F450760

General Info

Members Datasets Scaffolds Average Seq Length
472 296 413 334

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100124419|Ga0068857_1001244192
Length 359
Sequence VTPTDTQIHHNEKELATVAEMFYDDDADLSVIQGRKVAVIGYGSQGHAHALNLRDSGVDVRVGLAEGSKSRAKAENEGLTVRSVGDAVKEADLVVILTPDQVQRNVYADEIRPNLKEGAGLLFGHGFNIRFGYIKPEGGSDVLMVAPKGPGHLVRREYVDGRGVPVLLAVEQDASGQAWALAKSYAKAIGGLRAGGIGTTFTEETETDLFGEQAVLCGGASQLVQYGFETLVEAGYQPEVAYFECLHELKLIVDLMVEGGIAKQRWSVSDTAEYGDYVSGPRVIDPHVKENMRAVLGDIRSGAFAKRFIDDQDAGGPEFTALREKGAQHPIEATGKDLRRLMSWIKDTDSDYVEGSAAR

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
5 2643221641 Nocardioides sp. Root122 Isolate Unclassified
6 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
7 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
8 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
9 2643221711 Terrabacter sp. Root85 Isolate Unclassified
10 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
11 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
12 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
13 2739367653 Kocuria sp. OV113 Isolate Unclassified
14 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
15 2739367898 Nocardioides sp. CF479 Isolate Unclassified
16 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
17 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
18 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
19 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
20 2808606394 Promicromonospora sp. C35 Isolate Unclassified
21 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
22 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
23 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
24 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
25 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
26 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
27 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
28 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
29 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
30 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
31 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
32 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
33 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
34 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
35 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
36 2857727296 Kocuria sp. R-72562 Isolate Unclassified
37 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
38 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
39 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
40 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
41 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
42 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
43 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
44 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
45 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
46 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
47 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
48 2920879853 Kocuria salina CV6 Isolate Unclassified
49 2928153084 Leifsonia sp. 563 Isolate Unclassified
50 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
51 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
52 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
53 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
56 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
57 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
59 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
60 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
157 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
170 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
180 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
181 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
291 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
292 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
293 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
294 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
295 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
296 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.23
Metatranscriptomes 1.27
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.75
Nodule 0
Rhizoplane 10.38
Rhizosphere 65.89
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004381 3300000549 Bacteria 1842
2 JGI24739J22299_10024386 3300001989 Bacteria 2133
3 JGI24739J22299_10043474 3300001989 Bacteria 1485
4 JGI24735J21928_10000820 3300002067 Bacteria 11051
5 JGI24735J21928_10052050 3300002067 Bacteria 1181
6 Ga0007423J48922_100219 3300003285 Bacteria 12900
7 JGI25407J50210_10002340 3300003373 Bacteria 4448
8 Ga0055539_1000111 3300003752 Bacteria 90530
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055527_1000012 3300003760 Bacteria 348744
11 Ga0055542_1000017 3300003762 Bacteria 348744
12 Ga0055542_1002872 3300003762 Bacteria 5122
13 Ga0055529_1000023 3300003763 Bacteria 314383
14 Ga0055541_1000938 3300003841 Bacteria 6893
15 Ga0070683_100266510 3300005329 Bacteria 1629
16 Ga0070682_100000691 3300005337 Bacteria 20383
17 Ga0070660_100009065 3300005339 Bacteria 6984
18 Ga0070660_100075006 3300005339 Bacteria 2647
19 Ga0070674_100247904 3300005356 Bacteria 1397
20 Ga0070659_100019156 3300005366 Bacteria 5179
21 Ga0070659_100041902 3300005366 Bacteria 3580
22 Ga0070667_100129475 3300005367 Bacteria 2201
23 Ga0070714_100000525 3300005435 Bacteria 27804
24 Ga0068867_100365770 3300005459 Bacteria 1207
25 Ga0070679_100021008 3300005530 Bacteria 6370
26 Ga0070679_100201277 3300005530 Bacteria 1957
27 Ga0070684_100001882 3300005535 Bacteria 15377
28 Ga0070684_100213826 3300005535 Bacteria 1758
29 Ga0070665_100020111 3300005548 Bacteria 6703
30 Ga0070665_100102385 3300005548 Bacteria 2867
31 Ga0068857_100124419 3300005577 Bacteria 2323
32 Ga0068856_100054884 3300005614 Bacteria 3931
33 Ga0068856_100102918 3300005614 Bacteria 2849
34 Ga0070702_100001724 3300005615 Bacteria 9086
35 Ga0070702_100105510 3300005615 Bacteria 1737
36 Ga0068852_100045059 3300005616 Bacteria 3750
37 Ga0068859_100009636 3300005617 Bacteria 9751
38 Ga0068863_100040997 3300005841 Bacteria 4402
39 Ga0068858_100014693 3300005842 Bacteria 7371
40 Ga0068860_100000357 3300005843 Bacteria 60525
41 Ga0068860_100035215 3300005843 Bacteria 4803
42 Ga0081455_10000134 3300005937 Bacteria 87309
43 Ga0081455_10002407 3300005937 Bacteria 22331
44 Ga0081455_10083570 3300005937 Bacteria 2609
45 Ga0081538_10000520 3300005981 Bacteria 43003
46 Ga0075365_10002919 3300006038 Bacteria 8630
47 Ga0075365_10007438 3300006038 Bacteria 6132
48 Ga0075363_100045195 3300006048 Bacteria 2335
49 Ga0075364_10004748 3300006051 Bacteria 7851
50 Ga0075364_10114445 3300006051 Bacteria 1802
51 Ga0075367_10011121 3300006178 Bacteria 4748
52 Ga0075367_10125274 3300006178 Bacteria 1585
53 Ga0075370_10022197 3300006353 Bacteria 3483
54 Ga0075428_100013282 3300006844 Bacteria 9164
55 Ga0075428_100208797 3300006844 Bacteria 2110
56 Ga0075430_100000816 3300006846 Bacteria 24281
57 Ga0075431_100002532 3300006847 Bacteria 17632
58 Ga0075431_100039232 3300006847 Bacteria 4879
59 Ga0075429_100007033 3300006880 Bacteria 9774
60 Ga0097620_100009636 3300006931 Bacteria 9751
61 Ga0105251_10021108 3300009011 Bacteria 3407
62 Ga0111539_10192655 3300009094 Bacteria 2378
63 Ga0105247_10000856 3300009101 Bacteria 23044
64 Ga0114129_10078312 3300009147 Bacteria 4598
65 Ga0105243_10030404 3300009148 Bacteria 4158
66 Ga0105241_10187668 3300009174 Bacteria 1719
