Ga0501043_0404063 3300049579 Bacteria 1032
387 Ga0501046_0022553 3300049580 Bacteria 5187
388 Ga0501047_0003825 3300049581 Bacteria 14151
389 Ga0501071_0013369 3300049587 Bacteria 5593
390 Ga0501072_0016746 3300049588 Bacteria 5630
391 Ga0501072_0176689 3300049588 Bacteria 1703
392 Ga0501074_0036383 3300049590 Bacteria 3566
393 Ga0501075_0536970 3300049591 Bacteria 892
394 Ga0501075_0590059 3300049591 Bacteria 847
395 Ga0501076_0079595 3300049592 Bacteria 2629
396 Ga0501076_0466608 3300049592 Bacteria 1040
397 Ga0501077_0001190 3300049593 Bacteria 15711
398 Ga0501077_0009303 3300049593 Bacteria 6100
399 Ga0501077_0101517 3300049593 Bacteria 1823
400 Ga0501198_027296 3300049649 Bacteria 937
401 Ga0501202_010593 3300049652 Bacteria 1714
402 Ga0501216_005477 3300049660 Bacteria 1917
403 Ga0501217_007715 3300049661 Bacteria 2312
404 Ga0501224_007742 3300049664 Bacteria 1564
405 Ga0501235_005500 3300049669 Bacteria 2759
406 Ga0501239_009062 3300049672 Bacteria 1075
407 Ga0501240_029743 3300049673 Bacteria 867
408 Ga0501242_001340 3300049674 Bacteria 2450
409 Ga0501249_014893 3300049679 Bacteria 1659
410 Ga0501225_0006489 3300049705 Bacteria 3416
411 Ga0501234_013702 3300049707 Bacteria 1272
412 Ga0501245_029786 3300049708 Bacteria 897
413 Ga0501079_0121379 3300049741 Bacteria 2032
414 Ga0501080_0530884 3300049742 Bacteria 1049
415 Ga0501081_0109955 3300049743 Bacteria 1955
416 Ga0501268_052966 3300049765 Bacteria 789
417 Ga0501270_005930 3300049767 Bacteria 1442
418 Ga0501273_004553 3300049770 Bacteria 1528
419 Ga0501283_032880 3300049779 Bacteria 876
420 Ga0501035_0001658 3300049822 Bacteria 22498
421 Ga0501044_0007034 3300049823 Bacteria 12379
422 Ga0501045_0004319 3300049824 Bacteria 9802
423 nmdc:mga0yw44_261695_c1 3300050492 Bacteria 1153
424 nmdc:mga05p37_197667_c1 3300050507 Bacteria 2438
425 nmdc:mga05p37_265810_c1 3300050507 Bacteria 2051
426 nmdc:mga05p37_2855_c1 3300050507 Bacteria 20059
427 nmdc:mga05p37_434777_c1 3300050507 Bacteria 1524
428 nmdc:mga05p37_461784_c1 3300050507 Bacteria 1467
429 nmdc:mga05p37_86928_c1 3300050507 Bacteria 3853
430 nmdc:mga09592_109557_c1 3300050508 Bacteria 2369
431 nmdc:mga09592_495928_c1 3300050508 Bacteria 1052
432 nmdc:mga09592_691241_c1 3300050508 Bacteria 869
433 nmdc:mga0qj67_290981_c1 3300050509 Bacteria 1324
434 nmdc:mga06r32_251739_c1 3300050510 Bacteria 1754
435 nmdc:mga06r32_379391_c1 3300050510 Bacteria 1397
436 nmdc:mga08y16_3855_c1 3300050511 Bacteria 15590
437 nmdc:mga0n895_1063_c1 3300050512 Bacteria 20007
438 nmdc:mga0n895_21709_c1 3300050512 Bacteria 6008
439 nmdc:mga0n895_33489_c1 3300050512 Bacteria 4939
440 nmdc:mga0n895_631680_c1 3300050512 Bacteria 1071
441 nmdc:mga0n895_817320_c1 3300050512 Bacteria 922
442 nmdc:mga0rr50_279486_c1 3300050513 Bacteria 1393
443 nmdc:mga0rr50_321363_c1 3300050513 Bacteria 1298
444 nmdc:mga0rr50_599927_c1 3300050513 Bacteria 939
445 nmdc:mga0rr50_95053_c1 3300050513 Bacteria 2329
446 nmdc:mga08x19_694996_c1 3300050514 Bacteria 722
447 nmdc:mga0a205_124591_c1 3300050515 Bacteria 2476
448 nmdc:mga0a205_14184_c1 3300050515 Bacteria 7433
449 nmdc:mga0a205_235532_c1 3300050515 Bacteria 1713
450 nmdc:mga0a205_33756_c1 3300050515 Bacteria 4907
451 Ga0501084_0051479 3300054114 Bacteria 3446
452 Ga0501084_0435999 3300054114 Bacteria 1108
453 Ga0587083_0065035 3300059505 Bacteria 832
454 Ga0501082_0004636 3300060353 Bacteria 11995
455 Ga0501082_0510884 3300060353 Bacteria 1050
456 Ga0530510_0007516 3300061734 Bacteria 7589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100372832 Ga0307409_1003728322 197
2 3300046455 Ga0495603_0002695 Ga0495603_0002695_7322_7936 200
3 3300048906 Ga0496103_0463924 Ga0496103_0463924_62_688 201
4 3300049779 Ga0501283_032880 Ga0501283_032880_11_670 204
5 iso_pu_bacteria 2513237166 2514052189 206
6 iso_pu_bacteria 2894652903 2894657401 206
7 3300046681 Ga0495647_0051345 Ga0495647_0051345_632_1276 207
8 iso_pu_bacteria 2508501125 2509129422 207
9 iso_pu_bacteria 2513237151 2513962421 207
10 iso_pu_bacteria 2526164713 2527079179 207
11 iso_pu_bacteria 2643221580 2643912010 207
12 iso_pu_bacteria 2738541296 2738820075 207
13 iso_pu_bacteria 2738541298 2738832555 207
14 iso_pu_bacteria 2738541306 2738874082 207
