F450578

General Info

Members Datasets Scaffolds Average Seq Length
471 143 471 145

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10440654|Ga0075433_104406542
Length 164
Sequence MKLEDLRPAPGSVKRRKRVGRGPSSGHGKTSTKGARSGGGKAGGFEGGQMPLYRRIPKRGFLPHGGKTEYAVANLKALSAFPSGATVDPDALVAARLIKRGERDRVKLLGDGDVPHALTVRVHAISESAKAKIEAAGGRVDVLPVKEGKKGTRRGSPSPTVAAS

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
83 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
92 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100626859 3300005343 Bacteria 742
2 Ga0070692_10687750 3300005345 Bacteria 687
3 Ga0070669_100991552 3300005353 Bacteria 720
4 Ga0070669_101602081 3300005353 Bacteria 567
5 Ga0070688_100563535 3300005365 Bacteria 868
6 Ga0070705_100031127 3300005440 Bacteria 2952
7 Ga0070705_100571936 3300005440 Bacteria 870
8 Ga0070705_101410541 3300005440 Bacteria 581
9 Ga0070705_101761084 3300005440 Unclassified 525
10 Ga0070700_100143780 3300005441 Bacteria 1624
11 Ga0070694_100108733 3300005444 Bacteria 1972
12 Ga0070694_100252021 3300005444 Bacteria 1336
13 Ga0070708_100049812 3300005445 Bacteria 3707
14 Ga0070708_100099177 3300005445 Bacteria 2664
15 Ga0070708_100101621 3300005445 Bacteria 2633
16 Ga0070708_100731798 3300005445 Bacteria 930
17 Ga0070662_100052208 3300005457 Bacteria 2955
18 Ga0070681_10191129 3300005458 Bacteria 1967
19 Ga0068867_100169984 3300005459 Bacteria 1726
20 Ga0068867_100712771 3300005459 Bacteria 887
21 Ga0068867_100763424 3300005459 Bacteria 859
22 Ga0070685_10136936 3300005466 Bacteria 1537
23 Ga0070706_100018387 3300005467 Bacteria 6447
24 Ga0070706_100062584 3300005467 Bacteria 3439
25 Ga0070706_100588414 3300005467 Bacteria 1034
26 Ga0070707_100182789 3300005468 Bacteria 2044
27 Ga0070707_100462389 3300005468 Bacteria 1230
28 Ga0070699_100055856 3300005518 Bacteria 3418
29 Ga0070699_100228614 3300005518 Bacteria 1659
30 Ga0070699_100355339 3300005518 Bacteria 1320
31 Ga0070699_100366375 3300005518 Bacteria 1299
32 Ga0070697_100479846 3300005536 Bacteria 1086
33 Ga0070686_100035635 3300005544 Bacteria 3075
34 Ga0070695_100402846 3300005545 Bacteria 1038
35 Ga0070695_100430462 3300005545 Bacteria 1007
36 Ga0070695_100644766 3300005545 Bacteria 836
37 Ga0070696_100383530 3300005546 Bacteria 1096
38 Ga0070693_100197407 3300005547 Bacteria 1305
39 Ga0070693_100855866 3300005547 Bacteria 678
40 Ga0070704_100384325 3300005549 Bacteria 1194
41 Ga0070702_100377255 3300005615 Bacteria 1007
42 Ga0068859_100946703 3300005617 Bacteria 945
43 Ga0068864_100621770 3300005618 Bacteria 1050
44 Ga0068866_10033135 3300005718 Bacteria 2503
45 Ga0068861_100961877 3300005719 Bacteria 813
46 Ga0068860_100132385 3300005843 Bacteria 2394
47 Ga0068862_100140666 3300005844 Bacteria 2142
48 Ga0068862_101144135 3300005844 Bacteria 775
49 Ga0075432_10147336 3300006058 Bacteria 902
50 Ga0075427_10019651 3300006194 Bacteria 1066
51 Ga0075428_100158613 3300006844 Bacteria 2456
52 Ga0075428_100305939 3300006844 Bacteria 1709
53 Ga0075428_100450071 3300006844 Bacteria 1379
54 Ga0075428_102291104 3300006844 Unclassified 556
55 Ga0075430_100002159 3300006846 Bacteria 16284
56 Ga0075430_100004590 3300006846 Bacteria 11623
57 Ga0075430_100032139 3300006846 Bacteria 4455
58 Ga0075430_100254832 3300006846 Bacteria 1454
59 Ga0075430_100478310 3300006846 Bacteria 1028
60 Ga0075430_101541819 3300006846 Bacteria 546
61 Ga0075431_100000559 3300006847 Bacteria 31330
62 Ga0075431_100003805 3300006847 Bacteria 14672
63 Ga0075431_100006659 3300006847 Bacteria 11475
64 Ga0075431_100040977 3300006847 Bacteria 4774
65 Ga0075431_100087048 3300006847 Bacteria 3224
66 Ga0075431_100152061 3300006847 Bacteria 2383
67 Ga0075431_100180752 3300006847 Bacteria 2165
68 Ga0075431_100186555 3300006847 Bacteria 2126
69 Ga0075431_100603065 3300006847 Bacteria 1082
70 Ga0075433_10069493 3300006852 Bacteria 3093
71 Ga0075433_10274930 3300006852 Bacteria 1493
72 Ga0075433_10302477 3300006852 Bacteria 1416
73 Ga0075433_10361952 3300006852 Bacteria 1281
74 Ga0075433_10440654 3300006852 Bacteria 1148
75 Ga0075433_10657633 3300006852 Bacteria 919
76 Ga0075434_100325157 3300006871 Bacteria 1558
77 Ga0075434_100375167 3300006871 Bacteria 1443
78 Ga0075434_100414227 3300006871 Bacteria 1368
79 Ga0075434_100657178 3300006871 Bacteria 1066
80 Ga0075429_100086149 3300006880 Bacteria 2738
81 Ga0075429_100091713 3300006880 Bacteria 2650
82 Ga0075429_100156725 3300006880 Bacteria 1994
83 Ga0075429_100165513 3300006880 Bacteria 1937
84 Ga0075429_100325751 3300006880 Bacteria 1344
85 Ga0068865_100755264 3300006881 Bacteria 836
86 Ga0075436_100014542 3300006914 Bacteria 5393
87 Ga0075436_100159107 3300006914 Bacteria 1592
88 Ga0075436_100189025 3300006914 Bacteria 1457
89 Ga0097620_100946679 3300006931 Bacteria 945
90 Ga0075435_100017186 3300007076 Bacteria 5468
91 Ga0075435_100098421 3300007076 Bacteria 2421
92 Ga0075435_100423606 3300007076 Bacteria 1146
93 Ga0099794_10000935 3300007265 Bacteria 9858
94 Ga0099794_10569082 3300007265 Bacteria 599
95 Ga0111539_10054750 3300009094 Bacteria 4745
96 Ga0111539_10120862 3300009094 Bacteria 3069
97 Ga0111539_10325378 3300009094 Bacteria 1789
98 Ga0114129_10000487 3300009147 Bacteria 47969
99 Ga0114129_10001150 3300009147 Bacteria 35034
100 Ga0114129_10011322 3300009147 Bacteria 12707
101 Ga0114129_10048865 3300009147 Bacteria 5946
102 Ga0114129_10085090 3300009147 Bacteria 4387
103 Ga0114129_10120483 3300009147 Bacteria 3612
104 Ga0114129_10146583 3300009147 Bacteria 3233
105 Ga0114129_10178965 3300009147 Bacteria 2887
106 Ga0114129_10212309 3300009147 Bacteria 2616
107 Ga0114129_10757183 3300009147 Bacteria 1243
108 Ga0114129_10774336 3300009147 Bacteria 1226
109 Ga0114129_10806787 3300009147 Bacteria 1197
110 Ga0114129_10860149 3300009147 Bacteria 1152
111 Ga0105249_10472407 3300009553 Bacteria 1296
112 Ga0105249_10657084 3300009553 Unclassified 1106
113 Ga0157378_10585088 3300013297 Bacteria 1126
114 Ga0163162_10925042 3300013306 Bacteria 984
115 Ga0163162_11139509 3300013306 Bacteria 884
116 Ga0207642_10258553 3300025899 Bacteria 992
117 Ga0207645_10144507 3300025907 Bacteria 1550
118 Ga0207684_10063417 3300025910 Bacteria 3137