67 Ga0105242_10203897 3300009176 Bacteria 1758
68 Ga0105238_10390725 3300009551 Bacteria 1383
69 Ga0105239_10001015 3300010375 Bacteria 39219
70 Ga0157373_10017934 3300013100 Bacteria 5153
71 Ga0157371_10021032 3300013102 Bacteria 4797
72 Ga0157371_10034973 3300013102 Bacteria 3602
73 Ga0157371_10139876 3300013102 Bacteria 1724
74 Ga0157370_10001462 3300013104 Bacteria 29206
75 Ga0157370_10024896 3300013104 Bacteria 5925
76 Ga0157370_10104374 3300013104 Bacteria 2653
77 Ga0157369_10031847 3300013105 Bacteria 5803
78 Ga0157369_10034898 3300013105 Bacteria 5517
79 Ga0157369_10070765 3300013105 Bacteria 3747
80 Ga0171462_1003 3300013250 Bacteria 853796
81 Ga0163162_10024096 3300013306 Bacteria 6006
82 Ga0163162_10106054 3300013306 Bacteria 2905
83 Ga0157372_10000057 3300013307 Bacteria 125915
84 Ga0157372_10055250 3300013307 Bacteria 4434
85 Ga0157372_10084698 3300013307 Bacteria 3594
86 Ga0157372_10175713 3300013307 Bacteria 2478
87 Ga0157372_10231641 3300013307 Bacteria 2142
88 Ga0157375_10050005 3300013308 Bacteria 4099
89 Ga0157375_10118462 3300013308 Bacteria 2754
90 Ga0163163_10047891 3300014325 Bacteria 4202
91 Ga0163163_10514877 3300014325 Bacteria 1259
92 Ga0157379_10138434 3300014968 Bacteria 2194
93 Ga0157379_10346781 3300014968 Bacteria 1359
94 Ga0163161_10117247 3300017792 Bacteria 1997
95 Ga0197907_10338604 3300020069 Bacteria 1906
96 Ga0206353_10014289 3300020082 Bacteria 2103
97 Ga0209566_100078 3300025225 Bacteria 158974
98 Ga0209674_100001 3300025226 Bacteria 4013750
99 Ga0209672_100003 3300025228 Bacteria 1560476
100 Ga0209147_100858 3300025229 Bacteria 14179
101 Ga0209563_100001 3300025230 Bacteria 4013775
102 Ga0209677_100001 3300025253 Bacteria 4013787
103 Ga0209148_1000004 3300025254 Bacteria 1844481
104 Ga0209148_1002093 3300025254 Bacteria 7572
105 Ga0209455_1000022 3300025272 Bacteria 688910
106 Ga0209455_1003788 3300025272 Bacteria 5200
107 Ga0207697_10001476 3300025315 Bacteria 12842
108 Ga0207655_1045632 3300025728 Bacteria 1828
109 Ga0207713_1026397 3300025735 Bacteria 2663
110 Ga0207682_10020254 3300025893 Bacteria 2610
111 Ga0207710_10003524 3300025900 Bacteria 6952
112 Ga0207688_10028845 3300025901 Bacteria 3052
113 Ga0207647_10013238 3300025904 Bacteria 5725
114 Ga0207705_10000001 3300025909 Bacteria 2061880
115 Ga0207657_10040756 3300025919 Bacteria 4112
116 Ga0207657_10083103 3300025919 Bacteria 2687
117 Ga0207657_10119167 3300025919 Bacteria 2172
118 Ga0207657_10309698 3300025919 Bacteria 1250
119 Ga0207652_10146636 3300025921 Bacteria 2112
120 Ga0207694_10077535 3300025924 Bacteria 2604
121 Ga0207694_10136422 3300025924 Bacteria 1971
122 Ga0207659_10270001 3300025926 Bacteria 1387
123 Ga0207687_10391019 3300025927 Bacteria 1142
124 Ga0207700_10067258 3300025928 Bacteria 2742
125 Ga0207664_10000047 3300025929 Bacteria 139122
126 Ga0207690_10025502 3300025932 Bacteria 3713
127 Ga0207690_10070406 3300025932 Bacteria 2409
128 Ga0207709_10010919 3300025935 Bacteria 5005
129 Ga0207691_10000233 3300025940 Bacteria 54222
130 Ga0207691_10120623 3300025940 Bacteria 2324
131 Ga0207711_10212971 3300025941 Bacteria 1765
132 Ga0207661_10028385 3300025944 Bacteria 4284
133 Ga0207661_10399362 3300025944 Bacteria 1246
134 Ga0207658_10342722 3300025986 Bacteria 1299
135 Ga0207703_10036141 3300026035 Bacteria 3929
136 Ga0207678_10014881 3300026067 Bacteria 6843
137 Ga0207641_10033495 3300026088 Bacteria 4267
138 Ga0207641_10046507 3300026088 Bacteria 3658
139 Ga0207676_10146583 3300026095 Bacteria 2028
140 Ga0207674_10001716 3300026116 Bacteria 28034
141 Ga0207674_10153288 3300026116 Bacteria 2260
142 Ga0207698_10005148 3300026142 Bacteria 8039
143 Ga0207428_10032991 3300027907 Bacteria 4256
144 Ga0268266_10077220 3300028379 Bacteria 2895
145 Ga0268264_10000242 3300028381 Bacteria 103492
146 Ga0265334_10007935 3300028573 Bacteria 4536
147 Ga0316179_1119429 3300030734 Bacteria 2063
148 Ga0316181_1017937 3300030744 Bacteria 1592
149 Ga0316575_10000007 3300031665 Bacteria 79369
150 Ga0316575_10004327 3300031665 Bacteria 4992
151 Ga0316579_10022204 3300031691 Bacteria 2836
152 Ga0316576_10000924 3300031727 Bacteria 15000
153 Ga0316576_10072731 3300031727 Bacteria 2538
154 Ga0316578_10010985 3300031728 Bacteria 4718
155 Ga0316578_10181289 3300031728 Bacteria 1269
156 Ga0307405_10059706 3300031731 Bacteria 2404
157 Ga0307413_10077112 3300031824 Bacteria 2121
158 Ga0307413_10303825 3300031824 Bacteria 1211
159 Ga0307410_10004422 3300031852 Bacteria 7266
160 Ga0307409_100013302 3300031995 Bacteria 5289
161 Ga0307416_100219611 3300032002 Bacteria 1821
162 Ga0307414_10238153 3300032004 Bacteria 1505
163 Ga0307415_100100296 3300032126 Bacteria 2121
164 Ga0316585_10024392 3300032137 Bacteria 1871
165 Ga0316580_10026386 3300032139 Bacteria 1796
166 Ga0316580_10052365 3300032139 Bacteria 1257
167 Ga0316574_0001558 3300035398 Bacteria 10951
168 Ga0316574_0009181 3300035398 Bacteria 5527
169 Ga0316574_0021015 3300035398 Bacteria 3869
170 Ga0373927_0060288 3300035695 Bacteria 2455
171 Ga0316582_0007056 3300036647 Bacteria 5961
172 Ga0316582_0017128 3300036647 Bacteria 4183
173 Ga0316584_0002036 3300036712 Bacteria 12660
174 Ga0395900_0005454 3300037418 Bacteria 13324
175 Ga0395900_0007184 3300037418 Bacteria 11545
176 Ga0395900_0163776 3300037418 Bacteria 2267
177 Ga0395900_0455227 3300037418 Bacteria 1235
178 Ga0395898_0002037 3300037466 Bacteria 25298
179 Ga0395898_0083570 3300037466 Bacteria 3077
180 Ga0395898_0206428 3300037466 Bacteria 1875
181 Ga0395898_0321247 3300037466 Bacteria 1477
182 Ga0395905_0030962 3300037471 Bacteria 5039
183 Ga0395901_0031298 3300038443 Bacteria 5486
184 Ga0395901_0069728 3300038443 Bacteria 3661
185 Ga0395901_0192244 3300038443 Bacteria 2140
186 Ga0395901_0288682 3300038443 Bacteria 1703
187 Ga0400485_18908 3300038735 Bacteria 69934
188 Ga0400488_04075 3300038741 Bacteria 8276
189 Ga0400486_03657 3300038742 Bacteria 72353
190 Ga0436363_0217384 3300039450 Bacteria 2032
191 Ga0439465_0060728 3300041413 Bacteria 1252
192 Ga0439465_0080180 3300041413 Bacteria 1106
193 Ga0451843_0361191 3300041509 Bacteria 2140
194 Ga0439431_0010861 3300041997 Bacteria 2074
195 Ga0439431_0011563 3300041997 Bacteria 2018
196 Ga0439442_000056 3300042002 Bacteria 26193
197 Ga0439442_000532 3300042002 Bacteria 8419
198 Ga0439434_0003171 3300042435 Bacteria 4830
199 Ga0439464_0018964 3300042439 Bacteria 1875
200 Ga0466972_0015918 3300044658 Bacteria 3760
201 Ga0466972_0057025 3300044658 Bacteria 1877
202 Ga0466972_0109358 3300044658 Bacteria 1306
203 Ga0466965_0014723 3300044683 Bacteria 3703
204 Ga0466965_0097164 3300044683 Bacteria 1503
205 Ga0466965_0169698 3300044683 Bacteria 1147
206 Ga0466966_0001371 3300044684 Bacteria 15655
207 Ga0466966_0020134 3300044684 Bacteria 4391
208 Ga0466961_0048947 3300044693 Bacteria 2702
209 Ga0466961_0106818 3300044693 Bacteria 1762
210 Ga0466963_0019293 3300044694 Bacteria 4274
211 Ga0466963_0048661 3300044694 Bacteria 2802
212 Ga0466963_0103027 3300044694 Bacteria 1955
213 Ga0466963_0128702 3300044694 Bacteria 1747
214 Ga0466963_0159412 3300044694 Bacteria 1570
215 Ga0466964_0101542 3300044706 Bacteria 1269
216 Ga0466971_0002973 3300044719 Bacteria 7200
217 Ga0466971_0030519 3300044719 Bacteria 2412
218 Ga0466968_0056703 3300044735 Bacteria 1683
219 Ga0466970_0002711 3300044765 Bacteria 8556
220 Ga0466970_0024229 3300044765 Bacteria 3173
221 Ga0466970_0025110 3300044765 Bacteria 3118
222 Ga0466970_0057689 3300044765 Bacteria 2076
223 Ga0466957_0016352 3300044842 Bacteria 4340
224 Ga0466957_0020399 3300044842 Bacteria 3899