15 iso_pu_bacteria 2738543002 2739185712 207
16 iso_pu_bacteria 2738543008 2739220680 207
17 iso_pu_bacteria 2885427238 2885428787 207
18 iso_pu_bacteria 2900634093 2900636200 207
19 iso_pu_bacteria 2945934425 2945935465 207
20 iso_pu_bacteria 2990703756 2990703985 207
21 iso_pu_bacteria 641736151 642422143 207
22 3300005331 Ga0070670_100101582 Ga0070670_1001015823 208
23 3300005364 Ga0070673_100523400 Ga0070673_1005234001 209
24 3300005439 Ga0070711_100054539 Ga0070711_1000545392 209
25 3300005539 Ga0068853_100377527 Ga0068853_1003775272 209
26 3300005548 Ga0070665_100000646 Ga0070665_1000006469 209
27 3300005577 Ga0068857_100415310 Ga0068857_1004153102 209
28 3300005614 Ga0068856_100426905 Ga0068856_1004269052 209
29 3300006173 Ga0070716_100120663 Ga0070716_1001206631 209
30 3300006175 Ga0070712_100233123 Ga0070712_1002331232 209
31 3300006237 Ga0097621_100006576 Ga0097621_1000065764 209
32 3300006358 Ga0068871_100007917 Ga0068871_1000079175 209
33 3300006871 Ga0075434_100018271 Ga0075434_1000182713 209
34 3300006871 Ga0075434_100144970 Ga0075434_1001449702 209
35 3300009101 Ga0105247_10369902 Ga0105247_103699021 209
36 3300009551 Ga0105238_10936085 Ga0105238_109360851 209
37 3300014969 Ga0157376_10000713 Ga0157376_1000071319 209
38 3300025915 Ga0207693_10131319 Ga0207693_101313192 209
39 3300025915 Ga0207693_10237654 Ga0207693_102376542 209
40 3300025916 Ga0207663_10038733 Ga0207663_100387332 209
41 3300025929 Ga0207664_10210276 Ga0207664_102102761 209
42 3300026035 Ga0207703_10413985 Ga0207703_104139851 209
43 3300026041 Ga0207639_10135263 Ga0207639_101352632 209
44 3300026078 Ga0207702_10118699 Ga0207702_101186991 209
45 3300026116 Ga0207674_10162202 Ga0207674_101622023 209
46 3300028379 Ga0268266_10000349 Ga0268266_1000034957 209
47 3300046455 Ga0495603_0008219 Ga0495603_0008219_1496_2152 209
48 3300046461 Ga0495641_0117878 Ga0495641_0117878_112_768 209
49 3300046473 Ga0495582_0035827 Ga0495582_0035827_369_1025 209
50 3300046514 Ga0495618_0240620 Ga0495618_0240620_136_792 209
51 3300046526 Ga0495666_0005970 Ga0495666_0005970_3949_4605 209
52 3300046526 Ga0495666_0106006 Ga0495666_0106006_552_1208 209
53 3300046531 Ga0495665_0031036 Ga0495665_0031036_752_1408 209
54 3300046533 Ga0495640_0032847 Ga0495640_0032847_1400_2056 209
55 3300046535 Ga0495586_0035511 Ga0495586_0035511_360_1016 209
56 3300046642 Ga0495634_0064131 Ga0495634_0064131_631_1287 209
57 3300046681 Ga0495647_0017183 Ga0495647_0017183_595_1251 209
58 3300046683 Ga0495658_0038624 Ga0495658_0038624_1941_2597 209
59 3300046689 Ga0495613_0021790 Ga0495613_0021790_2356_3012 209
60 3300047315 Ga0495581_0010849 Ga0495581_0010849_3964_4620 209
61 3300047319 Ga0495674_0067214 Ga0495674_0067214_1806_2462 209
62 3300047321 Ga0495676_0097295 Ga0495676_0097295_1179_1835 209
63 3300047322 Ga0495680_0056793 Ga0495680_0056793_945_1601 209
64 3300048089 Ga0495614_0085836 Ga0495614_0085836_136_792 209
65 3300048918 Ga0496115_0025705 Ga0496115_0025705_3538_4194 209
66 3300050512 nmdc:mga0n895_33489_c1 nmdc:mga0n895_33489_c1_1680_2336 209
67 3300050514 nmdc:mga08x19_694996_c1 nmdc:mga08x19_694996_c1_53_709 209
68 3300005289 Ga0065704_10175272 Ga0065704_101752722 210
69 3300005295 Ga0065707_10345144 Ga0065707_103451441 210
70 3300005327 Ga0070658_10136553 Ga0070658_101365532 210
71 3300005334 Ga0068869_100453695 Ga0068869_1004536951 210
72 3300005335 Ga0070666_10228803 Ga0070666_102288032 210
73 3300005339 Ga0070660_100122919 Ga0070660_1001229192 210
74 3300005353 Ga0070669_100592841 Ga0070669_1005928411 210
75 3300005364 Ga0070673_100043420 Ga0070673_1000434202 210
76 3300005366 Ga0070659_100060912 Ga0070659_1000609124 210
77 3300005366 Ga0070659_100072056 Ga0070659_1000720562 210
78 3300005406 Ga0070703_10007796 Ga0070703_100077962 210
79 3300005434 Ga0070709_10317779 Ga0070709_103177792 210
80 3300005444 Ga0070694_100018410 Ga0070694_1000184103 210
81 3300005445 Ga0070708_100007789 Ga0070708_1000077896 210
82 3300005445 Ga0070708_100242727 Ga0070708_1002427272 210
83 3300005457 Ga0070662_100267477 Ga0070662_1002674771 210
84 3300005458 Ga0070681_10591802 Ga0070681_105918021 210
85 3300005467 Ga0070706_100016334 Ga0070706_1000163343 210