119 Ga0207684_10096399 3300025910 Bacteria 2524
120 Ga0207684_10189971 3300025910 Bacteria 1771
121 Ga0207707_10086753 3300025912 Bacteria 2735
122 Ga0207662_10010786 3300025918 Bacteria 5050
123 Ga0207662_10302817 3300025918 Bacteria 1063
124 Ga0207646_10008198 3300025922 Bacteria 10499
125 Ga0207646_10128194 3300025922 Bacteria 2282
126 Ga0207646_10135008 3300025922 Bacteria 2221
127 Ga0207681_11423037 3300025923 Bacteria 582
128 Ga0207690_10240148 3300025932 Bacteria 1395
129 Ga0207706_10151544 3300025933 Bacteria 2039
130 Ga0207704_10458883 3300025938 Bacteria 1018
131 Ga0207665_10135708 3300025939 Bacteria 1750
132 Ga0207711_10254880 3300025941 Bacteria 1612
133 Ga0207689_10152287 3300025942 Bacteria 1906
134 Ga0207712_10370824 3300025961 Bacteria 1195
135 Ga0207708_10014559 3300026075 Bacteria 5885
136 Ga0207648_10718980 3300026089 Bacteria 926
137 Ga0207676_10690636 3300026095 Bacteria 988
138 Ga0207675_100511218 3300026118 Bacteria 1197
139 Ga0207675_101186963 3300026118 Bacteria 783
140 Ga0209999_1054433 3300027543 Bacteria 758
141 Ga0209588_1012019 3300027671 Bacteria 2624
142 Ga0209971_1012586 3300027682 Bacteria 2003
143 Ga0209998_10018118 3300027717 Bacteria 1493
144 Ga0209974_10021626 3300027876 Bacteria 2131
145 Ga0207428_10000095 3300027907 Bacteria 123199
146 Ga0207428_10016763 3300027907 Bacteria 6299
147 Ga0268265_10590498 3300028380 Bacteria 1060
148 Ga0268265_10942172 3300028380 Bacteria 850
149 Ga0268264_10059910 3300028381 Bacteria 3190
150 Ga0268264_11878946 3300028381 Bacteria 609
151 Ga0316176_1179271 3300030732 Bacteria 578
152 Ga0307408_101815446 3300031548 Bacteria 583
153 Ga0307413_10608477 3300031824 Bacteria 895
154 Ga0307406_10487444 3300031901 Bacteria 997
155 Ga0307412_11258564 3300031911 Bacteria 665
156 Ga0307409_101908034 3300031995 Bacteria 623
157 Ga0307416_100034743 3300032002 Bacteria 3841
158 Ga0307416_100512337 3300032002 Bacteria 1266
159 Ga0307416_102645402 3300032002 Bacteria 599
160 Ga0307414_10774148 3300032004 Bacteria 874
161 Ga0307411_10308310 3300032005 Bacteria 1273
162 Ga0307411_10330784 3300032005 Bacteria 1234
163 Ga0373948_0020178 3300034817 Bacteria 1267
164 Ga0373958_0086724 3300034819 Bacteria 716
165 Ga0373939_0116760 3300035114 Bacteria 936
166 Ga0373941_0018781 3300035115 Bacteria 1915
167 Ga0373960_0042359 3300035121 Bacteria 1322
168 Ga0373960_0133250 3300035121 Bacteria 835
169 Ga0373942_0033117 3300035207 Bacteria 1377
170 Ga0373962_0018388 3300035242 Bacteria 1818
171 Ga0373931_0002585 3300035691 Bacteria 8062
172 Ga0395905_0332459 3300037471 Bacteria 1410
173 Ga0242420_025085 3300038996 Bacteria 1082
174 Ga0439441_021025 3300042001 Bacteria 1201
175 Ga0439435_0007189 3300042436 Bacteria 2535
176 Ga0451577_0234366 3300042876 Bacteria 1660
177 Ga0453684_0179339 3300044712 Bacteria 2488
178 Ga0496102_0008904 3300048905 Bacteria 8613
179 Ga0496102_1504603 3300048905 Bacteria 592
180 Ga0496103_0318406 3300048906 Bacteria 1000
181 Ga0496106_0397567 3300048909 Bacteria 1107
182 Ga0496107_0179736 3300048910 Bacteria 1571
183 Ga0496110_0871450 3300048913 Unclassified 806
184 Ga0501031_0032401 3300049568 Bacteria 3407
185 Ga0501031_0215157 3300049568 Bacteria 1252
186 Ga0501032_0112128 3300049569 Bacteria 1804
187 Ga0501032_0191911 3300049569 Bacteria 1335
188 Ga0501033_0023237 3300049570 Bacteria 4677
189 Ga0501033_0027390 3300049570 Bacteria 4285
190 Ga0501033_0089636 3300049570 Bacteria 2250
191 Ga0501033_0439328 3300049570 Bacteria 907
192 Ga0501036_0000860 3300049572 Bacteria 22572
193 Ga0501036_0002708 3300049572 Bacteria 13991
194 Ga0501036_0039858 3300049572 Bacteria 3974
195 Ga0501036_0055576 3300049572 Bacteria 3354
196 Ga0501036_0221715 3300049572 Bacteria 1588
197 Ga0501037_0128224 3300049573 Bacteria 1820
198 Ga0501037_0201186 3300049573 Bacteria 1408
199 Ga0501037_0212044 3300049573 Bacteria 1365
200 Ga0501038_0001811 3300049574 Bacteria 19789
201 Ga0501038_0021614 3300049574 Bacteria 5773
202 Ga0501038_0121814 3300049574 Bacteria 2150
203 Ga0501038_0250808 3300049574 Bacteria 1402
204 Ga0501038_0426119 3300049574 Bacteria 1023
205 Ga0501038_0876591 3300049574 Bacteria 664
206 Ga0501039_0001335 3300049575 Bacteria 18046
207 Ga0501039_0016831 3300049575 Bacteria 5604
208 Ga0501039_0023281 3300049575 Bacteria 4755
209 Ga0501039_0048875 3300049575 Bacteria 3270
210 Ga0501039_0147752 3300049575 Bacteria 1847
211 Ga0501039_0154954 3300049575 Bacteria 1800
212 Ga0501039_0533294 3300049575 Bacteria 921
213 Ga0501039_0605323 3300049575 Unclassified 859
214 Ga0501039_0615676 3300049575 Bacteria 851
215 Ga0501039_1448565 3300049575 Bacteria 528
216 Ga0501040_0011405 3300049576 Bacteria 5819
217 Ga0501040_0022910 3300049576 Bacteria 4184
218 Ga0501040_0027803 3300049576 Bacteria 3809
219 Ga0501040_0052828 3300049576 Bacteria 2782
220 Ga0501040_0101903 3300049576 Bacteria 2003
221 Ga0501040_0121211 3300049576 Bacteria 1835
222 Ga0501040_0252457 3300049576 Bacteria 1258
223 Ga0501040_0277400 3300049576 Bacteria 1197
224 Ga0501040_0568679 3300049576 Bacteria 818
225 Ga0501040_0593221 3300049576 Bacteria 800
226 Ga0501040_0749135 3300049576 Bacteria 707
227 Ga0501041_0002087 3300049577 Bacteria 11248
228 Ga0501041_0009982 3300049577 Bacteria 5594
229 Ga0501041_0023643 3300049577 Bacteria 3684
230 Ga0501041_0031216 3300049577 Bacteria 3218
231 Ga0501041_0051905 3300049577 Bacteria 2500
232 Ga0501041_0087687 3300049577 Bacteria 1921
233 Ga0501041_0163163 3300049577 Bacteria 1393
234 Ga0501041_0438042 3300049577 Unclassified 829
235 Ga0501042_0000948 3300049578 Bacteria 16341
236 Ga0501042_0102670 3300049578 Bacteria 2057
237 Ga0501042_0112923 3300049578 Bacteria 1956
238 Ga0501042_0248861 3300049578 Bacteria 1282
239 Ga0501042_0398748 3300049578 Bacteria 996
240 Ga0501042_0491959 3300049578 Unclassified 890
241 Ga0501042_1069286 3300049578 Bacteria 588
242 Ga0501042_1267020 3300049578 Bacteria 538
243 Ga0501043_0015166 3300049579 Bacteria 6033
244 Ga0501043_1092388 3300049579 Bacteria 564
245 Ga0501046_0005447 3300049580 Bacteria 11377
246 Ga0501046_0013103 3300049580 Bacteria 7039
247 Ga0501046_0026439 3300049580 Bacteria 4741
248 Ga0501046_0028564 3300049580 Bacteria 4541