225 Ga0466957_0027096 3300044842 Bacteria 3403
226 Ga0466957_0043158 3300044842 Bacteria 2730
227 Ga0466960_0005473 3300044901 Bacteria 5033
228 Ga0466960_0049366 3300044901 Bacteria 2025
229 Ga0466960_0065020 3300044901 Bacteria 1800
230 Ga0466960_0078114 3300044901 Bacteria 1661
231 Ga0466959_0022540 3300045049 Bacteria 4657
232 Ga0466959_0042256 3300045049 Bacteria 3362
233 Ga0466959_0050451 3300045049 Bacteria 3055
234 Ga0466959_0066565 3300045049 Bacteria 2613
235 Ga0466959_0168416 3300045049 Bacteria 1537
236 Ga0451576_0078337 3300045051 Bacteria 3440
237 Ga0466958_0015072 3300045836 Bacteria 4423
238 Ga0466958_0141560 3300045836 Bacteria 1514
239 Ga0466967_0003568 3300045976 Bacteria 10202
240 Ga0466967_0003706 3300045976 Bacteria 10064
241 Ga0466967_0017900 3300045976 Bacteria 5645
242 Ga0466967_0042687 3300045976 Bacteria 3920
243 Ga0466967_0118922 3300045976 Bacteria 2438
244 Ga0466967_0124421 3300045976 Bacteria 2387
245 Ga0495638_0163716 3300046460 Bacteria 1281
246 Ga0495641_0065891 3300046461 Bacteria 1630
247 Ga0495641_0113766 3300046461 Bacteria 1207
248 Ga0495651_0077142 3300046462 Bacteria 2523
249 Ga0495639_0057240 3300046475 Bacteria 1781
250 Ga0495639_0115271 3300046475 Bacteria 1278
251 Ga0495639_0143819 3300046475 Bacteria 1148
252 Ga0495594_0023056 3300046499 Bacteria 3334
253 Ga0495594_0052084 3300046499 Bacteria 2253
254 Ga0495610_0114877 3300046512 Bacteria 1188
255 Ga0495642_0042369 3300046528 Bacteria 1854
256 Ga0495586_0132868 3300046535 Bacteria 1394
257 Ga0495622_0023892 3300046557 Bacteria 2852
258 Ga0495667_0082301 3300046559 Bacteria 2092
259 Ga0495670_0094041 3300046691 Bacteria 1536
260 Ga0495600_0222814 3300046809 Bacteria 1206
261 Ga0495581_0187567 3300047315 Bacteria 1209
262 Ga0495675_0059312 3300047444 Bacteria 2426
263 Ga0496100_0008634 3300048903 Bacteria 5689
264 Ga0496100_0031907 3300048903 Bacteria 3279
265 Ga0496100_0079980 3300048903 Bacteria 2204
266 Ga0496101_0037252 3300048904 Bacteria 3449
267 Ga0496101_0337071 3300048904 Bacteria 1184
268 Ga0496102_0000044 3300048905 Bacteria 187834
269 Ga0496102_0001247 3300048905 Bacteria 22962
270 Ga0496102_0043444 3300048905 Bacteria 4075
271 Ga0496102_0072381 3300048905 Bacteria 3167
272 Ga0496102_0135650 3300048905 Bacteria 2306
273 Ga0496102_0322044 3300048905 Bacteria 1456
274 Ga0496103_0000117 3300048906 Bacteria 86837
275 Ga0496103_0021102 3300048906 Bacteria 3918
276 Ga0496103_0174119 3300048906 Bacteria 1382
277 Ga0496104_0025246 3300048907 Bacteria 5477
278 Ga0496104_0151899 3300048907 Bacteria 2222
279 Ga0496105_0054850 3300048908 Bacteria 3290
280 Ga0496106_0173380 3300048909 Bacteria 1710
281 Ga0496107_0129318 3300048910 Bacteria 1864
282 Ga0496107_0195031 3300048910 Bacteria 1505
283 Ga0496108_0012156 3300048911 Bacteria 7001
284 Ga0496108_0075928 3300048911 Bacteria 2840
285 Ga0496109_0015892 3300048912 Bacteria 6573
286 Ga0496109_0066790 3300048912 Bacteria 3294
287 Ga0496109_0302093 3300048912 Bacteria 1509
288 Ga0496110_0028237 3300048913 Bacteria 4816
289 Ga0496110_0073918 3300048913 Bacteria 3025
290 Ga0496110_0110170 3300048913 Bacteria 2473
291 Ga0496110_0131422 3300048913 Bacteria 2261
292 Ga0496110_0229976 3300048913 Bacteria 1686
293 Ga0496110_0243745 3300048913 Bacteria 1636
294 Ga0496111_0002165 3300048914 Bacteria 11764
295 Ga0496111_0004227 3300048914 Bacteria 9043
296 Ga0496111_0010426 3300048914 Bacteria 6236
297 Ga0496111_0123472 3300048914 Bacteria 1913
298 Ga0496111_0203761 3300048914 Bacteria 1470
299 Ga0496112_0006714 3300048915 Bacteria 10133
300 Ga0496112_0008553 3300048915 Bacteria 9170
301 Ga0496112_0327843 3300048915 Bacteria 1475
302 Ga0496112_0438935 3300048915 Bacteria 1244
303 Ga0496113_0077396 3300048916 Bacteria 2543
304 Ga0496113_0082529 3300048916 Bacteria 2465
305 Ga0496113_0166977 3300048916 Bacteria 1742
306 Ga0496113_0342132 3300048916 Bacteria 1200
307 Ga0496114_0014155 3300048917 Bacteria 6397
308 Ga0496114_0018028 3300048917 Bacteria 5703
309 Ga0496114_0079400 3300048917 Bacteria 2769
310 Ga0496114_0158209 3300048917 Bacteria 1968
311 Ga0496114_0468010 3300048917 Bacteria 1115
312 Ga0496116_0106761 3300048919 Bacteria 1657
313 Ga0496117_0003713 3300048920 Bacteria 17532
314 Ga0496117_0051248 3300048920 Bacteria 2919
315 Ga0496118_0007507 3300048921 Bacteria 11531
316 Ga0496118_0015006 3300048921 Bacteria 7203
317 Ga0496119_0000336 3300048922 Bacteria 65760
318 Ga0496119_0010041 3300048922 Bacteria 8009
319 Ga0496119_0045172 3300048922 Bacteria 2765
320 Ga0496119_0048207 3300048922 Bacteria 2644
321 Ga0496120_0001760 3300048923 Bacteria 24449
322 Ga0496122_0000373 3300048925 Bacteria 96291
323 Ga0496122_0000646 3300048925 Bacteria 70740
324 Ga0496122_0001413 3300048925 Bacteria 38906
325 Ga0496123_0000213 3300048926 Bacteria 118378
326 Ga0496123_0000405 3300048926 Bacteria 79019
327 Ga0496124_0009254 3300048927 Bacteria 10161
328 Ga0496125_0000075 3300048928 Bacteria 234414
329 Ga0496125_0083263 3300048928 Bacteria 2434
330 Ga0496125_0083938 3300048928 Bacteria 2421
331 Ga0496126_0053727 3300048929 Bacteria 3653
332 Ga0496126_0290128 3300048929 Bacteria 1353
333 Ga0501306_000278 3300049127 Bacteria 3632
334 Ga0501317_000579 3300049533 Bacteria 2685
335 Ga0501318_000073 3300049534 Bacteria 4221
336 Ga0501031_0008433 3300049568 Bacteria 6703
337 Ga0501031_0012785 3300049568 Bacteria 5484
338 Ga0501031_0023687 3300049568 Bacteria 4002
339 Ga0501032_0045714 3300049569 Bacteria 2960
340 Ga0501034_0011240 3300049571 Bacteria 9294
341 Ga0501034_0012373 3300049571 Bacteria 8815
342 Ga0501036_0005800 3300049572 Bacteria 10007
343 Ga0501036_0008620 3300049572 Bacteria 8366
344 Ga0501036_0077519 3300049572 Bacteria 2812
345 Ga0501037_0269037 3300049573 Bacteria 1190
346 Ga0501038_0016396 3300049574 Bacteria 6714
347 Ga0501041_0038084 3300049577 Bacteria 2915
348 Ga0501042_0003020 3300049578 Bacteria 10464
349 Ga0501042_0014432 3300049578 Bacteria 5393
350 Ga0501043_0099182 3300049579 Bacteria 2290
351 Ga0501046_0044903 3300049580 Bacteria 3512
352 Ga0501047_0019439 3300049581 Bacteria 6517
353 Ga0501047_0021831 3300049581 Bacteria 6147
354 Ga0501048_0014701 3300049582 Bacteria 5790
355 Ga0501048_0023237 3300049582 Bacteria 4534
356 Ga0501069_0098163 3300049585 Bacteria 1661
357 Ga0501070_0003094 3300049586 Bacteria 14491
358 Ga0501070_0029069 3300049586 Bacteria 4635
359 Ga0501070_0031942 3300049586 Bacteria 4409
360 Ga0501070_0342437 3300049586 Bacteria 1214
361 Ga0501071_0001053 3300049587 Bacteria 15281
362 Ga0501071_0005032 3300049587 Bacteria 8452
363 Ga0501071_0005137 3300049587 Bacteria 8383
364 Ga0501072_0007372 3300049588 Bacteria 8344
365 Ga0501072_0111044 3300049588 Bacteria 2182
366 Ga0501073_0077619 3300049589 Bacteria 2311
367 Ga0501074_0062051 3300049590 Bacteria 2693
368 Ga0501075_0002506 3300049591 Bacteria 12238
369 Ga0501076_0270482 3300049592 Bacteria 1391
370 Ga0501079_0011060 3300049741 Bacteria 6882
371 Ga0501079_0260229 3300049741 Bacteria 1356
372 Ga0501080_0052200 3300049742 Bacteria 3805
373 Ga0501080_0132334 3300049742 Bacteria 2309
374 Ga0501083_0005546 3300049744 Bacteria 8944
375 Ga0501035_0025646 3300049822 Bacteria 5403
376 Ga0501035_0094984 3300049822 Bacteria 2621
377 Ga0501044_0011917 3300049823 Bacteria 9421
378 Ga0501044_0128966 3300049823 Bacteria 2524
379 Ga0501045_0014598 3300049824 Bacteria 5570
380 Ga0501045_0042461 3300049824 Bacteria 3309
381 nmdc:mga03n38_42580_c1 3300050490 Bacteria 1986
382 nmdc:mga03n38_45567_c1 3300050490 Bacteria 1932
383 nmdc:mga03n38_52667_c1 3300050490 Bacteria 1823