86 3300005467 Ga0070706_100214924 Ga0070706_1002149242 210
87 3300005471 Ga0070698_100018414 Ga0070698_10001841410 210
88 3300005471 Ga0070698_100088655 Ga0070698_1000886552 210
89 3300005471 Ga0070698_100156723 Ga0070698_1001567232 210
90 3300005518 Ga0070699_100113751 Ga0070699_1001137512 210
91 3300005535 Ga0070684_100065049 Ga0070684_1000650492 210
92 3300005539 Ga0068853_100030652 Ga0068853_1000306523 210
93 3300005539 Ga0068853_100386340 Ga0068853_1003863401 210
94 3300005545 Ga0070695_100077441 Ga0070695_1000774412 210
95 3300005547 Ga0070693_100253730 Ga0070693_1002537302 210
96 3300005549 Ga0070704_100098946 Ga0070704_1000989462 210
97 3300005563 Ga0068855_100035031 Ga0068855_1000350317 210
98 3300005563 Ga0068855_100035962 Ga0068855_1000359626 210
99 3300005564 Ga0070664_100179822 Ga0070664_1001798222 210
100 3300005577 Ga0068857_100653576 Ga0068857_1006535762 210
101 3300005617 Ga0068859_100292887 Ga0068859_1002928872 210
102 3300005618 Ga0068864_100089130 Ga0068864_1000891302 210
103 3300005618 Ga0068864_100248919 Ga0068864_1002489192 210
104 3300005843 Ga0068860_100094120 Ga0068860_1000941202 210
105 3300005844 Ga0068862_100131131 Ga0068862_1001311312 210
106 3300005937 Ga0081455_10000513 Ga0081455_1000051336 210
107 3300006028 Ga0070717_10384517 Ga0070717_103845172 210
108 3300006038 Ga0075365_10147489 Ga0075365_101474893 210
109 3300006038 Ga0075365_10300601 Ga0075365_103006012 210
110 3300006173 Ga0070716_100093335 Ga0070716_1000933352 210
111 3300006358 Ga0068871_100076603 Ga0068871_1000766032 210
112 3300006844 Ga0075428_100008177 Ga0075428_1000081775 210
113 3300006844 Ga0075428_100147898 Ga0075428_1001478982 210
114 3300006844 Ga0075428_100168253 Ga0075428_1001682531 210
115 3300006844 Ga0075428_100871880 Ga0075428_1008718801 210
116 3300006846 Ga0075430_100276839 Ga0075430_1002768392 210
117 3300006847 Ga0075431_100017845 Ga0075431_1000178456 210
118 3300006847 Ga0075431_100023576 Ga0075431_1000235763 210
119 3300006847 Ga0075431_100141753 Ga0075431_1001417532 210
120 3300006852 Ga0075433_10004196 Ga0075433_100041965 210
121 3300006852 Ga0075433_10080388 Ga0075433_100803883 210
122 3300006852 Ga0075433_10083978 Ga0075433_100839782 210
123 3300006852 Ga0075433_10302418 Ga0075433_103024181 210
124 3300006852 Ga0075433_10574281 Ga0075433_105742811 210
125 3300006852 Ga0075433_10611500 Ga0075433_106115002 210
126 3300006871 Ga0075434_100000893 Ga0075434_1000008936 210
127 3300006871 Ga0075434_100017723 Ga0075434_10001772310 210
128 3300006871 Ga0075434_100090394 Ga0075434_1000903943 210
129 3300006871 Ga0075434_100275326 Ga0075434_1002753262 210
130 3300006880 Ga0075429_100011612 Ga0075429_1000116124 210
131 3300006880 Ga0075429_100057654 Ga0075429_1000576542 210
132 3300006880 Ga0075429_100077851 Ga0075429_1000778511 210
133 3300006880 Ga0075429_100287500 Ga0075429_1002875002 210
134 3300006881 Ga0068865_100203135 Ga0068865_1002031351 210
135 3300006914 Ga0075436_100027435 Ga0075436_1000274352 210
136 3300006914 Ga0075436_100029555 Ga0075436_1000295554 210
137 3300006914 Ga0075436_100042341 Ga0075436_1000423413 210
138 3300006931 Ga0097620_100292862 Ga0097620_1002928623 210
139 3300007076 Ga0075435_100205719 Ga0075435_1002057192 210
140 3300007076 Ga0075435_100274495 Ga0075435_1002744952 210
141 3300007076 Ga0075435_100292360 Ga0075435_1002923602 210
142 3300009011 Ga0105251_10000194 Ga0105251_1000019446 210
143 3300009093 Ga0105240_10695610 Ga0105240_106956101 210
144 3300009094 Ga0111539_10007267 Ga0111539_100072673 210
145 3300009094 Ga0111539_10160930 Ga0111539_101609303 210
146 3300009147 Ga0114129_10024444 Ga0114129_100244446 210
147 3300009147 Ga0114129_11038099 Ga0114129_110380992 210
148 3300009147 Ga0114129_11213239 Ga0114129_112132391 210
149 3300009148 Ga0105243_10107861 Ga0105243_101078612 210
150 3300009174 Ga0105241_10031866 Ga0105241_100318663 210
151 3300009176 Ga0105242_10151407 Ga0105242_101514072 210
152 3300009176 Ga0105242_10209412 Ga0105242_102094121 210
153 3300009176 Ga0105242_10367883 Ga0105242_103678832 210
154 3300009177 Ga0105248_10022006 Ga0105248_100220063 210
155 3300009551 Ga0105238_10033329 Ga0105238_100333298 210
156 3300009553 Ga0105249_10552057 Ga0105249_105520571 210