249 Ga0501046_0121676 3300049580 Bacteria 1985
250 Ga0501046_0230920 3300049580 Bacteria 1367
251 Ga0501046_0356414 3300049580 Bacteria 1061
252 Ga0501046_0582621 3300049580 Bacteria 795
253 Ga0501046_0702973 3300049580 Bacteria 712
254 Ga0501046_0960230 3300049580 Bacteria 594
255 Ga0501048_0003958 3300049582 Bacteria 11254
256 Ga0501048_0014949 3300049582 Bacteria 5741
257 Ga0501048_0027424 3300049582 Bacteria 4139
258 Ga0501048_0147543 3300049582 Bacteria 1664
259 Ga0501048_0388135 3300049582 Bacteria 997
260 Ga0501048_0532890 3300049582 Bacteria 842
261 Ga0501048_0617956 3300049582 Bacteria 778
262 Ga0501048_1089770 3300049582 Bacteria 575
263 Ga0501067_0010535 3300049583 Bacteria 5119
264 Ga0501068_0008573 3300049584 Bacteria 5695
265 Ga0501068_0090015 3300049584 Bacteria 1892
266 Ga0501068_0171913 3300049584 Bacteria 1368
267 Ga0501068_0207647 3300049584 Bacteria 1243
268 Ga0501068_0247890 3300049584 Bacteria 1135
269 Ga0501068_0521550 3300049584 Bacteria 771
270 Ga0501069_0063926 3300049585 Bacteria 2056
271 Ga0501069_0098933 3300049585 Bacteria 1655
272 Ga0501069_0104030 3300049585 Bacteria 1613
273 Ga0501070_0472584 3300049586 Bacteria 1009
274 Ga0501070_0628252 3300049586 Bacteria 854
275 Ga0501070_0747625 3300049586 Bacteria 771
276 Ga0501071_0000849 3300049587 Bacteria 16382
277 Ga0501071_0017192 3300049587 Bacteria 4985
278 Ga0501071_0059859 3300049587 Bacteria 2756
279 Ga0501071_0065940 3300049587 Bacteria 2630
280 Ga0501071_0082743 3300049587 Bacteria 2351
281 Ga0501071_0134708 3300049587 Bacteria 1837
282 Ga0501071_0309922 3300049587 Bacteria 1198
283 Ga0501072_0003324 3300049588 Bacteria 12098
284 Ga0501072_0005776 3300049588 Bacteria 9420
285 Ga0501072_0014153 3300049588 Bacteria 6112
286 Ga0501072_0022481 3300049588 Bacteria 4892
287 Ga0501072_0042061 3300049588 Bacteria 3589
288 Ga0501072_0141189 3300049588 Bacteria 1920
289 Ga0501072_0236044 3300049588 Bacteria 1456
290 Ga0501072_0276785 3300049588 Bacteria 1335
291 Ga0501072_0944937 3300049588 Bacteria 673
292 Ga0501073_0197342 3300049589 Bacteria 1392
293 Ga0501073_0253412 3300049589 Bacteria 1215
294 Ga0501074_0003006 3300049590 Bacteria 11867
295 Ga0501074_0007561 3300049590 Bacteria 7862
296 Ga0501074_0104281 3300049590 Bacteria 2030
297 Ga0501074_0156141 3300049590 Bacteria 1630
298 Ga0501074_0172992 3300049590 Bacteria 1541
299 Ga0501074_0266229 3300049590 Bacteria 1218
300 Ga0501075_0001033 3300049591 Bacteria 17853
301 Ga0501075_0001990 3300049591 Bacteria 13490
302 Ga0501075_0009915 3300049591 Bacteria 6676
303 Ga0501075_0012463 3300049591 Bacteria 6043
304 Ga0501075_0033791 3300049591 Bacteria 3805
305 Ga0501075_0072029 3300049591 Bacteria 2612
306 Ga0501075_0375029 3300049591 Bacteria 1084
307 Ga0501075_0389270 3300049591 Bacteria 1063
308 Ga0501075_1107545 3300049591 Bacteria 601
309 Ga0501075_1226865 3300049591 Bacteria 569
310 Ga0501076_0000979 3300049592 Bacteria 18705
311 Ga0501076_0002232 3300049592 Bacteria 13267
312 Ga0501076_0004384 3300049592 Bacteria 10028
313 Ga0501076_0009654 3300049592 Bacteria 7129
314 Ga0501076_0020810 3300049592 Bacteria 5024
315 Ga0501076_0028793 3300049592 Bacteria 4316
316 Ga0501076_0123009 3300049592 Bacteria 2101
317 Ga0501076_0317244 3300049592 Bacteria 1278
318 Ga0501076_0578218 3300049592 Bacteria 926
319 Ga0501076_0927197 3300049592 Bacteria 718
320 Ga0501076_1356682 3300049592 Bacteria 584
321 Ga0501077_0002533 3300049593 Bacteria 10951
322 Ga0501077_0007258 3300049593 Bacteria 6834
323 Ga0501077_0031014 3300049593 Bacteria 3401
324 Ga0501077_0098253 3300049593 Bacteria 1856
325 Ga0501077_0123476 3300049593 Bacteria 1641
326 Ga0501077_0128467 3300049593 Bacteria 1607
327 Ga0501077_0195668 3300049593 Bacteria 1284
328 Ga0501077_0365534 3300049593 Bacteria 921
329 Ga0501077_0447142 3300049593 Bacteria 827
330 Ga0501079_0001475 3300049741 Bacteria 16640
331 Ga0501079_0006844 3300049741 Bacteria 8584
332 Ga0501079_0011359 3300049741 Bacteria 6796
333 Ga0501079_0013353 3300049741 Bacteria 6265
334 Ga0501079_0019976 3300049741 Bacteria 5118
335 Ga0501079_0021167 3300049741 Bacteria 4972
336 Ga0501079_0025718 3300049741 Bacteria 4513
337 Ga0501079_0228972 3300049741 Bacteria 1452
338 Ga0501079_0328334 3300049741 Bacteria 1198
339 Ga0501079_0331337 3300049741 Bacteria 1192
340 Ga0501079_0358128 3300049741 Bacteria 1143
341 Ga0501079_0416162 3300049741 Bacteria 1055
342 Ga0501079_0519808 3300049741 Bacteria 936
343 Ga0501079_0629822 3300049741 Bacteria 844
344 Ga0501079_1157019 3300049741 Bacteria 609
345 Ga0501079_1432270 3300049741 Bacteria 544
346 Ga0501080_0023877 3300049742 Bacteria 5667
347 Ga0501080_0069446 3300049742 Bacteria 3276
348 Ga0501080_0085286 3300049742 Bacteria 2935
349 Ga0501080_0086583 3300049742 Bacteria 2911
350 Ga0501080_0401667 3300049742 Bacteria 1233
351 Ga0501080_0426912 3300049742 Bacteria 1190
352 Ga0501080_0469866 3300049742 Bacteria 1126
353 Ga0501080_0545266 3300049742 Bacteria 1033
354 Ga0501080_0813831 3300049742 Bacteria 819
355 Ga0501080_1093054 3300049742 Bacteria 689
356 Ga0501081_0001239 3300049743 Bacteria 15520
357 Ga0501081_0002378 3300049743 Bacteria 11848
358 Ga0501081_0009283 3300049743 Bacteria 6406
359 Ga0501081_0012727 3300049743 Bacteria 5534
360 Ga0501081_0028627 3300049743 Bacteria 3760
361 Ga0501081_0253893 3300049743 Bacteria 1284
362 Ga0501081_0323905 3300049743 Bacteria 1133
363 Ga0501081_0331063 3300049743 Bacteria 1120
364 Ga0501081_0429468 3300049743 Bacteria 980
365 Ga0501081_1014421 3300049743 Bacteria 627
366 Ga0501081_1037922 3300049743 Bacteria 620
367 Ga0501081_1406161 3300049743 Bacteria 529
368 Ga0501083_0016891 3300049744 Bacteria 5098
369 Ga0501083_0026008 3300049744 Bacteria 4048
370 Ga0501083_0094692 3300049744 Bacteria 1971
371 Ga0501283_055511 3300049779 Bacteria 708
372 Ga0501035_0029667 3300049822 Bacteria 4988
373 Ga0501035_0051228 3300049822 Bacteria 3697
374 Ga0501035_0236498 3300049822 Bacteria 1555
375 Ga0501035_1010268 3300049822 Bacteria 653
376 Ga0501045_0000682 3300049824 Bacteria 21537
377 Ga0501045_0001615 3300049824 Bacteria 15093
378 Ga0501045_0005837 3300049824 Bacteria 8526
379 Ga0501045_0008044 3300049824 Bacteria 7346