384 nmdc:mga00v17_142010_c1 3300050491 Bacteria 1540
385 nmdc:mga00v17_15733_c1 3300050491 Bacteria 4252
386 nmdc:mga00v17_81024_c1 3300050491 Bacteria 2027
387 nmdc:mga00v17_81537_c1 3300050491 Bacteria 2021
388 nmdc:mga00v17_9684_c1 3300050491 Bacteria 5227
389 nmdc:mga0yw44_154857_c1 3300050492 Bacteria 1497
390 nmdc:mga0yw44_36854_c1 3300050492 Bacteria 2885
391 nmdc:mga0yw44_5319_c1 3300050492 Bacteria 6055
392 nmdc:mga0yw44_54651_c1 3300050492 Bacteria 2428
393 nmdc:mga06z11_5409_c1 3300050494 Bacteria 5119
394 nmdc:mga07m45_12015_c1 3300050496 Bacteria 4565
395 nmdc:mga07m45_31948_c1 3300050496 Bacteria 2919
396 nmdc:mga05p37_1355_c1 3300050507 Bacteria 28485
397 nmdc:mga05p37_140187_c1 3300050507 Bacteria 2963
398 nmdc:mga09592_1246_c1 3300050508 Bacteria 20413
399 nmdc:mga09592_72490_c1 3300050508 Bacteria 2925
400 nmdc:mga0qj67_173_c1 3300050509 Bacteria 43526
401 nmdc:mga0qj67_29724_c1 3300050509 Bacteria 4245
402 nmdc:mga0qj67_9421_c1 3300050509 Bacteria 7266
403 nmdc:mga06r32_761_c1 3300050510 Bacteria 28397
404 nmdc:mga08y16_39322_c1 3300050511 Bacteria 4964
405 Ga0500644_0000271 3300053088 Bacteria 29196
406 Ga0500641_0111899 3300053096 Bacteria 1175
407 Ga0500556_0001337 3300053104 Bacteria 10898
408 Ga0500593_001021 3300053117 Bacteria 10151
409 Ga0500616_0000584 3300053153 Bacteria 44375
410 Ga0500616_0004040 3300053153 Bacteria 10672
411 Ga0501084_0286693 3300054114 Bacteria 1390
412 Ga0501082_0150031 3300060353 Bacteria 2024
413 Ga0466962_0003822 3300061719 Bacteria 7196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0073918 Ga0496110_0073918_14_886 284
2 3300042439 Ga0439464_0018964 Ga0439464_0018964_969_1865 292
3 3300048913 Ga0496110_0229976 Ga0496110_0229976_728_1642 295
4 3300014968 Ga0157379_10346781 Ga0157379_103467812 299
5 3300035398 Ga0316574_0021015 Ga0316574_0021015_136_1158 300
6 3300036647 Ga0316582_0007056 Ga0316582_0007056_1729_2751 300
7 3300036712 Ga0316584_0002036 Ga0316584_0002036_10967_11989 300
8 3300031691 Ga0316579_10022204 Ga0316579_100222042 301
9 3300031728 Ga0316578_10181289 Ga0316578_101812891 301
10 3300031665 Ga0316575_10004327 Ga0316575_100043274 303
11 3300031728 Ga0316578_10010985 Ga0316578_100109853 303
12 3300032137 Ga0316585_10024392 Ga0316585_100243922 303
13 3300032139 Ga0316580_10026386 Ga0316580_100263862 303
14 3300032139 Ga0316580_10052365 Ga0316580_100523651 303
15 3300035398 Ga0316574_0001558 Ga0316574_0001558_1010_2041 303
16 3300036647 Ga0316582_0017128 Ga0316582_0017128_2510_3541 303
17 3300005548 Ga0070665_100020111 Ga0070665_1000201116 305
18 3300014325 Ga0163163_10047891 Ga0163163_100478913 305
19 3300025941 Ga0207711_10212971 Ga0207711_102129713 305
20 3300026088 Ga0207641_10033495 Ga0207641_100334954 305
21 3300046499 Ga0495594_0023056 Ga0495594_0023056_17_1030 305
22 3300048915 Ga0496112_0008553 Ga0496112_0008553_1712_2725 305
23 3300048917 Ga0496114_0018028 Ga0496114_0018028_3014_4042 307
24 3300048922 Ga0496119_0048207 Ga0496119_0048207_52_1077 307
25 3300013306 Ga0163162_10106054 Ga0163162_101060543 308
26 3300048903 Ga0496100_0008634 Ga0496100_0008634_255_1283 308
27 3300048904 Ga0496101_0037252 Ga0496101_0037252_24_1052 308
28 3300048905 Ga0496102_0322044 Ga0496102_0322044_320_1348 308
29 3300048906 Ga0496103_0021102 Ga0496103_0021102_172_1200 308
30 3300048908 Ga0496105_0054850 Ga0496105_0054850_806_1834 308
31 3300048912 Ga0496109_0302093 Ga0496109_0302093_12_1040 308
32 3300048914 Ga0496111_0010426 Ga0496111_0010426_2699_3727 308
33 3300048916 Ga0496113_0082529 Ga0496113_0082529_729_1757 308
34 3300048917 Ga0496114_0079400 Ga0496114_0079400_12_1040 308
35 3300048907 Ga0496104_0151899 Ga0496104_0151899_179_1207 310
36 3300048913 Ga0496110_0110170 Ga0496110_0110170_864_1892 310
37 3300005548 Ga0070665_100102385 Ga0070665_1001023852 311
38 3300028379 Ga0268266_10077220 Ga0268266_100772203 311
39 3300031727 Ga0316576_10000924 Ga0316576_1000092410 311
40 3300035398 Ga0316574_0009181 Ga0316574_0009181_4272_5297 311
41 3300038443 Ga0395901_0192244 Ga0395901_0192244_1064_2092 312
42 3300046462 Ga0495651_0077142 Ga0495651_0077142_230_1249 312
43 3300044694 Ga0466963_0019293 Ga0466963_0019293_980_2008 313
44 3300045976 Ga0466967_0003706 Ga0466967_0003706_4193_5221 313
45 3300013307 Ga0157372_10175713 Ga0157372_101757133 314
46 3300028573 Ga0265334_10007935 Ga0265334_100079354 314
47 3300048911 Ga0496108_0012156 Ga0496108_0012156_1084_2103 314
48 3300048912 Ga0496109_0015892 Ga0496109_0015892_4992_6011 314
49 3300048916 Ga0496113_0166977 Ga0496113_0166977_363_1382 314
50 3300002067 JGI24735J21928_10052050 JGI24735J21928_100520501 315
51 3300048929 Ga0496126_0290128 Ga0496126_0290128_232_1263 315
52 3300005842 Ga0068858_100014693 Ga0068858_1000146937 316
53 3300026035 Ga0207703_10036141 Ga0207703_100361413 316
54 3300049571 Ga0501034_0011240 Ga0501034_0011240_710_1735 317
55 3300005535 Ga0070684_100213826 Ga0070684_1002138262 319
56 3300014325 Ga0163163_10514877 Ga0163163_105148772 319
57 3300025901 Ga0207688_10028845 Ga0207688_100288452 319
58 3300025940 Ga0207691_10120623 Ga0207691_101206233 319
59 3300048913 Ga0496110_0243745 Ga0496110_0243745_62_1120 319
60 3300048915 Ga0496112_0006714 Ga0496112_0006714_5736_6749 319
61 3300048915 Ga0496112_0438935 Ga0496112_0438935_11_1069 319
62 3300048917 Ga0496114_0158209 Ga0496114_0158209_546_1604 319
63 iso_pu_bacteria 2868088558 2868091995 319
64 3300009148 Ga0105243_10030404 Ga0105243_100304043 320
65 3300009551 Ga0105238_10390725 Ga0105238_103907251 320
66 3300046559 Ga0495667_0082301 Ga0495667_0082301_1004_2023 320
67 3300046809 Ga0495600_0222814 Ga0495600_0222814_174_1193 320
68 3300047444 Ga0495675_0059312 Ga0495675_0059312_1042_2061 320
69 3300005616 Ga0068852_100045059 Ga0068852_1000450592 321
70 3300009174 Ga0105241_10187668 Ga0105241_101876682 321
71 3300026142 Ga0207698_10005148 Ga0207698_100051488 321
72 3300044901 Ga0466960_0065020 Ga0466960_0065020_697_1734 321
73 3300046535 Ga0495586_0132868 Ga0495586_0132868_150_1178 321
74 3300048929 Ga0496126_0053727 Ga0496126_0053727_632_1663 321
75 iso_pu_bacteria 8056060235 8056066239 321
76 3300044658 Ga0466972_0057025 Ga0466972_0057025_793_1821 322
77 3300045049 Ga0466959_0168416 Ga0466959_0168416_295_1323 322
78 3300005615 Ga0070702_100001724 Ga0070702_1000017248 323
79 3300005841 Ga0068863_100040997 Ga0068863_1000409975 323
80 3300017792 Ga0163161_10117247 Ga0163161_101172471 323
81 3300025924 Ga0207694_10136422 Ga0207694_101364222 323
82 3300026088 Ga0207641_10046507 Ga0207641_100465071 323
83 3300048903 Ga0496100_0031907 Ga0496100_0031907_498_1535 323
84 3300048904 Ga0496101_0337071 Ga0496101_0337071_86_1123 323
85 3300048905 Ga0496102_0135650 Ga0496102_0135650_397_1434 323
86 3300048910 Ga0496107_0195031 Ga0496107_0195031_88_1125 323
87 3300031731 Ga0307405_10059706 Ga0307405_100597062 324
88 3300031995 Ga0307409_100013302 Ga0307409_1000133024 324
89 3300032002 Ga0307416_100219611 Ga0307416_1002196111 324
90 3300044684 Ga0466966_0020134 Ga0466966_0020134_227_1255 324
91 3300045049 Ga0466959_0022540 Ga0466959_0022540_51_1079 324
92 3300046461 Ga0495641_0065891 Ga0495641_0065891_236_1273 324
93 3300048905 Ga0496102_0001247 Ga0496102_0001247_7214_8245 325
94 3300031824 Ga0307413_10077112 Ga0307413_100771123 326
95 3300032126 Ga0307415_100100296 Ga0307415_1001002961 326
96 3300044658 Ga0466972_0015918 Ga0466972_0015918_166_1194 326
97 3300044683 Ga0466965_0014723 Ga0466965_0014723_2515_3543 326
98 3300044694 Ga0466963_0128702 Ga0466963_0128702_321_1349 326
99 3300044719 Ga0466971_0002973 Ga0466971_0002973_2775_3803 326