157 3300009553 Ga0105249_10810742 Ga0105249_108107422 210
158 3300010375 Ga0105239_10099722 Ga0105239_100997222 210
159 3300013104 Ga0157370_10002788 Ga0157370_1000278814 210
160 3300013104 Ga0157370_10100210 Ga0157370_101002102 210
161 3300013105 Ga0157369_10000278 Ga0157369_1000027826 210
162 3300013105 Ga0157369_10000884 Ga0157369_1000088425 210
163 3300013296 Ga0157374_10257527 Ga0157374_102575272 210
164 3300013306 Ga0163162_10168852 Ga0163162_101688522 210
165 3300013307 Ga0157372_10036009 Ga0157372_100360092 210
166 3300013308 Ga0157375_11260214 Ga0157375_112602141 210
167 3300014325 Ga0163163_10027081 Ga0163163_100270813 210
168 3300014325 Ga0163163_10035713 Ga0163163_100357136 210
169 3300014325 Ga0163163_10074171 Ga0163163_100741713 210
170 3300014325 Ga0163163_10098969 Ga0163163_100989692 210
171 3300014325 Ga0163163_10175799 Ga0163163_101757992 210
172 3300014969 Ga0157376_10000014 Ga0157376_1000001482 210
173 3300016635 Ga0183361_10004 Ga0183361_100046 210
174 3300020069 Ga0197907_10243966 Ga0197907_102439662 210
175 3300020070 Ga0206356_10612726 Ga0206356_106127263 210
176 3300020075 Ga0206349_1585616 Ga0206349_15856161 210
177 3300020076 Ga0206355_1069331 Ga0206355_10693311 210
178 3300020077 Ga0206351_10379826 Ga0206351_103798261 210
179 3300020077 Ga0206351_10534409 Ga0206351_105344092 210
180 3300020078 Ga0206352_10471761 Ga0206352_104717611 210
181 3300020078 Ga0206352_11245840 Ga0206352_112458401 210
182 3300020080 Ga0206350_11239942 Ga0206350_112399422 210
183 3300020081 Ga0206354_11328338 Ga0206354_113283382 210
184 3300020081 Ga0206354_11444182 Ga0206354_114441822 210
185 3300020082 Ga0206353_10090539 Ga0206353_100905394 210
186 3300020082 Ga0206353_10635380 Ga0206353_106353802 210
187 3300020610 Ga0154015_1663104 Ga0154015_16631041 210
188 3300022467 Ga0224712_10002203 Ga0224712_100022036 210
189 3300022467 Ga0224712_10135579 Ga0224712_101355792 210
190 3300022467 Ga0224712_10139681 Ga0224712_101396811 210
191 3300022467 Ga0224712_10205408 Ga0224712_102054081 210
192 3300025885 Ga0207653_10002105 Ga0207653_100021055 210
193 3300025885 Ga0207653_10025775 Ga0207653_100257752 210
194 3300025898 Ga0207692_10345961 Ga0207692_103459611 210
195 3300025899 Ga0207642_10162773 Ga0207642_101627732 210
196 3300025906 Ga0207699_10115930 Ga0207699_101159302 210
197 3300025909 Ga0207705_10000720 Ga0207705_100007202 210
198 3300025910 Ga0207684_10004828 Ga0207684_1000482812 210
199 3300025910 Ga0207684_10005115 Ga0207684_1000511512 210
200 3300025910 Ga0207684_10345876 Ga0207684_103458761 210
201 3300025911 Ga0207654_10039439 Ga0207654_100394393 210
202 3300025912 Ga0207707_10295572 Ga0207707_102955722 210
203 3300025913 Ga0207695_10289269 Ga0207695_102892692 210
204 3300025913 Ga0207695_10656752 Ga0207695_106567521 210
205 3300025914 Ga0207671_10097047 Ga0207671_100970472 210
206 3300025914 Ga0207671_10316772 Ga0207671_103167722 210
207 3300025919 Ga0207657_10192740 Ga0207657_101927402 210
208 3300025919 Ga0207657_10219037 Ga0207657_102190373 210
209 3300025920 Ga0207649_10014807 Ga0207649_100148073 210
210 3300025922 Ga0207646_10001173 Ga0207646_1000117338 210
211 3300025922 Ga0207646_10006313 Ga0207646_1000631313 210
212 3300025924 Ga0207694_10089082 Ga0207694_100890822 210
213 3300025924 Ga0207694_10092273 Ga0207694_100922731 210
214 3300025924 Ga0207694_10658408 Ga0207694_106584082 210
215 3300025928 Ga0207700_10339793 Ga0207700_103397933 210
216 3300025931 Ga0207644_10012039 Ga0207644_100120392 210
217 3300025932 Ga0207690_10200962 Ga0207690_102009622 210
218 3300025933 Ga0207706_10043744 Ga0207706_100437445 210
219 3300025934 Ga0207686_10123556 Ga0207686_101235562 210
220 3300025934 Ga0207686_10134141 Ga0207686_101341411 210
221 3300025935 Ga0207709_10058696 Ga0207709_100586962 210
222 3300025939 Ga0207665_10015178 Ga0207665_100151782 210
223 3300025941 Ga0207711_10026410 Ga0207711_100264103 210
224 3300025942 Ga0207689_10220292 Ga0207689_102202922 210
225 3300025949 Ga0207667_10015774 Ga0207667_100157746 210
226 3300025949 Ga0207667_10017618 Ga0207667_100176185 210
227 3300025960 Ga0207651_10130988 Ga0207651_101309882 210
228 3300025961 Ga0207712_10586245 Ga0207712_105862452 210