380 Ga0501045_0046088 3300049824 Bacteria 3175
381 Ga0501045_0836171 3300049824 Bacteria 677
382 nmdc:mga05p37_114074_c1 3300050507 Bacteria 3322
383 nmdc:mga05p37_115601_c2 3300050507 Bacteria 1196
384 nmdc:mga05p37_26466_c1 3300050507 Bacteria 7056
385 nmdc:mga05p37_269042_c2 3300050507 Bacteria 1219
386 nmdc:mga05p37_3121_c1 3300050507 Bacteria 19253
387 nmdc:mga05p37_33395_c1 3300050507 Bacteria 6302
388 nmdc:mga05p37_36644_c1 3300050507 Bacteria 6016
389 nmdc:mga05p37_43525_c1 3300050507 Bacteria 5524
390 nmdc:mga05p37_77307_c1 3300050507 Bacteria 4098
391 nmdc:mga05p37_79621_c1 3300050507 Bacteria 4034
392 nmdc:mga05p37_797152_c1 3300050507 Bacteria 1034
393 nmdc:mga09592_162708_c1 3300050508 Bacteria 1928
394 nmdc:mga09592_26553_c1 3300050508 Bacteria 4799
395 nmdc:mga09592_26571_c1 3300050508 Bacteria 4798
396 nmdc:mga09592_317112_c1 3300050508 Bacteria 1351
397 nmdc:mga09592_382858_c1 3300050508 Bacteria 1216
398 nmdc:mga09592_82111_c1 3300050508 Bacteria 2747
399 nmdc:mga0qj67_13056_c1 3300050509 Bacteria 6272
400 nmdc:mga0qj67_2619_c1 3300050509 Bacteria 12899
401 nmdc:mga0qj67_263626_c1 3300050509 Bacteria 1398
402 nmdc:mga0qj67_5121_c1 3300050509 Bacteria 9545
403 nmdc:mga0qj67_77970_c1 3300050509 Bacteria 2651
404 nmdc:mga06r32_1401_c1 3300050510 Bacteria 21763
405 nmdc:mga06r32_1949_c1 3300050510 Bacteria 18394
406 nmdc:mga06r32_33016_c1 3300050510 Bacteria 4873
407 nmdc:mga06r32_337317_c1 3300050510 Bacteria 1492
408 nmdc:mga06r32_382706_c1 3300050510 Bacteria 1390
409 nmdc:mga06r32_724801_c1 3300050510 Bacteria 959
410 nmdc:mga06r32_766554_c1 3300050510 Bacteria 927
411 nmdc:mga06r32_8063_c1 3300050510 Bacteria 9478
412 nmdc:mga06r32_809521_c1 3300050510 Unclassified 897
413 nmdc:mga08y16_1243848_c1 3300050511 Bacteria 713
414 nmdc:mga08y16_16604_c1 3300050511 Bacteria 7743
415 nmdc:mga08y16_51809_c1 3300050511 Bacteria 4295
416 nmdc:mga08y16_716_c1 3300050511 Bacteria 31529
417 nmdc:mga0n895_117793_c1 3300050512 Bacteria 2676
418 nmdc:mga0n895_1452696_c1 3300050512 Bacteria 653
419 nmdc:mga0n895_201363_c1 3300050512 Bacteria 2022
420 nmdc:mga0n895_474931_c1 3300050512 Bacteria 1261
421 nmdc:mga0n895_853437_c1 3300050512 Bacteria 898
422 nmdc:mga0rr50_115144_c1 3300050513 Bacteria 2133
423 nmdc:mga0rr50_197336_c1 3300050513 Bacteria 1652
424 nmdc:mga0rr50_27519_c1 3300050513 Bacteria 3983
425 nmdc:mga0rr50_363694_c1 3300050513 Bacteria 1218
426 nmdc:mga08x19_129171_c1 3300050514 Bacteria 1173
427 nmdc:mga08x19_138941_c1 3300050514 Bacteria 1640
428 nmdc:mga08x19_141061_c1 3300050514 Bacteria 1628
429 nmdc:mga0a205_13385_c1 3300050515 Bacteria 7637
430 nmdc:mga0a205_224039_c1 3300050515 Bacteria 1765
431 nmdc:mga0a205_226823_c1 3300050515 Bacteria 1753
432 nmdc:mga0a205_265161_c1 3300050515 Bacteria 1595
433 nmdc:mga0a205_33438_c1 3300050515 Bacteria 4930
434 nmdc:mga0a205_369772_c1 3300050515 Bacteria 1300
435 nmdc:mga0a205_48003_c2 3300050515 Bacteria 1648
436 nmdc:mga0a205_72927_c1 3300050515 Bacteria 3317
437 Ga0501084_0000677 3300054114 Bacteria 25964
438 Ga0501084_0004051 3300054114 Bacteria 11934
439 Ga0501084_0006689 3300054114 Bacteria 9477
440 Ga0501084_0009461 3300054114 Bacteria 8064
441 Ga0501084_0035131 3300054114 Bacteria 4190
442 Ga0501084_0040405 3300054114 Bacteria 3902
443 Ga0501084_0065675 3300054114 Bacteria 3036
444 Ga0501084_0086478 3300054114 Bacteria 2632
445 Ga0501084_0225836 3300054114 Bacteria 1580
446 Ga0501084_0355356 3300054114 Bacteria 1238
447 Ga0501084_0355891 3300054114 Bacteria 1237
448 Ga0501084_1431078 3300054114 Bacteria 579
449 Ga0501082_0002099 3300060353 Bacteria 17551
450 Ga0501082_0002693 3300060353 Bacteria 15524
451 Ga0501082_0017314 3300060353 Bacteria 6208
452 Ga0501082_0023005 3300060353 Bacteria 5373
453 Ga0501082_0128389 3300060353 Bacteria 2199
454 Ga0501082_0164136 3300060353 Bacteria 1930
455 Ga0501082_0174937 3300060353 Bacteria 1866
456 Ga0501082_0215355 3300060353 Bacteria 1671
457 Ga0501082_0254231 3300060353 Bacteria 1529
458 Ga0501082_0301222 3300060353 Bacteria 1396
459 Ga0501082_0317692 3300060353 Bacteria 1357
460 Ga0501082_1692686 3300060353 Bacteria 552
461 Ga0530510_0001293 3300061734 Bacteria 16724
462 Ga0530510_0003221 3300061734 Bacteria 11210
463 Ga0530510_0009637 3300061734 Bacteria 6776
464 Ga0530510_0010449 3300061734 Bacteria 6509
465 Ga0530510_0031810 3300061734 Bacteria 3794
466 Ga0530510_0053672 3300061734 Bacteria 2912
467 Ga0530510_0130886 3300061734 Bacteria 1846
468 Ga0530510_0259442 3300061734 Bacteria 1296
469 Ga0530510_0519776 3300061734 Bacteria 903
470 Ga0530510_0560263 3300061734 Bacteria 868
471 Ga0530510_0617048 3300061734 Bacteria 825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100101621 Ga0070708_1001016214 100
2 3300005467 Ga0070706_100018387 Ga0070706_1000183872 100
3 3300025910 Ga0207684_10189971 Ga0207684_101899714 100
4 3300026118 Ga0207675_101186963 Ga0207675_1011869633 104
5 3300050512 nmdc:mga0n895_853437_c1 nmdc:mga0n895_853437_c1_346_813 110
6 3300050513 nmdc:mga0rr50_115144_c1 nmdc:mga0rr50_115144_c1_116_583 111
7 3300049580 Ga0501046_0960230 Ga0501046_0960230_25_462 112
8 3300005445 Ga0070708_100049812 Ga0070708_1000498127 115
9 3300005467 Ga0070706_100062584 Ga0070706_1000625846 115
10 3300005518 Ga0070699_100228614 Ga0070699_1002286142 115
11 3300025910 Ga0207684_10096399 Ga0207684_100963993 115
12 3300049576 Ga0501040_0568679 Ga0501040_0568679_285_743 116
13 3300049579 Ga0501043_1092388 Ga0501043_1092388_25_483 116
14 3300061734 Ga0530510_0010449 Ga0530510_0010449_1753_2211 116
15 3300025939 Ga0207665_10135708 Ga0207665_101357082 117
16 3300049588 Ga0501072_0944937 Ga0501072_0944937_44_529 117
17 3300049593 Ga0501077_0365534 Ga0501077_0365534_405_890 117
18 3300049743 Ga0501081_0429468 Ga0501081_0429468_358_843 117
19 3300005345 Ga0070692_10687750 Ga0070692_106877501 118
20 3300005353 Ga0070669_100991552 Ga0070669_1009915521 118
21 3300005546 Ga0070696_100383530 Ga0070696_1003835303 118
22 3300049570 Ga0501033_0439328 Ga0501033_0439328_458_871 118
23 3300049575 Ga0501039_1448565 Ga0501039_1448565_43_456 118
24 3300049576 Ga0501040_0121211 Ga0501040_0121211_42_455 118
25 3300005468 Ga0070707_100182789 Ga0070707_1001827892 119