100 3300044765 Ga0466970_0024229 Ga0466970_0024229_1748_2776 326
101 3300044842 Ga0466957_0027096 Ga0466957_0027096_1685_2713 326
102 3300044901 Ga0466960_0005473 Ga0466960_0005473_2996_4024 326
103 3300045976 Ga0466967_0042687 Ga0466967_0042687_321_1349 326
104 3300061719 Ga0466962_0003822 Ga0466962_0003822_3727_4755 326
105 3300049569 Ga0501032_0045714 Ga0501032_0045714_609_1634 327
106 iso_pu_bacteria 2867312974 2867315739 327
107 iso_pu_bacteria 2867319477 2867323795 327
108 3300013100 Ga0157373_10017934 Ga0157373_100179344 329
109 3300049588 Ga0501072_0007372 Ga0501072_0007372_7296_8312 329
110 3300006844 Ga0075428_100208797 Ga0075428_1002087973 330
111 3300006846 Ga0075430_100000816 Ga0075430_1000008167 330
112 3300009011 Ga0105251_10021108 Ga0105251_100211083 330
113 3300013102 Ga0157371_10139876 Ga0157371_101398761 330
114 3300013105 Ga0157369_10031847 Ga0157369_100318473 330
115 3300042002 Ga0439442_000056 Ga0439442_000056_19698_20714 330
116 3300042002 Ga0439442_000532 Ga0439442_000532_2469_3485 330
117 3300045976 Ga0466967_0003568 Ga0466967_0003568_7010_8029 330
118 3300046461 Ga0495641_0113766 Ga0495641_0113766_130_1149 330
119 3300046475 Ga0495639_0057240 Ga0495639_0057240_547_1566 330
120 3300046475 Ga0495639_0115271 Ga0495639_0115271_177_1193 330
121 3300046499 Ga0495594_0052084 Ga0495594_0052084_1209_2225 330
122 3300046528 Ga0495642_0042369 Ga0495642_0042369_808_1824 330
123 3300046557 Ga0495622_0023892 Ga0495622_0023892_902_1918 330
124 3300046691 Ga0495670_0094041 Ga0495670_0094041_293_1309 330
125 3300048905 Ga0496102_0043444 Ga0496102_0043444_2067_3083 330
126 3300048906 Ga0496103_0174119 Ga0496103_0174119_342_1358 330
127 3300048909 Ga0496106_0173380 Ga0496106_0173380_353_1369 330
128 3300048927 Ga0496124_0009254 Ga0496124_0009254_7963_8979 330
129 3300048928 Ga0496125_0083938 Ga0496125_0083938_1063_2079 330
130 3300049568 Ga0501031_0012785 Ga0501031_0012785_4338_5357 330
131 3300049572 Ga0501036_0005800 Ga0501036_0005800_3997_5016 330
132 3300049573 Ga0501037_0269037 Ga0501037_0269037_42_1061 330
133 3300049577 Ga0501041_0038084 Ga0501041_0038084_1839_2858 330
134 3300049578 Ga0501042_0014432 Ga0501042_0014432_1230_2249 330
135 3300049582 Ga0501048_0023237 Ga0501048_0023237_544_1563 330
136 3300049587 Ga0501071_0005032 Ga0501071_0005032_3214_4233 330
137 3300049590 Ga0501074_0062051 Ga0501074_0062051_883_1902 330
138 3300049741 Ga0501079_0260229 Ga0501079_0260229_212_1231 330
139 3300049742 Ga0501080_0052200 Ga0501080_0052200_1485_2504 330
140 3300049824 Ga0501045_0042461 Ga0501045_0042461_54_1073 330
141 3300050507 nmdc:mga05p37_140187_c1 nmdc:mga05p37_140187_c1_997_2007 330
142 3300050508 nmdc:mga09592_72490_c1 nmdc:mga09592_72490_c1_445_1455 330
143 3300050509 nmdc:mga0qj67_173_c1 nmdc:mga0qj67_173_c1_19436_20446 330
144 3300050509 nmdc:mga0qj67_29724_c1 nmdc:mga0qj67_29724_c1_977_1987 330
145 3300054114 Ga0501084_0286693 Ga0501084_0286693_326_1345 330
146 3300013102 Ga0157371_10034973 Ga0157371_100349732 331
147 3300013104 Ga0157370_10001462 Ga0157370_100014625 331
148 iso_pu_bacteria 2739367653 2739602611 331
149 iso_pu_bacteria 2808606700 2810364046 331
150 iso_pu_bacteria 2821268502 2821270268 331
151 iso_pu_bacteria 2857727296 2857729212 331
152 iso_pu_bacteria 2905926851 2905927386 331
153 iso_pu_bacteria 2920879853 2920882073 331
154 iso_pu_bacteria 2939598168 2939598459 331
155 iso_pu_bacteria 2945941187 2945942604 331
156 iso_pu_bacteria 2946003308 2946005087 331
157 iso_pu_bacteria 8004021418 8004021879 331
158 iso_pu_bacteria 8004025490 8004027716 331
159 iso_pu_bacteria 8004212874 8004213869 331
160 iso_pu_bacteria 8054107350 8054111224 331
161 iso_pu_bacteria 8057345674 8057345693 331
162 3300037418 Ga0395900_0007184 Ga0395900_0007184_1094_2110 332
163 3300038735 Ga0400485_18908 Ga0400485_18908_26812_27828 332
164 3300038741 Ga0400488_04075 Ga0400488_04075_1223_2239 332
165 3300038742 Ga0400486_03657 Ga0400486_03657_9513_10529 332
166 iso_pu_bacteria 2643221549 2643768087 332
167 iso_pu_bacteria 2643221567 2643850873 332
168 iso_pu_bacteria 2643221615 2644090028 332
169 iso_pu_bacteria 2643221624 2644134613 332
170 iso_pu_bacteria 2643221641 2644231365 332
171 iso_pu_bacteria 2643221657 2644319873 332
172 iso_pu_bacteria 2643221690 2644506714 332
173 iso_pu_bacteria 2643221694 2644527707 332
174 iso_pu_bacteria 2643221711 2644608896 332
175 iso_pu_bacteria 2643221722 2644670672 332
176 iso_pu_bacteria 2738541272 2738696599 332
177 iso_pu_bacteria 2738543027 2739324329 332
178 iso_pu_bacteria 2739367654 2739606742 332
179 iso_pu_bacteria 2739367898 2740166685 332
180 iso_pu_bacteria 2758568522 2760306437 332
181 iso_pu_bacteria 2758568621 2760625097 332
182 iso_pu_bacteria 2784132109 2784471747 332
183 iso_pu_bacteria 2808606365 2808873375 332
184 iso_pu_bacteria 2808606394 2809029964 332
185 iso_pu_bacteria 2811994880 2812362121 332
186 iso_pu_bacteria 2811994882 2812374044 332
187 iso_pu_bacteria 2818991318 2819426718 332
188 iso_pu_bacteria 2818991458 2819665742 332
189 iso_pu_bacteria 2818991462 2819691097 332
190 iso_pu_bacteria 2818991469 2819728984 332
191 iso_pu_bacteria 2835188231 2835189059 332
192 iso_pu_bacteria 2844841374 2844842015 332
193 iso_pu_bacteria 2855386786 2855387520 332
194 iso_pu_bacteria 2857481737 2857483530 332
195 iso_pu_bacteria 2857710386 2857712491 332
196 iso_pu_bacteria 2887443736 2887445611 332
197 iso_pu_bacteria 2893684298 2893686695 332
198 iso_pu_bacteria 2919055335 2919057649 332
199 iso_pu_bacteria 2919446982 2919449642 332
200 iso_pu_bacteria 2919523602 2919524056 332
201 iso_pu_bacteria 2928153084 2928155783 332
202 iso_pu_bacteria 8056579771 8056582681 332
203 3300003762 Ga0055542_1002872 Ga0055542_10028723 333
204 3300005329 Ga0070683_100266510 Ga0070683_1002665102 333
205 3300005339 Ga0070660_100075006 Ga0070660_1000750063 333
206 3300005530 Ga0070679_100021008 Ga0070679_1000210085 333
207 3300009101 Ga0105247_10000856 Ga0105247_100008566 333
208 3300009176 Ga0105242_10203897 Ga0105242_102038972 333
209 3300010375 Ga0105239_10001015 Ga0105239_1000101514 333
210 3300013105 Ga0157369_10034898 Ga0157369_100348982 333
211 3300013306 Ga0163162_10024096 Ga0163162_100240965 333
212 3300013307 Ga0157372_10055250 Ga0157372_100552503 333
213 3300013307 Ga0157372_10084698 Ga0157372_100846983 333
214 3300013308 Ga0157375_10118462 Ga0157375_101184623 333
215 3300014968 Ga0157379_10138434 Ga0157379_101384343 333
216 3300025254 Ga0209148_1002093 Ga0209148_10020933 333
217 3300025315 Ga0207697_10001476 Ga0207697_100014765 333
218 3300025728 Ga0207655_1045632 Ga0207655_10456323 333
219 3300025735 Ga0207713_1026397 Ga0207713_10263972 333
220 3300025893 Ga0207682_10020254 Ga0207682_100202542 333
221 3300025919 Ga0207657_10083103 Ga0207657_100831033 333
222 3300025921 Ga0207652_10146636 Ga0207652_101466362 333
223 3300025926 Ga0207659_10270001 Ga0207659_102700012 333
224 3300025935 Ga0207709_10010919 Ga0207709_100109193 333
225 3300025940 Ga0207691_10000233 Ga0207691_1000023321 333
226 3300037466 Ga0395898_0206428 Ga0395898_0206428_724_1746 333
227 3300039450 Ga0436363_0217384 Ga0436363_0217384_258_1277 333
228 3300041413 Ga0439465_0060728 Ga0439465_0060728_104_1123 333
229 3300041413 Ga0439465_0080180 Ga0439465_0080180_71_1090 333
230 3300041509 Ga0451843_0361191 Ga0451843_0361191_478_1497 333
231 3300041997 Ga0439431_0011563 Ga0439431_0011563_14_1033 333
232 3300042435 Ga0439434_0003171 Ga0439434_0003171_2719_3738 333
233 3300044683 Ga0466965_0097164 Ga0466965_0097164_409_1428 333