229 3300026023 Ga0207677_10266243 Ga0207677_102662432 210
230 3300026041 Ga0207639_10371117 Ga0207639_103711171 210
231 3300026041 Ga0207639_10770946 Ga0207639_107709461 210
232 3300026078 Ga0207702_10466006 Ga0207702_104660062 210
233 3300026088 Ga0207641_10433219 Ga0207641_104332191 210
234 3300026089 Ga0207648_10250879 Ga0207648_102508791 210
235 3300026095 Ga0207676_10161019 Ga0207676_101610192 210
236 3300026116 Ga0207674_10031593 Ga0207674_100315936 210
237 3300026116 Ga0207674_10121661 Ga0207674_101216612 210
238 3300026116 Ga0207674_10549444 Ga0207674_105494442 210
239 3300026121 Ga0207683_10107766 Ga0207683_101077663 210
240 3300026142 Ga0207698_10541299 Ga0207698_105412991 210
241 3300027907 Ga0207428_10010128 Ga0207428_100101284 210
242 3300028380 Ga0268265_10617194 Ga0268265_106171941 210
243 3300028381 Ga0268264_10098553 Ga0268264_100985532 210
244 3300028381 Ga0268264_10899727 Ga0268264_108997271 210
245 3300028800 Ga0265338_10002812 Ga0265338_1000281214 210
246 3300031241 Ga0265325_10066771 Ga0265325_100667713 210
247 3300031728 Ga0316578_10010592 Ga0316578_100105924 210
248 3300031901 Ga0307406_10159456 Ga0307406_101594563 210
249 3300031911 Ga0307412_10185417 Ga0307412_101854171 210
250 3300032002 Ga0307416_100024960 Ga0307416_1000249601 210
251 3300036401 Ga0373937_0389658 Ga0373937_0389658_618_1277 210
252 3300036647 Ga0316582_0041873 Ga0316582_0041873_577_1236 210
253 3300036712 Ga0316584_0005782 Ga0316584_0005782_3980_4639 210
254 3300037312 Ga0395899_0000423 Ga0395899_0000423_23371_24024 210
255 3300037312 Ga0395899_0185322 Ga0395899_0185322_255_944 210
256 3300037312 Ga0395899_0273133 Ga0395899_0273133_40_693 210
257 3300037418 Ga0395900_0000607 Ga0395900_0000607_23371_24024 210
258 3300037418 Ga0395900_0001360 Ga0395900_0001360_4289_4942 210
259 3300037418 Ga0395900_0089292 Ga0395900_0089292_410_1063 210
260 3300037418 Ga0395900_0205010 Ga0395900_0205010_533_1186 210
261 3300037418 Ga0395900_0481509 Ga0395900_0481509_237_926 210
262 3300037466 Ga0395898_0000695 Ga0395898_0000695_26889_27542 210
263 3300037466 Ga0395898_0001367 Ga0395898_0001367_9501_10154 210
264 3300037466 Ga0395898_0024251 Ga0395898_0024251_3644_4297 210
265 3300037466 Ga0395898_0362242 Ga0395898_0362242_59_748 210
266 3300037471 Ga0395905_0000103 Ga0395905_0000103_118473_119132 210
267 3300038443 Ga0395901_0000004 Ga0395901_0000004_174387_175040 210
268 3300038443 Ga0395901_0000045 Ga0395901_0000045_181564_182217 210
269 3300038443 Ga0395901_0005973 Ga0395901_0005973_28_717 210
270 3300042993 Ga0439440_0042365 Ga0439440_0042365_157_816 210
271 3300044673 Ga0453683_0533242 Ga0453683_0533242_67_726 210
272 3300044684 Ga0466966_0000017 Ga0466966_0000017_97503_98156 210
273 3300044693 Ga0466961_0000325 Ga0466961_0000325_19813_20466 210
274 3300044694 Ga0466963_0017483 Ga0466963_0017483_3638_4291 210
275 3300044694 Ga0466963_0024268 Ga0466963_0024268_1218_1877 210
276 3300044719 Ga0466971_0007513 Ga0466971_0007513_698_1351 210
277 3300045049 Ga0466959_0037652 Ga0466959_0037652_1442_2095 210
278 3300045051 Ga0451576_0021995 Ga0451576_0021995_4266_4925 210
279 3300045051 Ga0451576_0238168 Ga0451576_0238168_763_1422 210
280 3300045836 Ga0466958_0004644 Ga0466958_0004644_2286_2939 210
281 3300046473 Ga0495582_0005047 Ga0495582_0005047_648_1301 210
282 3300046475 Ga0495639_0071288 Ga0495639_0071288_753_1406 210
283 3300046477 Ga0495664_0258274 Ga0495664_0258274_370_1023 210
284 3300046499 Ga0495594_0003021 Ga0495594_0003021_6504_7157 210
285 3300046514 Ga0495618_0004414 Ga0495618_0004414_485_1138 210
286 3300046515 Ga0495620_0205731 Ga0495620_0205731_21_722 210
287 3300046526 Ga0495666_0001106 Ga0495666_0001106_2702_3355 210
288 3300046531 Ga0495665_0036954 Ga0495665_0036954_1763_2416 210
289 3300046533 Ga0495640_0063365 Ga0495640_0063365_373_1026 210
290 3300046535 Ga0495586_0012495 Ga0495586_0012495_3056_3709 210
291 3300046536 Ga0495587_0052826 Ga0495587_0052826_1597_2256 210
292 3300046542 Ga0495597_0002825 Ga0495597_0002825_2545_3309 210
293 3300046642 Ga0495634_0210001 Ga0495634_0210001_328_981 210
294 3300046684 Ga0495669_0087215 Ga0495669_0087215_755_1414 210
295 3300046689 Ga0495613_0268770 Ga0495613_0268770_194_847 210