26 3300007265 Ga0099794_10569082 Ga0099794_105690822 119
27 3300005467 Ga0070706_100588414 Ga0070706_1005884143 120
28 3300005518 Ga0070699_100355339 Ga0070699_1003553393 120
29 3300025910 Ga0207684_10063417 Ga0207684_100634172 120
30 3300025922 Ga0207646_10135008 Ga0207646_101350081 120
31 3300005440 Ga0070705_100571936 Ga0070705_1005719362 121
32 3300006194 Ga0075427_10019651 Ga0075427_100196512 121
33 3300006844 Ga0075428_100450071 Ga0075428_1004500711 121
34 3300006846 Ga0075430_100002159 Ga0075430_10000215911 121
35 3300006847 Ga0075431_100087048 Ga0075431_1000870482 121
36 3300006880 Ga0075429_100091713 Ga0075429_1000917135 121
37 3300006914 Ga0075436_100014542 Ga0075436_1000145424 121
38 3300009147 Ga0114129_10212309 Ga0114129_102123095 121
39 3300050514 nmdc:mga08x19_141061_c1 nmdc:mga08x19_141061_c1_307_801 121
40 3300009147 Ga0114129_10860149 Ga0114129_108601493 122
41 3300031901 Ga0307406_10487444 Ga0307406_104874442 122
42 3300048905 Ga0496102_1504603 Ga0496102_1504603_49_519 122
43 3300049822 Ga0501035_1010268 Ga0501035_1010268_26_430 122
44 3300050512 nmdc:mga0n895_1452696_c1 nmdc:mga0n895_1452696_c1_116_589 122
45 3300005444 Ga0070694_100108733 Ga0070694_1001087334 123
46 3300005459 Ga0068867_100169984 Ga0068867_1001699843 123
47 3300005518 Ga0070699_100366375 Ga0070699_1003663752 123
48 3300005547 Ga0070693_100197407 Ga0070693_1001974073 123
49 3300005718 Ga0068866_10033135 Ga0068866_100331353 123
50 3300006852 Ga0075433_10302477 Ga0075433_103024772 123
51 3300006871 Ga0075434_100657178 Ga0075434_1006571783 123
52 3300006881 Ga0068865_100755264 Ga0068865_1007552642 123
53 3300007076 Ga0075435_100423606 Ga0075435_1004236062 123
54 3300009094 Ga0111539_10054750 Ga0111539_100547502 123
55 3300009147 Ga0114129_10178965 Ga0114129_101789652 123
56 3300025918 Ga0207662_10302817 Ga0207662_103028172 123
57 3300025938 Ga0207704_10458883 Ga0207704_104588832 123
58 3300025942 Ga0207689_10152287 Ga0207689_101522875 123
59 3300034819 Ga0373958_0086724 Ga0373958_0086724_14_481 123
60 3300035121 Ga0373960_0042359 Ga0373960_0042359_491_958 123
61 3300035242 Ga0373962_0018388 Ga0373962_0018388_619_1086 123
62 3300035691 Ga0373931_0002585 Ga0373931_0002585_3835_4302 123
63 3300042001 Ga0439441_021025 Ga0439441_021025_404_874 123
64 3300049568 Ga0501031_0215157 Ga0501031_0215157_640_1107 123
65 3300049576 Ga0501040_0593221 Ga0501040_0593221_116_589 123
66 3300049580 Ga0501046_0702973 Ga0501046_0702973_97_564 123
67 3300049582 Ga0501048_0617956 Ga0501048_0617956_95_562 123
68 3300049586 Ga0501070_0747625 Ga0501070_0747625_272_745 123
69 3300049591 Ga0501075_1107545 Ga0501075_1107545_25_492 123
70 3300050507 nmdc:mga05p37_77307_c1 nmdc:mga05p37_77307_c1_2939_3406 123
71 3300050507 nmdc:mga05p37_79621_c1 nmdc:mga05p37_79621_c1_1617_2090 123
72 3300050508 nmdc:mga09592_26571_c1 nmdc:mga09592_26571_c1_3302_3769 123
73 3300050509 nmdc:mga0qj67_263626_c1 nmdc:mga0qj67_263626_c1_689_1156 123
74 3300050510 nmdc:mga06r32_8063_c1 nmdc:mga06r32_8063_c1_1828_2295 123
75 3300050511 nmdc:mga08y16_51809_c1 nmdc:mga08y16_51809_c1_2899_3393 123
76 3300050513 nmdc:mga0rr50_363694_c1 nmdc:mga0rr50_363694_c1_238_732 123
77 3300050515 nmdc:mga0a205_48003_c2 nmdc:mga0a205_48003_c2_516_1010 123
78 3300061734 Ga0530510_0560263 Ga0530510_0560263_149_616 123
79 3300005536 Ga0070697_100479846 Ga0070697_1004798463 124
80 3300006847 Ga0075431_100180752 Ga0075431_1001807523 124
81 3300009147 Ga0114129_10085090 Ga0114129_100850902 124
82 3300013297 Ga0157378_10585088 Ga0157378_105850883 124
83 3300025907 Ga0207645_10144507 Ga0207645_101445072 124
84 3300031548 Ga0307408_101815446 Ga0307408_1018154462 124
85 3300031911 Ga0307412_11258564 Ga0307412_112585642 124
86 3300032005 Ga0307411_10308310 Ga0307411_103083102 124
87 3300049576 Ga0501040_0252457 Ga0501040_0252457_510_977 124
88 3300049741 Ga0501079_0416162 Ga0501079_0416162_19_486 124
89 3300049742 Ga0501080_0813831 Ga0501080_0813831_189_656 124
90 3300049743 Ga0501081_0253893 Ga0501081_0253893_92_559 124
91 3300050510 nmdc:mga06r32_724801_c1 nmdc:mga06r32_724801_c1_185_643 124
92 3300050514 nmdc:mga08x19_138941_c1 nmdc:mga08x19_138941_c1_609_1082 124
93 3300005445 Ga0070708_100731798 Ga0070708_1007317982 125
94 3300009147 Ga0114129_10757183 Ga0114129_107571832 126
95 3300025941 Ga0207711_10254880 Ga0207711_102548802 126
96 3300049569 Ga0501032_0191911 Ga0501032_0191911_265_732 126
97 3300049572 Ga0501036_0039858 Ga0501036_0039858_346_813 126
98 3300049573 Ga0501037_0212044 Ga0501037_0212044_850_1317 126
99 3300049574 Ga0501038_0250808 Ga0501038_0250808_382_849 126
100 3300049574 Ga0501038_0876591 Ga0501038_0876591_101_568 126
101 3300049575 Ga0501039_0016831 Ga0501039_0016831_1399_1866 126
102 3300049575 Ga0501039_0147752 Ga0501039_0147752_111_578 126
103 3300049576 Ga0501040_0027803 Ga0501040_0027803_996_1463 126
104 3300049577 Ga0501041_0023643 Ga0501041_0023643_639_1106 126
105 3300049577 Ga0501041_0163163 Ga0501041_0163163_795_1262 126
106 3300049578 Ga0501042_0112923 Ga0501042_0112923_866_1333 126
107 3300049580 Ga0501046_0121676 Ga0501046_0121676_795_1262 126
108 3300049582 Ga0501048_0027424 Ga0501048_0027424_2291_2758 126
109 3300049582 Ga0501048_0147543 Ga0501048_0147543_582_1049 126
110 3300049584 Ga0501068_0090015 Ga0501068_0090015_259_726 126
111 3300049584 Ga0501068_0521550 Ga0501068_0521550_205_672 126
112 3300049585 Ga0501069_0098933 Ga0501069_0098933_268_735 126
113 3300049586 Ga0501070_0472584 Ga0501070_0472584_268_735 126
114 3300049587 Ga0501071_0134708 Ga0501071_0134708_83_550 126
115 3300049588 Ga0501072_0141189 Ga0501072_0141189_800_1267 126
116 3300049588 Ga0501072_0276785 Ga0501072_0276785_573_1040 126
117 3300049589 Ga0501073_0253412 Ga0501073_0253412_292_759 126
118 3300049590 Ga0501074_0007561 Ga0501074_0007561_4507_4974 126
119 3300049591 Ga0501075_0009915 Ga0501075_0009915_832_1299 126
120 3300049591 Ga0501075_0033791 Ga0501075_0033791_1371_1838 126
121 3300049592 Ga0501076_0009654 Ga0501076_0009654_4994_5461 126
122 3300049592 Ga0501076_0020810 Ga0501076_0020810_2594_3061 126
123 3300049593 Ga0501077_0128467 Ga0501077_0128467_988_1455 126
124 3300049741 Ga0501079_0025718 Ga0501079_0025718_1024_1491 126