234 3300044683 Ga0466965_0169698 Ga0466965_0169698_80_1099 333
235 3300044693 Ga0466961_0048947 Ga0466961_0048947_1630_2649 333
236 3300044694 Ga0466963_0048661 Ga0466963_0048661_1622_2641 333
237 3300044694 Ga0466963_0103027 Ga0466963_0103027_526_1548 333
238 3300044719 Ga0466971_0030519 Ga0466971_0030519_54_1073 333
239 3300044842 Ga0466957_0020399 Ga0466957_0020399_2508_3527 333
240 3300044842 Ga0466957_0043158 Ga0466957_0043158_72_1091 333
241 3300044901 Ga0466960_0049366 Ga0466960_0049366_112_1131 333
242 3300044901 Ga0466960_0078114 Ga0466960_0078114_29_1048 333
243 3300045051 Ga0451576_0078337 Ga0451576_0078337_2406_3425 333
244 3300045836 Ga0466958_0015072 Ga0466958_0015072_2728_3747 333
245 3300045836 Ga0466958_0141560 Ga0466958_0141560_100_1146 333
246 3300045976 Ga0466967_0017900 Ga0466967_0017900_2206_3228 333
247 3300045976 Ga0466967_0124421 Ga0466967_0124421_652_1671 333
248 3300046460 Ga0495638_0163716 Ga0495638_0163716_10_1029 333
249 3300048905 Ga0496102_0000044 Ga0496102_0000044_140697_141716 333
250 3300048906 Ga0496103_0000117 Ga0496103_0000117_31708_32727 333
251 3300048910 Ga0496107_0129318 Ga0496107_0129318_70_1089 333
252 3300048911 Ga0496108_0075928 Ga0496108_0075928_1503_2522 333
253 3300048913 Ga0496110_0028237 Ga0496110_0028237_18_1037 333
254 3300048914 Ga0496111_0002165 Ga0496111_0002165_6051_7070 333
255 3300048914 Ga0496111_0203761 Ga0496111_0203761_90_1109 333
256 3300048916 Ga0496113_0342132 Ga0496113_0342132_15_1034 333
257 3300048919 Ga0496116_0106761 Ga0496116_0106761_184_1203 333
258 3300048921 Ga0496118_0015006 Ga0496118_0015006_4603_5622 333
259 3300049568 Ga0501031_0008433 Ga0501031_0008433_1141_2178 333
260 3300049572 Ga0501036_0008620 Ga0501036_0008620_4586_5623 333
261 3300049578 Ga0501042_0003020 Ga0501042_0003020_9367_10404 333
262 3300049580 Ga0501046_0044903 Ga0501046_0044903_2438_3475 333
263 3300049582 Ga0501048_0014701 Ga0501048_0014701_18_1055 333
264 3300049585 Ga0501069_0098163 Ga0501069_0098163_15_1052 333
265 3300049586 Ga0501070_0029069 Ga0501070_0029069_3094_4113 333
266 3300049586 Ga0501070_0342437 Ga0501070_0342437_82_1101 333
267 3300049587 Ga0501071_0005137 Ga0501071_0005137_7298_8335 333
268 3300049591 Ga0501075_0002506 Ga0501075_0002506_9727_10764 333
269 3300049592 Ga0501076_0270482 Ga0501076_0270482_286_1323 333
270 3300049741 Ga0501079_0011060 Ga0501079_0011060_3328_4365 333
271 3300049742 Ga0501080_0132334 Ga0501080_0132334_45_1082 333
272 3300049824 Ga0501045_0014598 Ga0501045_0014598_4439_5476 333
273 3300050490 nmdc:mga03n38_42580_c1 nmdc:mga03n38_42580_c1_413_1435 333
274 3300050490 nmdc:mga03n38_45567_c1 nmdc:mga03n38_45567_c1_705_1727 333
275 3300050490 nmdc:mga03n38_52667_c1 nmdc:mga03n38_52667_c1_406_1428 333
276 3300050491 nmdc:mga00v17_142010_c1 nmdc:mga00v17_142010_c1_448_1467 333
277 3300050491 nmdc:mga00v17_15733_c1 nmdc:mga00v17_15733_c1_1139_2158 333
278 3300050491 nmdc:mga00v17_81024_c1 nmdc:mga00v17_81024_c1_333_1355 333
279 3300050491 nmdc:mga00v17_81537_c1 nmdc:mga00v17_81537_c1_758_1780 333
280 3300050491 nmdc:mga00v17_9684_c1 nmdc:mga00v17_9684_c1_1369_2388 333
281 3300050492 nmdc:mga0yw44_154857_c1 nmdc:mga0yw44_154857_c1_255_1274 333
282 3300050492 nmdc:mga0yw44_36854_c1 nmdc:mga0yw44_36854_c1_842_1861 333
283 3300050492 nmdc:mga0yw44_5319_c1 nmdc:mga0yw44_5319_c1_908_1930 333
284 3300050492 nmdc:mga0yw44_54651_c1 nmdc:mga0yw44_54651_c1_780_1799 333
285 3300050494 nmdc:mga06z11_5409_c1 nmdc:mga06z11_5409_c1_884_1903 333
286 3300050496 nmdc:mga07m45_12015_c1 nmdc:mga07m45_12015_c1_3457_4479 333
287 3300050496 nmdc:mga07m45_31948_c1 nmdc:mga07m45_31948_c1_140_1159 333
288 3300053088 Ga0500644_0000271 Ga0500644_0000271_19920_20942 333
289 3300053096 Ga0500641_0111899 Ga0500641_0111899_46_1068 333
290 3300053104 Ga0500556_0001337 Ga0500556_0001337_44_1063 333
291 3300053117 Ga0500593_001021 Ga0500593_001021_26_1045 333
292 3300053153 Ga0500616_0000584 Ga0500616_0000584_38377_39396 333
293 3300053153 Ga0500616_0004040 Ga0500616_0004040_5218_6237 333
294 3300060353 Ga0501082_0150031 Ga0501082_0150031_961_1998 333
295 iso_pu_bacteria 2857479173 2857480031 333
296 iso_pu_bacteria 2857632687 2857634629 333
297 iso_pu_bacteria 2870801768 2870802800 333
298 iso_pu_bacteria 2870804320 2870804873 333
299 3300020069 Ga0197907_10338604 Ga0197907_103386042 334
300 3300037418 Ga0395900_0163776 Ga0395900_0163776_754_1782 334
301 3300037471 Ga0395905_0030962 Ga0395905_0030962_3175_4203 334
302 3300047315 Ga0495581_0187567 Ga0495581_0187567_55_1092 334
303 3300048916 Ga0496113_0077396 Ga0496113_0077396_82_1110 334
304 3300005366 Ga0070659_100019156 Ga0070659_1000191564 335
305 3300013102 Ga0157371_10021032 Ga0157371_100210324 335
306 3300013104 Ga0157370_10024896 Ga0157370_100248964 335
307 3300013250 Ga0171462_1003 Ga0171462_1003136 335
308 3300025909 Ga0207705_10000001 Ga0207705_100000011628 335
309 3300025919 Ga0207657_10040756 Ga0207657_100407562 335
310 3300025919 Ga0207657_10119167 Ga0207657_101191672 335
311 3300025924 Ga0207694_10077535 Ga0207694_100775353 335
312 3300025932 Ga0207690_10070406 Ga0207690_100704062 335
313 3300026067 Ga0207678_10014881 Ga0207678_100148815 335
314 3300031824 Ga0307413_10303825 Ga0307413_103038252 335
315 3300031852 Ga0307410_10004422 Ga0307410_100044223 335
316 3300032004 Ga0307414_10238153 Ga0307414_102381532 335
317 3300037466 Ga0395898_0321247 Ga0395898_0321247_145_1173 335
318 3300038443 Ga0395901_0031298 Ga0395901_0031298_986_2014 335
319 3300044658 Ga0466972_0109358 Ga0466972_0109358_247_1275 335
320 3300044684 Ga0466966_0001371 Ga0466966_0001371_6814_7842 335
321 3300044693 Ga0466961_0106818 Ga0466961_0106818_190_1218 335
322 3300044694 Ga0466963_0159412 Ga0466963_0159412_444_1472 335
323 3300044765 Ga0466970_0002711 Ga0466970_0002711_32_1057 335
324 3300044842 Ga0466957_0016352 Ga0466957_0016352_753_1781 335
325 3300045049 Ga0466959_0042256 Ga0466959_0042256_1780_2808 335
326 3300045976 Ga0466967_0118922 Ga0466967_0118922_1323_2351 335
327 3300048920 Ga0496117_0003713 Ga0496117_0003713_12529_13554 335
328 3300048921 Ga0496118_0007507 Ga0496118_0007507_3301_4326 335
329 3300048922 Ga0496119_0000336 Ga0496119_0000336_42680_43708 335
330 3300048922 Ga0496119_0010041 Ga0496119_0010041_3698_4723 335
331 3300048923 Ga0496120_0001760 Ga0496120_0001760_7121_8149 335
332 3300048925 Ga0496122_0000373 Ga0496122_0000373_11130_12155 335
333 3300048926 Ga0496123_0000213 Ga0496123_0000213_105940_106965 335
334 3300048928 Ga0496125_0083263 Ga0496125_0083263_423_1448 335
335 3300049127 Ga0501306_000278 Ga0501306_000278_1253_2278 335
336 3300049533 Ga0501317_000579 Ga0501317_000579_862_1887 335
337 3300049534 Ga0501318_000073 Ga0501318_000073_1408_2433 335
338 3300049571 Ga0501034_0012373 Ga0501034_0012373_3227_4252 335
339 3300049579 Ga0501043_0099182 Ga0501043_0099182_974_1999 335
340 3300049586 Ga0501070_0031942 Ga0501070_0031942_536_1561 335
341 3300049587 Ga0501071_0001053 Ga0501071_0001053_4209_5234 335
342 3300049588 Ga0501072_0111044 Ga0501072_0111044_872_1897 335
343 3300049589 Ga0501073_0077619 Ga0501073_0077619_187_1212 335
344 3300000549 LJQas_1004381 LJQas_10043811 336
345 3300001989 JGI24739J22299_10024386 JGI24739J22299_100243861 336
346 3300001989 JGI24739J22299_10043474 JGI24739J22299_100434741 336
347 3300002067 JGI24735J21928_10000820 JGI24735J21928_100008207 336
348 3300003285 Ga0007423J48922_100219 Ga0007423J48922_1002193 336
349 3300003373 JGI25407J50210_10002340 JGI25407J50210_100023402 336
350 3300003752 Ga0055539_1000111 Ga0055539_100011186 336