296 3300046691 Ga0495670_0173626 Ga0495670_0173626_325_984 210
297 3300046809 Ga0495600_0386801 Ga0495600_0386801_15_668 210
298 3300047318 Ga0495636_0154274 Ga0495636_0154274_49_708 210
299 3300047319 Ga0495674_0012162 Ga0495674_0012162_3784_4449 210
300 3300047319 Ga0495674_0304514 Ga0495674_0304514_60_719 210
301 3300047321 Ga0495676_0088039 Ga0495676_0088039_795_1448 210
302 3300047322 Ga0495680_0089832 Ga0495680_0089832_1273_1926 210
303 3300047443 Ga0495687_002912 Ga0495687_002912_3410_4129 210
304 3300047471 Ga0495684_0307315 Ga0495684_0307315_425_1078 210
305 3300048913 Ga0496110_0710656 Ga0496110_0710656_89_748 210
306 3300048918 Ga0496115_0103415 Ga0496115_0103415_462_1142 210
307 3300049570 Ga0501033_0013128 Ga0501033_0013128_747_1415 210
308 3300049575 Ga0501039_0003167 Ga0501039_0003167_10767_11426 210
309 3300049576 Ga0501040_0002517 Ga0501040_0002517_353_1012 210
310 3300049577 Ga0501041_0089395 Ga0501041_0089395_1023_1682 210
311 3300049578 Ga0501042_0006696 Ga0501042_0006696_6011_6670 210
312 3300049579 Ga0501043_0099494 Ga0501043_0099494_89_748 210
313 3300049579 Ga0501043_0404063 Ga0501043_0404063_97_765 210
314 3300049580 Ga0501046_0022553 Ga0501046_0022553_122_781 210
315 3300049581 Ga0501047_0003825 Ga0501047_0003825_8764_9432 210
316 3300049587 Ga0501071_0013369 Ga0501071_0013369_193_852 210
317 3300049588 Ga0501072_0016746 Ga0501072_0016746_4246_4905 210
318 3300049590 Ga0501074_0036383 Ga0501074_0036383_720_1379 210
319 3300049591 Ga0501075_0590059 Ga0501075_0590059_56_715 210
320 3300049592 Ga0501076_0079595 Ga0501076_0079595_365_1024 210
321 3300049592 Ga0501076_0466608 Ga0501076_0466608_271_930 210
322 3300049593 Ga0501077_0001190 Ga0501077_0001190_14791_15450 210
323 3300049593 Ga0501077_0009303 Ga0501077_0009303_2505_3164 210
324 3300049593 Ga0501077_0101517 Ga0501077_0101517_140_799 210
325 3300049741 Ga0501079_0121379 Ga0501079_0121379_487_1146 210
326 3300049743 Ga0501081_0109955 Ga0501081_0109955_536_1195 210
327 3300049822 Ga0501035_0001658 Ga0501035_0001658_3557_4225 210
328 3300049823 Ga0501044_0007034 Ga0501044_0007034_3712_4380 210
329 3300049824 Ga0501045_0004319 Ga0501045_0004319_8195_8854 210
330 3300050492 nmdc:mga0yw44_261695_c1 nmdc:mga0yw44_261695_c1_44_703 210
331 3300050507 nmdc:mga05p37_197667_c1 nmdc:mga05p37_197667_c1_1580_2233 210
332 3300050507 nmdc:mga05p37_434777_c1 nmdc:mga05p37_434777_c1_743_1402 210
333 3300050507 nmdc:mga05p37_461784_c1 nmdc:mga05p37_461784_c1_160_819 210
334 3300050507 nmdc:mga05p37_86928_c1 nmdc:mga05p37_86928_c1_1340_1999 210
335 3300050508 nmdc:mga09592_109557_c1 nmdc:mga09592_109557_c1_1457_2116 210
336 3300050508 nmdc:mga09592_495928_c1 nmdc:mga09592_495928_c1_255_914 210
337 3300050508 nmdc:mga09592_691241_c1 nmdc:mga09592_691241_c1_140_799 210
338 3300050509 nmdc:mga0qj67_290981_c1 nmdc:mga0qj67_290981_c1_155_814 210
339 3300050510 nmdc:mga06r32_251739_c1 nmdc:mga06r32_251739_c1_469_1125 210
340 3300050510 nmdc:mga06r32_379391_c1 nmdc:mga06r32_379391_c1_485_1144 210
341 3300050511 nmdc:mga08y16_3855_c1 nmdc:mga08y16_3855_c1_2787_3446 210
342 3300050512 nmdc:mga0n895_1063_c1 nmdc:mga0n895_1063_c1_16491_17150 210
343 3300050512 nmdc:mga0n895_21709_c1 nmdc:mga0n895_21709_c1_2190_2843 210
344 3300050512 nmdc:mga0n895_631680_c1 nmdc:mga0n895_631680_c1_62_721 210
345 3300050512 nmdc:mga0n895_817320_c1 nmdc:mga0n895_817320_c1_39_698 210
346 3300050513 nmdc:mga0rr50_279486_c1 nmdc:mga0rr50_279486_c1_138_791 210
347 3300050513 nmdc:mga0rr50_321363_c1 nmdc:mga0rr50_321363_c1_76_735 210
348 3300050513 nmdc:mga0rr50_599927_c1 nmdc:mga0rr50_599927_c1_273_926 210
349 3300050513 nmdc:mga0rr50_95053_c1 nmdc:mga0rr50_95053_c1_47_706 210
350 3300050515 nmdc:mga0a205_124591_c1 nmdc:mga0a205_124591_c1_1133_1792 210
351 3300050515 nmdc:mga0a205_235532_c1 nmdc:mga0a205_235532_c1_88_741 210
352 3300050515 nmdc:mga0a205_33756_c1 nmdc:mga0a205_33756_c1_2057_2716 210
353 3300054114 Ga0501084_0051479 Ga0501084_0051479_810_1469 210
354 3300059505 Ga0587083_0065035 Ga0587083_0065035_87_746 210
355 3300060353 Ga0501082_0004636 Ga0501082_0004636_550_1209 210
356 3300061734 Ga0530510_0007516 Ga0530510_0007516_186_845 210
357 3300003503 JGI26141J51220_1002771 JGI26141J51220_10027711 211