125 3300049741 Ga0501079_0358128 Ga0501079_0358128_28_495 126
126 3300049742 Ga0501080_0086583 Ga0501080_0086583_1389_1856 126
127 3300049743 Ga0501081_0028627 Ga0501081_0028627_2614_3081 126
128 3300049744 Ga0501083_0094692 Ga0501083_0094692_1404_1871 126
129 3300049822 Ga0501035_0236498 Ga0501035_0236498_845_1312 126
130 3300049824 Ga0501045_0001615 Ga0501045_0001615_11655_12122 126
131 3300050507 nmdc:mga05p37_797152_c1 nmdc:mga05p37_797152_c1_172_621 126
132 3300054114 Ga0501084_0009461 Ga0501084_0009461_5232_5699 126
133 3300054114 Ga0501084_0040405 Ga0501084_0040405_2662_3129 126
134 3300060353 Ga0501082_0128389 Ga0501082_0128389_863_1330 126
135 3300060353 Ga0501082_0164136 Ga0501082_0164136_190_657 126
136 3300061734 Ga0530510_0053672 Ga0530510_0053672_585_1052 126
137 3300006844 Ga0075428_100305939 Ga0075428_1003059392 127
138 3300006846 Ga0075430_100004590 Ga0075430_1000045903 127
139 3300006847 Ga0075431_100000559 Ga0075431_10000055924 127
140 3300006871 Ga0075434_100414227 Ga0075434_1004142273 127
141 3300006880 Ga0075429_100325751 Ga0075429_1003257512 127
142 3300009147 Ga0114129_10000487 Ga0114129_1000048747 127
143 3300050507 nmdc:mga05p37_26466_c1 nmdc:mga05p37_26466_c1_102_572 127
144 3300050507 nmdc:mga05p37_33395_c1 nmdc:mga05p37_33395_c1_1846_2319 127
145 3300050508 nmdc:mga09592_317112_c1 nmdc:mga09592_317112_c1_670_1140 127
146 3300050509 nmdc:mga0qj67_2619_c1 nmdc:mga0qj67_2619_c1_9281_9754 127
147 3300050510 nmdc:mga06r32_1949_c1 nmdc:mga06r32_1949_c1_6082_6555 127
148 3300050511 nmdc:mga08y16_1243848_c1 nmdc:mga08y16_1243848_c1_208_681 127
149 3300050515 nmdc:mga0a205_13385_c1 nmdc:mga0a205_13385_c1_4340_4810 127
150 3300005468 Ga0070707_100462389 Ga0070707_1004623891 128
151 3300005459 Ga0068867_100712771 Ga0068867_1007127712 129
152 3300005445 Ga0070708_100099177 Ga0070708_1000991772 131
153 3300005545 Ga0070695_100430462 Ga0070695_1004304622 131
154 3300025922 Ga0207646_10128194 Ga0207646_101281943 131
155 3300049584 Ga0501068_0247890 Ga0501068_0247890_347_832 131
156 3300060353 Ga0501082_0254231 Ga0501082_0254231_213_698 131
157 3300006847 Ga0075431_100186555 Ga0075431_1001865551 133
158 3300006871 Ga0075434_100375167 Ga0075434_1003751673 133
159 3300027682 Ga0209971_1012586 Ga0209971_10125863 133
160 3300049577 Ga0501041_0438042 Ga0501041_0438042_360_815 133
161 3300049741 Ga0501079_0328334 Ga0501079_0328334_606_1061 133
162 3300050510 nmdc:mga06r32_809521_c1 nmdc:mga06r32_809521_c1_31_486 133
163 3300050512 nmdc:mga0n895_201363_c1 nmdc:mga0n895_201363_c1_1157_1666 133
164 3300005518 Ga0070699_100055856 Ga0070699_1000558564 134
165 3300005719 Ga0068861_100961877 Ga0068861_1009618771 134
166 3300005844 Ga0068862_101144135 Ga0068862_1011441352 134
167 3300006844 Ga0075428_100158613 Ga0075428_1001586133 134
168 3300006846 Ga0075430_101541819 Ga0075430_1015418191 134
169 3300006847 Ga0075431_100603065 Ga0075431_1006030652 134
170 3300006852 Ga0075433_10069493 Ga0075433_100694932 134
171 3300006880 Ga0075429_100165513 Ga0075429_1001655132 134
172 3300009094 Ga0111539_10120862 Ga0111539_101208626 134
173 3300009147 Ga0114129_10048865 Ga0114129_100488658 134
174 3300013306 Ga0163162_10925042 Ga0163162_109250423 134
175 3300025899 Ga0207642_10258553 Ga0207642_102585532 134
176 3300025922 Ga0207646_10008198 Ga0207646_1000819813 134
177 3300026089 Ga0207648_10718980 Ga0207648_107189802 134
178 3300027907 Ga0207428_10016763 Ga0207428_100167632 134
179 3300028380 Ga0268265_10942172 Ga0268265_109421721 134
180 3300028381 Ga0268264_11878946 Ga0268264_118789462 134
181 3300049572 Ga0501036_0055576 Ga0501036_0055576_1540_1998 134
182 3300049576 Ga0501040_0101903 Ga0501040_0101903_424_882 134
183 3300049576 Ga0501040_0749135 Ga0501040_0749135_49_501 134
184 3300049577 Ga0501041_0087687 Ga0501041_0087687_837_1295 134
185 3300049578 Ga0501042_0248861 Ga0501042_0248861_252_710 134
186 3300049580 Ga0501046_0013103 Ga0501046_0013103_2089_2547 134
187 3300049580 Ga0501046_0356414 Ga0501046_0356414_174_626 134
188 3300049584 Ga0501068_0171913 Ga0501068_0171913_414_872 134
189 3300049586 Ga0501070_0628252 Ga0501070_0628252_96_554 134
190 3300049588 Ga0501072_0014153 Ga0501072_0014153_984_1442 134
191 3300049590 Ga0501074_0172992 Ga0501074_0172992_595_1053 134
192 3300049591 Ga0501075_0375029 Ga0501075_0375029_555_1007 134
193 3300049592 Ga0501076_0123009 Ga0501076_0123009_587_1045 134
194 3300049593 Ga0501077_0031014 Ga0501077_0031014_2430_2888 134
195 3300049741 Ga0501079_0021167 Ga0501079_0021167_4458_4916 134
196 3300049741 Ga0501079_0519808 Ga0501079_0519808_370_822 134
197 3300049741 Ga0501079_0629822 Ga0501079_0629822_56_508 134
198 3300049742 Ga0501080_0085286 Ga0501080_0085286_189_647 134
199 3300049743 Ga0501081_1014421 Ga0501081_1014421_28_480 134
200 3300049824 Ga0501045_0046088 Ga0501045_0046088_578_1036 134
201 3300050507 nmdc:mga05p37_36644_c1 nmdc:mga05p37_36644_c1_1794_2264 134
202 3300050508 nmdc:mga09592_26553_c1 nmdc:mga09592_26553_c1_2176_2646 134
203 3300050510 nmdc:mga06r32_766554_c1 nmdc:mga06r32_766554_c1_429_899 134
204 3300050511 nmdc:mga08y16_16604_c1 nmdc:mga08y16_16604_c1_4925_5395 134
205 3300050513 nmdc:mga0rr50_197336_c1 nmdc:mga0rr50_197336_c1_1023_1493 134
206 3300050515 nmdc:mga0a205_33438_c1 nmdc:mga0a205_33438_c1_3454_3924 134
207 3300054114 Ga0501084_0086478 Ga0501084_0086478_572_1030 134
208 3300054114 Ga0501084_1431078 Ga0501084_1431078_18_470 134
209 3300060353 Ga0501082_0174937 Ga0501082_0174937_924_1382 134
210 3300061734 Ga0530510_0009637 Ga0530510_0009637_2599_3057 134
211 3300061734 Ga0530510_0259442 Ga0530510_0259442_286_738 134
212 3300006846 Ga0075430_100478310 Ga0075430_1004783102 135
213 3300006847 Ga0075431_100152061 Ga0075431_1001520612 135
214 3300006852 Ga0075433_10274930 Ga0075433_102749303 135
215 3300006852 Ga0075433_10440654 Ga0075433_104406542 135
216 3300006880 Ga0075429_100156725 Ga0075429_1001567252 135
217 3300007076 Ga0075435_100098421 Ga0075435_1000984212 135
218 3300009147 Ga0114129_10011322 Ga0114129_100113225 135
219 3300009147 Ga0114129_10774336 Ga0114129_107743363 135
220 3300037471 Ga0395905_0332459 Ga0395905_0332459_556_1026 135