351 3300003756 Ga0055533_1000001 Ga0055533_1000001345 336
352 3300003760 Ga0055527_1000012 Ga0055527_1000012177 336
353 3300003762 Ga0055542_1000017 Ga0055542_1000017177 336
354 3300003763 Ga0055529_1000023 Ga0055529_1000023144 336
355 3300003841 Ga0055541_1000938 Ga0055541_10009384 336
356 3300005337 Ga0070682_100000691 Ga0070682_10000069117 336
357 3300005339 Ga0070660_100009065 Ga0070660_1000090651 336
358 3300005356 Ga0070674_100247904 Ga0070674_1002479042 336
359 3300005366 Ga0070659_100041902 Ga0070659_1000419022 336
360 3300005367 Ga0070667_100129475 Ga0070667_1001294753 336
361 3300005435 Ga0070714_100000525 Ga0070714_1000005257 336
362 3300005459 Ga0068867_100365770 Ga0068867_1003657701 336
363 3300005530 Ga0070679_100201277 Ga0070679_1002012771 336
364 3300005535 Ga0070684_100001882 Ga0070684_1000018823 336
365 3300005577 Ga0068857_100124419 Ga0068857_1001244192 336
366 3300005614 Ga0068856_100054884 Ga0068856_1000548842 336
367 3300005614 Ga0068856_100102918 Ga0068856_1001029182 336
368 3300005615 Ga0070702_100105510 Ga0070702_1001055101 336
369 3300005617 Ga0068859_100009636 Ga0068859_1000096363 336
370 3300005843 Ga0068860_100000357 Ga0068860_1000003574 336
371 3300005843 Ga0068860_100035215 Ga0068860_1000352153 336
372 3300005937 Ga0081455_10000134 Ga0081455_1000013465 336
373 3300005937 Ga0081455_10002407 Ga0081455_100024075 336
374 3300005937 Ga0081455_10083570 Ga0081455_100835702 336
375 3300005981 Ga0081538_10000520 Ga0081538_1000052044 336
376 3300006038 Ga0075365_10002919 Ga0075365_100029194 336
377 3300006038 Ga0075365_10007438 Ga0075365_100074382 336
378 3300006048 Ga0075363_100045195 Ga0075363_1000451953 336
379 3300006051 Ga0075364_10004748 Ga0075364_1000474810 336
380 3300006051 Ga0075364_10114445 Ga0075364_101144452 336
381 3300006178 Ga0075367_10011121 Ga0075367_100111213 336
382 3300006178 Ga0075367_10125274 Ga0075367_101252741 336
383 3300006353 Ga0075370_10022197 Ga0075370_100221972 336
384 3300006844 Ga0075428_100013282 Ga0075428_1000132825 336
385 3300006847 Ga0075431_100002532 Ga0075431_10000253216 336
386 3300006847 Ga0075431_100039232 Ga0075431_1000392323 336
387 3300006880 Ga0075429_100007033 Ga0075429_1000070334 336
388 3300006931 Ga0097620_100009636 Ga0097620_1000096367 336
389 3300009094 Ga0111539_10192655 Ga0111539_101926551 336
390 3300009147 Ga0114129_10078312 Ga0114129_100783121 336
391 3300013104 Ga0157370_10104374 Ga0157370_101043742 336
392 3300013105 Ga0157369_10070765 Ga0157369_100707653 336
393 3300013307 Ga0157372_10000057 Ga0157372_10000057111 336
394 3300013307 Ga0157372_10231641 Ga0157372_102316412 336
395 3300013308 Ga0157375_10050005 Ga0157375_100500053 336
396 3300020082 Ga0206353_10014289 Ga0206353_100142892 336
397 3300025225 Ga0209566_100078 Ga0209566_10007827 336
398 3300025226 Ga0209674_100001 Ga0209674_100001346 336
399 3300025228 Ga0209672_100003 Ga0209672_100003169 336
400 3300025229 Ga0209147_100858 Ga0209147_1008583 336
401 3300025230 Ga0209563_100001 Ga0209563_100001346 336
402 3300025253 Ga0209677_100001 Ga0209677_100001346 336
403 3300025254 Ga0209148_1000004 Ga0209148_1000004464 336
404 3300025272 Ga0209455_1000022 Ga0209455_1000022520 336
405 3300025272 Ga0209455_1003788 Ga0209455_10037886 336
406 3300025900 Ga0207710_10003524 Ga0207710_100035244 336
407 3300025904 Ga0207647_10013238 Ga0207647_100132382 336
408 3300025919 Ga0207657_10309698 Ga0207657_103096982 336
409 3300025927 Ga0207687_10391019 Ga0207687_103910191 336
410 3300025928 Ga0207700_10067258 Ga0207700_100672583 336
411 3300025929 Ga0207664_10000047 Ga0207664_100000477 336
412 3300025932 Ga0207690_10025502 Ga0207690_100255022 336
413 3300025944 Ga0207661_10028385 Ga0207661_100283851 336
414 3300025944 Ga0207661_10399362 Ga0207661_103993621 336
415 3300025986 Ga0207658_10342722 Ga0207658_103427221 336
416 3300026095 Ga0207676_10146583 Ga0207676_101465831 336
417 3300026116 Ga0207674_10001716 Ga0207674_1000171618 336
418 3300026116 Ga0207674_10153288 Ga0207674_101532881 336
419 3300027907 Ga0207428_10032991 Ga0207428_100329911 336
420 3300028381 Ga0268264_10000242 Ga0268264_1000024292 336
421 3300030734 Ga0316179_1119429 Ga0316179_11194292 336
422 3300030744 Ga0316181_1017937 Ga0316181_10179372 336
423 3300031665 Ga0316575_10000007 Ga0316575_1000000762 336
424 3300031727 Ga0316576_10072731 Ga0316576_100727313 336
425 3300035695 Ga0373927_0060288 Ga0373927_0060288_443_1474 336
426 3300037418 Ga0395900_0005454 Ga0395900_0005454_11279_12307 336
427 3300037418 Ga0395900_0455227 Ga0395900_0455227_135_1172 336
428 3300037466 Ga0395898_0002037 Ga0395898_0002037_23505_24533 336
429 3300037466 Ga0395898_0083570 Ga0395898_0083570_1974_3011 336
430 3300038443 Ga0395901_0069728 Ga0395901_0069728_94_1131 336
431 3300038443 Ga0395901_0288682 Ga0395901_0288682_547_1575 336
432 3300041997 Ga0439431_0010861 Ga0439431_0010861_757_1785 336
433 3300044706 Ga0466964_0101542 Ga0466964_0101542_13_1041 336
434 3300044735 Ga0466968_0056703 Ga0466968_0056703_354_1382 336
435 3300044765 Ga0466970_0025110 Ga0466970_0025110_57_1085 336
436 3300044765 Ga0466970_0057689 Ga0466970_0057689_964_1992 336
437 3300045049 Ga0466959_0050451 Ga0466959_0050451_863_1891 336
438 3300045049 Ga0466959_0066565 Ga0466959_0066565_1392_2420 336
439 3300046475 Ga0495639_0143819 Ga0495639_0143819_69_1097 336
440 3300046512 Ga0495610_0114877 Ga0495610_0114877_58_1086 336
441 3300048903 Ga0496100_0079980 Ga0496100_0079980_1093_2130 336
442 3300048905 Ga0496102_0072381 Ga0496102_0072381_2110_3138 336
443 3300048907 Ga0496104_0025246 Ga0496104_0025246_881_1909 336
444 3300048912 Ga0496109_0066790 Ga0496109_0066790_1926_2960 336
445 3300048913 Ga0496110_0131422 Ga0496110_0131422_578_1609 336
446 3300048914 Ga0496111_0004227 Ga0496111_0004227_1093_2124 336
447 3300048914 Ga0496111_0123472 Ga0496111_0123472_425_1453 336
448 3300048915 Ga0496112_0327843 Ga0496112_0327843_135_1169 336
449 3300048917 Ga0496114_0014155 Ga0496114_0014155_5162_6190 336
450 3300048917 Ga0496114_0468010 Ga0496114_0468010_67_1098 336
451 3300048920 Ga0496117_0051248 Ga0496117_0051248_21_1049 336
452 3300048922 Ga0496119_0045172 Ga0496119_0045172_1726_2754 336
453 3300048925 Ga0496122_0000646 Ga0496122_0000646_23896_24924 336
454 3300048925 Ga0496122_0001413 Ga0496122_0001413_37815_38843 336
455 3300048926 Ga0496123_0000405 Ga0496123_0000405_44074_45102 336
456 3300048928 Ga0496125_0000075 Ga0496125_0000075_105351_106379 336
457 3300049568 Ga0501031_0023687 Ga0501031_0023687_1470_2498 336
458 3300049572 Ga0501036_0077519 Ga0501036_0077519_910_1938 336
459 3300049574 Ga0501038_0016396 Ga0501038_0016396_1727_2755 336
460 3300049581 Ga0501047_0019439 Ga0501047_0019439_4012_5040 336
461 3300049581 Ga0501047_0021831 Ga0501047_0021831_43_1071 336
462 3300049586 Ga0501070_0003094 Ga0501070_0003094_4463_5491 336
463 3300049744 Ga0501083_0005546 Ga0501083_0005546_1287_2315 336
464 3300049822 Ga0501035_0025646 Ga0501035_0025646_2951_3979 336
465 3300049822 Ga0501035_0094984 Ga0501035_0094984_723_1751 336
466 3300049823 Ga0501044_0011917 Ga0501044_0011917_3067_4095 336
467 3300049823 Ga0501044_0128966 Ga0501044_0128966_991_2019 336
468 3300050507 nmdc:mga05p37_1355_c1 nmdc:mga05p37_1355_c1_5068_6099 336
469 3300050508 nmdc:mga09592_1246_c1 nmdc:mga09592_1246_c1_13705_14736 336
470 3300050509 nmdc:mga0qj67_9421_c1 nmdc:mga0qj67_9421_c1_5350_6381 336
471 3300050510 nmdc:mga06r32_761_c1 nmdc:mga06r32_761_c1_6947_7978 336
472 3300050511 nmdc:mga08y16_39322_c1 nmdc:mga08y16_39322_c1_942_1973 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01450