358 3300004800 Ga0058861_12055236 Ga0058861_120552361 211
359 3300004803 Ga0058862_12740080 Ga0058862_127400801 211
360 3300005295 Ga0065707_10432466 Ga0065707_104324662 211
361 3300005328 Ga0070676_10104717 Ga0070676_101047172 211
362 3300005334 Ga0068869_100071294 Ga0068869_1000712942 211
363 3300005341 Ga0070691_10375761 Ga0070691_103757611 211
364 3300005345 Ga0070692_10059026 Ga0070692_100590262 211
365 3300005347 Ga0070668_100125193 Ga0070668_1001251933 211
366 3300005347 Ga0070668_100298403 Ga0070668_1002984032 211
367 3300005406 Ga0070703_10000256 Ga0070703_100002562 211
368 3300005444 Ga0070694_100004321 Ga0070694_1000043215 211
369 3300005444 Ga0070694_100196070 Ga0070694_1001960702 211
370 3300005459 Ga0068867_100080206 Ga0068867_1000802063 211
371 3300005545 Ga0070695_100000872 Ga0070695_10000087210 211
372 3300005545 Ga0070695_100005643 Ga0070695_1000056436 211
373 3300005549 Ga0070704_100298658 Ga0070704_1002986582 211
374 3300005843 Ga0068860_100504686 Ga0068860_1005046862 211
375 3300005844 Ga0068862_100003295 Ga0068862_1000032952 211
376 3300005937 Ga0081455_10086390 Ga0081455_100863903 211
377 3300005981 Ga0081538_10006443 Ga0081538_100064438 211
378 3300006058 Ga0075432_10135782 Ga0075432_101357821 211
379 3300006173 Ga0070716_100159168 Ga0070716_1001591682 211
380 3300006847 Ga0075431_100603913 Ga0075431_1006039132 211
381 3300009147 Ga0114129_10082020 Ga0114129_100820202 211
382 3300009147 Ga0114129_10406565 Ga0114129_104065652 211
383 3300009174 Ga0105241_10000634 Ga0105241_1000063428 211
384 3300009553 Ga0105249_10189117 Ga0105249_101891172 211
385 3300014325 Ga0163163_10221720 Ga0163163_102217202 211
386 3300025923 Ga0207681_10483096 Ga0207681_104830962 211
387 3300025927 Ga0207687_10173020 Ga0207687_101730202 211
388 3300025942 Ga0207689_10022906 Ga0207689_100229064 211
389 3300026089 Ga0207648_10114772 Ga0207648_101147723 211
390 3300027312 Ga0209371_1009497 Ga0209371_10094972 211
391 3300027360 Ga0209969_1007355 Ga0209969_10073552 211
392 3300027364 Ga0209967_1009685 Ga0209967_10096852 211
393 3300027378 Ga0209981_1013652 Ga0209981_10136522 211
394 3300027424 Ga0209984_1009636 Ga0209984_10096362 211
395 3300027462 Ga0210000_1010095 Ga0210000_10100951 211
396 3300027471 Ga0209995_1008768 Ga0209995_10087682 211
397 3300027526 Ga0209968_1004399 Ga0209968_10043991 211
398 3300027543 Ga0209999_1008179 Ga0209999_10081792 211
399 3300027614 Ga0209970_1002040 Ga0209970_10020404 211
400 3300027617 Ga0210002_1013841 Ga0210002_10138412 211
401 3300027665 Ga0209983_1000006 Ga0209983_100000612 211
402 3300027682 Ga0209971_1000053 Ga0209971_10000536 211
403 3300027695 Ga0209966_1000266 Ga0209966_10002666 211
404 3300027717 Ga0209998_10002739 Ga0209998_100027393 211
405 3300027876 Ga0209974_10004512 Ga0209974_100045125 211
406 3300028380 Ga0268265_10004291 Ga0268265_100042918 211
407 3300028381 Ga0268264_10485916 Ga0268264_104859162 211
408 3300031731 Ga0307405_10005003 Ga0307405_100050035 211
409 3300031824 Ga0307413_10050804 Ga0307413_100508043 211
410 3300031824 Ga0307413_10103250 Ga0307413_101032502 211
411 3300031824 Ga0307413_10108847 Ga0307413_101088472 211
412 3300031852 Ga0307410_10189146 Ga0307410_101891462 211
413 3300031901 Ga0307406_10036406 Ga0307406_100364062 211
414 3300031901 Ga0307406_10044493 Ga0307406_100444932 211
415 3300031901 Ga0307406_10188881 Ga0307406_101888812 211
416 3300031903 Ga0307407_10065128 Ga0307407_100651282 211
417 3300031911 Ga0307412_10025889 Ga0307412_100258894 211
418 3300031995 Ga0307409_100048126 Ga0307409_1000481263 211
419 3300031995 Ga0307409_100109999 Ga0307409_1001099992 211
420 3300032002 Ga0307416_100118887 Ga0307416_1001188872 211
421 3300032002 Ga0307416_100157819 Ga0307416_1001578193 211
422 3300032004 Ga0307414_10007670 Ga0307414_100076702 211
423 3300032004 Ga0307414_10039518 Ga0307414_100395183 211
424 3300032004 Ga0307414_10121902 Ga0307414_101219021 211
425 3300032005 Ga0307411_10055954 Ga0307411_100559542 211
426 3300032005 Ga0307411_10250715 Ga0307411_102507152 211
427 3300032005 Ga0307411_10287122 Ga0307411_102871222 211
428 3300032126 Ga0307415_100017380 Ga0307415_1000173805 211