221 3300049742 Ga0501080_0469866 Ga0501080_0469866_288_758 135
222 3300049743 Ga0501081_0323905 Ga0501081_0323905_270_740 135
223 3300050507 nmdc:mga05p37_114074_c1 nmdc:mga05p37_114074_c1_2817_3284 135
224 3300050508 nmdc:mga09592_162708_c1 nmdc:mga09592_162708_c1_983_1450 135
225 3300050510 nmdc:mga06r32_33016_c1 nmdc:mga06r32_33016_c1_2731_3198 135
226 3300050515 nmdc:mga0a205_369772_c1 nmdc:mga0a205_369772_c1_109_618 135
227 3300050515 nmdc:mga0a205_72927_c1 nmdc:mga0a205_72927_c1_1646_2113 135
228 3300060353 Ga0501082_1692686 Ga0501082_1692686_27_497 135
229 3300005440 Ga0070705_101410541 Ga0070705_1014105411 136
230 3300005444 Ga0070694_100252021 Ga0070694_1002520213 136
231 3300005458 Ga0070681_10191129 Ga0070681_101911292 136
232 3300005545 Ga0070695_100402846 Ga0070695_1004028462 136
233 3300005549 Ga0070704_100384325 Ga0070704_1003843253 136
234 3300005617 Ga0068859_100946703 Ga0068859_1009467033 136
235 3300005843 Ga0068860_100132385 Ga0068860_1001323855 136
236 3300006844 Ga0075428_102291104 Ga0075428_1022911041 136
237 3300006846 Ga0075430_100032139 Ga0075430_1000321393 136
238 3300006846 Ga0075430_100254832 Ga0075430_1002548322 136
239 3300006847 Ga0075431_100003805 Ga0075431_10000380514 136
240 3300006847 Ga0075431_100006659 Ga0075431_10000665914 136
241 3300006847 Ga0075431_100040977 Ga0075431_1000409773 136
242 3300006852 Ga0075433_10361952 Ga0075433_103619522 136
243 3300006871 Ga0075434_100325157 Ga0075434_1003251573 136
244 3300006880 Ga0075429_100086149 Ga0075429_1000861494 136
245 3300006914 Ga0075436_100159107 Ga0075436_1001591072 136
246 3300006914 Ga0075436_100189025 Ga0075436_1001890252 136
247 3300006931 Ga0097620_100946679 Ga0097620_1009466793 136
248 3300007076 Ga0075435_100017186 Ga0075435_1000171869 136
249 3300007265 Ga0099794_10000935 Ga0099794_100009358 136
250 3300009147 Ga0114129_10120483 Ga0114129_101204833 136
251 3300009147 Ga0114129_10146583 Ga0114129_101465836 136
252 3300009147 Ga0114129_10806787 Ga0114129_108067873 136
253 3300009553 Ga0105249_10472407 Ga0105249_104724073 136
254 3300025912 Ga0207707_10086753 Ga0207707_100867532 136
255 3300025923 Ga0207681_11423037 Ga0207681_114230371 136
256 3300025932 Ga0207690_10240148 Ga0207690_102401482 136
257 3300027543 Ga0209999_1054433 Ga0209999_10544332 136
258 3300027671 Ga0209588_1012019 Ga0209588_10120193 136
259 3300027717 Ga0209998_10018118 Ga0209998_100181182 136
260 3300027876 Ga0209974_10021626 Ga0209974_100216263 136
261 3300027907 Ga0207428_10000095 Ga0207428_1000009521 136
262 3300028381 Ga0268264_10059910 Ga0268264_100599105 136
263 3300030732 Ga0316176_1179271 Ga0316176_11792711 136
264 3300031824 Ga0307413_10608477 Ga0307413_106084772 136
265 3300031995 Ga0307409_101908034 Ga0307409_1019080342 136
266 3300032002 Ga0307416_100034743 Ga0307416_1000347437 136
267 3300032002 Ga0307416_100512337 Ga0307416_1005123373 136
268 3300032002 Ga0307416_102645402 Ga0307416_1026454021 136
269 3300032004 Ga0307414_10774148 Ga0307414_107741481 136
270 3300032005 Ga0307411_10330784 Ga0307411_103307843 136
271 3300034817 Ga0373948_0020178 Ga0373948_0020178_252_725 136
272 3300035114 Ga0373939_0116760 Ga0373939_0116760_345_818 136
273 3300035115 Ga0373941_0018781 Ga0373941_0018781_792_1265 136
274 3300035121 Ga0373960_0133250 Ga0373960_0133250_151_624 136
275 3300035207 Ga0373942_0033117 Ga0373942_0033117_782_1255 136
276 3300038996 Ga0242420_025085 Ga0242420_025085_507_974 136
277 3300042876 Ga0451577_0234366 Ga0451577_0234366_420_893 136
278 3300044712 Ga0453684_0179339 Ga0453684_0179339_754_1227 136
279 3300048905 Ga0496102_0008904 Ga0496102_0008904_4911_5384 136
280 3300048906 Ga0496103_0318406 Ga0496103_0318406_270_743 136
281 3300048909 Ga0496106_0397567 Ga0496106_0397567_138_611 136
282 3300048910 Ga0496107_0179736 Ga0496107_0179736_724_1197 136
283 3300048913 Ga0496110_0871450 Ga0496110_0871450_127_600 136
284 3300049570 Ga0501033_0027390 Ga0501033_0027390_3098_3565 136
285 3300049572 Ga0501036_0221715 Ga0501036_0221715_462_929 136
286 3300049574 Ga0501038_0121814 Ga0501038_0121814_634_1101 136
287 3300049575 Ga0501039_0154954 Ga0501039_0154954_648_1115 136
288 3300049575 Ga0501039_0533294 Ga0501039_0533294_270_737 136
289 3300049575 Ga0501039_0615676 Ga0501039_0615676_70_543 136
290 3300049576 Ga0501040_0052828 Ga0501040_0052828_1770_2237 136
291 3300049576 Ga0501040_0277400 Ga0501040_0277400_518_985 136
292 3300049577 Ga0501041_0051905 Ga0501041_0051905_1986_2453 136
293 3300049578 Ga0501042_0102670 Ga0501042_0102670_510_977 136
294 3300049578 Ga0501042_0398748 Ga0501042_0398748_69_536 136
295 3300049578 Ga0501042_1069286 Ga0501042_1069286_91_558 136
296 3300049580 Ga0501046_0028564 Ga0501046_0028564_1625_2092 136
297 3300049580 Ga0501046_0230920 Ga0501046_0230920_290_757 136
298 3300049582 Ga0501048_0388135 Ga0501048_0388135_211_678 136
299 3300049582 Ga0501048_1089770 Ga0501048_1089770_45_500 136
300 3300049583 Ga0501067_0010535 Ga0501067_0010535_840_1307 136
301 3300049584 Ga0501068_0207647 Ga0501068_0207647_696_1163 136
302 3300049585 Ga0501069_0104030 Ga0501069_0104030_280_747 136
303 3300049587 Ga0501071_0065940 Ga0501071_0065940_1376_1843 136
304 3300049587 Ga0501071_0082743 Ga0501071_0082743_1681_2154 136
305 3300049588 Ga0501072_0022481 Ga0501072_0022481_1762_2235 136
306 3300049588 Ga0501072_0042061 Ga0501072_0042061_2917_3384 136
307 3300049588 Ga0501072_0236044 Ga0501072_0236044_316_783 136
308 3300049590 Ga0501074_0104281 Ga0501074_0104281_837_1304 136
309 3300049590 Ga0501074_0266229 Ga0501074_0266229_408_881 136
310 3300049591 Ga0501075_0012463 Ga0501075_0012463_1195_1662 136
311 3300049591 Ga0501075_0389270 Ga0501075_0389270_296_763 136
312 3300049592 Ga0501076_0002232 Ga0501076_0002232_3257_3724 136
313 3300049592 Ga0501076_0317244 Ga0501076_0317244_501_974 136
314 3300049592 Ga0501076_0578218 Ga0501076_0578218_46_513 136
315 3300049592 Ga0501076_1356682 Ga0501076_1356682_27_500 136
316 3300049593 Ga0501077_0002533 Ga0501077_0002533_10068_10535 136
317 3300049593 Ga0501077_0447142 Ga0501077_0447142_317_790 136
318 3300049741 Ga0501079_0011359 Ga0501079_0011359_4061_4528 136
319 3300049741 Ga0501079_0013353 Ga0501079_0013353_3031_3498 136