IlvC

Acetohydroxy acid isomeroreductase, catalytic domain

201

344

1

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

31

195

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

36

125

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

36

119

0.86

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

7

121

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e4r-assembly1.cif.gz_A crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd 0.9664 2 319
6vo2-assembly1.cif.gz_A crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, nadph and inhibitor. 0.9639 3 322
4kqx-assembly1.cif.gz_A mutant slackia exigua kari ddv in complex with nad and an inhibitor 0.9618 5 318
7q03-assembly1.cif.gz_A ketol-acid reductoisomerase from methanothermococcus thermolithotrophicus in the close state with nadp and mg2+ 0.9571 3 318
4kqw-assembly1.cif.gz_B the structure of the slackia exigua kari in complex with nadp 0.9538 3 321
ID Description Score Start End Superfamily
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9855 1 176 3.40.50.720
4xehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 2 176 3.40.50.720
2e5vA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9688 20 45 3.50.50.60
4xdyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 3 176 3.40.50.720
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 1 176 3.40.50.720
ID Description Score Start End GO Terms
AF-W1XVF2-F1-model_v4 Ketol-acid reductoisomerase 1.002 102 190 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A3N0GJ32-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9973 84 190 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
GO:0046872
AF-A0A3D4NM10-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9966 102 189 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
GO:0046872
AF-A0A4U3BLN5-F1-model_v4 deleted 0.9962 92 193
AF-A0A6G3VCJ0-F1-model_v4 deleted 0.9962 88 183

Feature Viewer

pLDDT pTM Quality
91.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map