429 3300032126 Ga0307415_100304082 Ga0307415_1003040822 211
430 3300034818 Ga0373950_0010589 Ga0373950_0010589_772_1419 211
431 3300037853 Ga0436364_1240134 Ga0436364_1240134_23287_23952 211
432 3300039062 Ga0400483_023391 Ga0400483_023391_4238_4900 211
433 3300039062 Ga0400483_265909 Ga0400483_265909_7053_7715 211
434 3300039437 Ga0436365_0060709 Ga0436365_0060709_1074_1709 211
435 3300044673 Ga0453683_0027447 Ga0453683_0027447_702_1337 211
436 3300044673 Ga0453683_0255042 Ga0453683_0255042_395_1093 211
437 3300045051 Ga0451576_0118305 Ga0451576_0118305_43_678 211
438 3300045051 Ga0451576_1220608 Ga0451576_1220608_122_757 211
439 3300046457 Ga0495590_0009434 Ga0495590_0009434_2946_3653 211
440 3300047319 Ga0495674_0391855 Ga0495674_0391855_51_764 211
441 3300048918 Ga0496115_0056761 Ga0496115_0056761_1686_2348 211
442 3300048922 Ga0496119_0003345 Ga0496119_0003345_4899_5561 211
443 3300048928 Ga0496125_0125431 Ga0496125_0125431_1082_1717 211
444 3300048929 Ga0496126_0015367 Ga0496126_0015367_896_1540 211
445 3300048929 Ga0496126_0033492 Ga0496126_0033492_487_1215 211
446 3300049571 Ga0501034_0000815 Ga0501034_0000815_5778_6413 211
447 3300049575 Ga0501039_0123875 Ga0501039_0123875_598_1233 211
448 3300049575 Ga0501039_0260537 Ga0501039_0260537_433_1068 211
449 3300049588 Ga0501072_0176689 Ga0501072_0176689_894_1529 211
450 3300049591 Ga0501075_0536970 Ga0501075_0536970_88_723 211
451 3300049649 Ga0501198_027296 Ga0501198_027296_243_923 211
452 3300049652 Ga0501202_010593 Ga0501202_010593_455_1135 211
453 3300049660 Ga0501216_005477 Ga0501216_005477_1192_1872 211
454 3300049661 Ga0501217_007715 Ga0501217_007715_300_980 211
455 3300049664 Ga0501224_007742 Ga0501224_007742_389_1069 211
456 3300049669 Ga0501235_005500 Ga0501235_005500_513_1193 211
457 3300049672 Ga0501239_009062 Ga0501239_009062_217_897 211
458 3300049673 Ga0501240_029743 Ga0501240_029743_134_814 211
459 3300049674 Ga0501242_001340 Ga0501242_001340_136_816 211
460 3300049679 Ga0501249_014893 Ga0501249_014893_844_1524 211
461 3300049705 Ga0501225_0006489 Ga0501225_0006489_989_1669 211
462 3300049707 Ga0501234_013702 Ga0501234_013702_330_1010 211
463 3300049708 Ga0501245_029786 Ga0501245_029786_152_832 211
464 3300049742 Ga0501080_0530884 Ga0501080_0530884_22_657 211
465 3300049765 Ga0501268_052966 Ga0501268_052966_25_705 211
466 3300049767 Ga0501270_005930 Ga0501270_005930_289_969 211
467 3300049770 Ga0501273_004553 Ga0501273_004553_349_1029 211
468 3300050507 nmdc:mga05p37_265810_c1 nmdc:mga05p37_265810_c1_540_1187 211
469 3300050507 nmdc:mga05p37_2855_c1 nmdc:mga05p37_2855_c1_5526_6182 211
470 3300050515 nmdc:mga0a205_14184_c1 nmdc:mga0a205_14184_c1_2826_3473 211
471 3300054114 Ga0501084_0435999 Ga0501084_0435999_379_1014 211
472 3300060353 Ga0501082_0510884 Ga0501082_0510884_247_882 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

39

179

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

199

238

0.97

PF08534

Redoxin

Redoxin

38

196

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9671 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9624 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9591 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9498 3 210
5b6n-assembly2.cif.gz_C crystal structures of human peroxiredoxin 6 in sulfinic acid state 0.9413 2 209
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9902 146 209 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9752 146 209 3.30.1020.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9723 146 207 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9694 146 207 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.965 5 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.988 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A659YRX5-F1-model_v4 deleted 0.9854 1 103
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.985 3 94 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2N3DL12-F1-model_v4 Peroxidase 0.9827 1 207 GO:0005829
GO:0045454
GO:0051920
AF-A0A1T5DCE5-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9819 1 207 GO:0005829
GO:0016020
GO:0045454
GO:0051920

Feature Viewer

pLDDT pTM Quality
91.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map