320 3300049741 Ga0501079_0228972 Ga0501079_0228972_341_814 136
321 3300049741 Ga0501079_0331337 Ga0501079_0331337_162_629 136
322 3300049741 Ga0501079_1157019 Ga0501079_1157019_57_524 136
323 3300049741 Ga0501079_1432270 Ga0501079_1432270_36_509 136
324 3300049742 Ga0501080_0401667 Ga0501080_0401667_97_570 136
325 3300049742 Ga0501080_0426912 Ga0501080_0426912_531_998 136
326 3300049742 Ga0501080_0545266 Ga0501080_0545266_30_497 136
327 3300049743 Ga0501081_0009283 Ga0501081_0009283_2928_3395 136
328 3300049743 Ga0501081_0331063 Ga0501081_0331063_505_972 136
329 3300049743 Ga0501081_1037922 Ga0501081_1037922_65_535 136
330 3300049743 Ga0501081_1406161 Ga0501081_1406161_37_504 136
331 3300049779 Ga0501283_055511 Ga0501283_055511_115_582 136
332 3300049824 Ga0501045_0836171 Ga0501045_0836171_200_667 136
333 3300050507 nmdc:mga05p37_115601_c2 nmdc:mga05p37_115601_c2_433_900 136
334 3300050507 nmdc:mga05p37_269042_c2 nmdc:mga05p37_269042_c2_207_674 136
335 3300050507 nmdc:mga05p37_43525_c1 nmdc:mga05p37_43525_c1_4859_5326 136
336 3300050508 nmdc:mga09592_382858_c1 nmdc:mga09592_382858_c1_395_862 136
337 3300050508 nmdc:mga09592_82111_c1 nmdc:mga09592_82111_c1_1125_1592 136
338 3300050509 nmdc:mga0qj67_13056_c1 nmdc:mga0qj67_13056_c1_2273_2740 136
339 3300050509 nmdc:mga0qj67_5121_c1 nmdc:mga0qj67_5121_c1_6803_7270 136
340 3300050509 nmdc:mga0qj67_77970_c1 nmdc:mga0qj67_77970_c1_702_1169 136
341 3300050510 nmdc:mga06r32_1401_c1 nmdc:mga06r32_1401_c1_634_1101 136
342 3300050510 nmdc:mga06r32_337317_c1 nmdc:mga06r32_337317_c1_694_1167 136
343 3300050510 nmdc:mga06r32_382706_c1 nmdc:mga06r32_382706_c1_183_650 136
344 3300050511 nmdc:mga08y16_716_c1 nmdc:mga08y16_716_c1_29572_30039 136
345 3300050512 nmdc:mga0n895_117793_c1 nmdc:mga0n895_117793_c1_656_1126 136
346 3300050513 nmdc:mga0rr50_27519_c1 nmdc:mga0rr50_27519_c1_2198_2668 136
347 3300050514 nmdc:mga08x19_129171_c1 nmdc:mga08x19_129171_c1_243_713 136
348 3300050515 nmdc:mga0a205_226823_c1 nmdc:mga0a205_226823_c1_1026_1496 136
349 3300050515 nmdc:mga0a205_265161_c1 nmdc:mga0a205_265161_c1_297_764 136
350 3300054114 Ga0501084_0006689 Ga0501084_0006689_3173_3640 136
351 3300054114 Ga0501084_0035131 Ga0501084_0035131_432_899 136
352 3300054114 Ga0501084_0225836 Ga0501084_0225836_378_851 136
353 3300060353 Ga0501082_0017314 Ga0501082_0017314_5563_6030 136
354 3300060353 Ga0501082_0023005 Ga0501082_0023005_4719_5186 136
355 3300060353 Ga0501082_0215355 Ga0501082_0215355_609_1082 136
356 3300060353 Ga0501082_0317692 Ga0501082_0317692_877_1344 136
357 3300061734 Ga0530510_0003221 Ga0530510_0003221_7008_7475 136
358 3300061734 Ga0530510_0031810 Ga0530510_0031810_86_553 136
359 3300061734 Ga0530510_0130886 Ga0530510_0130886_717_1184 136
360 3300061734 Ga0530510_0519776 Ga0530510_0519776_71_544 136
361 3300061734 Ga0530510_0617048 Ga0530510_0617048_208_681 136
362 3300009094 Ga0111539_10325378 Ga0111539_103253781 139
363 3300042436 Ga0439435_0007189 Ga0439435_0007189_1877_2335 139
364 3300049570 Ga0501033_0089636 Ga0501033_0089636_933_1388 139
365 3300049572 Ga0501036_0000860 Ga0501036_0000860_365_820 139
366 3300049574 Ga0501038_0021614 Ga0501038_0021614_3514_3969 139
367 3300049574 Ga0501038_0426119 Ga0501038_0426119_70_525 139
368 3300049575 Ga0501039_0023281 Ga0501039_0023281_1633_2088 139
369 3300049575 Ga0501039_0048875 Ga0501039_0048875_987_1442 139
370 3300049576 Ga0501040_0022910 Ga0501040_0022910_119_574 139
371 3300049577 Ga0501041_0009982 Ga0501041_0009982_3735_4190 139
372 3300049577 Ga0501041_0031216 Ga0501041_0031216_443_898 139
373 3300049578 Ga0501042_0491959 Ga0501042_0491959_165_620 139
374 3300049578 Ga0501042_1267020 Ga0501042_1267020_59_514 139
375 3300049580 Ga0501046_0026439 Ga0501046_0026439_3714_4169 139
376 3300049580 Ga0501046_0582621 Ga0501046_0582621_255_710 139
377 3300049582 Ga0501048_0014949 Ga0501048_0014949_2991_3446 139
378 3300049582 Ga0501048_0532890 Ga0501048_0532890_116_571 139
379 3300049587 Ga0501071_0017192 Ga0501071_0017192_426_881 139
380 3300049587 Ga0501071_0059859 Ga0501071_0059859_1402_1857 139
381 3300049588 Ga0501072_0005776 Ga0501072_0005776_5512_5967 139
382 3300049589 Ga0501073_0197342 Ga0501073_0197342_724_1179 139
383 3300049590 Ga0501074_0156141 Ga0501074_0156141_583_1038 139
384 3300049591 Ga0501075_0001033 Ga0501075_0001033_8103_8558 139
385 3300049591 Ga0501075_0072029 Ga0501075_0072029_1606_2061 139
386 3300049592 Ga0501076_0000979 Ga0501076_0000979_7978_8433 139
387 3300049592 Ga0501076_0028793 Ga0501076_0028793_3662_4117 139
388 3300049592 Ga0501076_0927197 Ga0501076_0927197_238_696 139
389 3300049593 Ga0501077_0123476 Ga0501077_0123476_424_879 139
390 3300049593 Ga0501077_0195668 Ga0501077_0195668_681_1136 139
391 3300049741 Ga0501079_0006844 Ga0501079_0006844_6108_6563 139
392 3300049741 Ga0501079_0019976 Ga0501079_0019976_942_1397 139
393 3300049742 Ga0501080_0023877 Ga0501080_0023877_320_775 139
394 3300049743 Ga0501081_0002378 Ga0501081_0002378_8422_8877 139
395 3300049743 Ga0501081_0012727 Ga0501081_0012727_4078_4533 139
396 3300049744 Ga0501083_0026008 Ga0501083_0026008_1833_2288 139
397 3300049822 Ga0501035_0051228 Ga0501035_0051228_1765_2220 139
398 3300049824 Ga0501045_0005837 Ga0501045_0005837_1429_1884 139
399 3300049824 Ga0501045_0008044 Ga0501045_0008044_6419_6874 139
400 3300054114 Ga0501084_0004051 Ga0501084_0004051_7878_8333 139
401 3300054114 Ga0501084_0065675 Ga0501084_0065675_2269_2724 139
402 3300060353 Ga0501082_0002099 Ga0501082_0002099_11564_12019 139
403 3300061734 Ga0530510_0001293 Ga0530510_0001293_9199_9654 139
404 3300005343 Ga0070687_100626859 Ga0070687_1006268591 140
405 3300005353 Ga0070669_101602081 Ga0070669_1016020811 140
406 3300005365 Ga0070688_100563535 Ga0070688_1005635351 140
407 3300005440 Ga0070705_100031127 Ga0070705_1000311276 140
408 3300005440 Ga0070705_101761084 Ga0070705_1017610841 140
409 3300005441 Ga0070700_100143780 Ga0070700_1001437802 140
410 3300005457 Ga0070662_100052208 Ga0070662_1000522083 140
411 3300005459 Ga0068867_100763424 Ga0068867_1007634242 140
412 3300005466 Ga0070685_10136936 Ga0070685_101369362 140
413 3300005544 Ga0070686_100035635 Ga0070686_1000356356 140
414 3300005545 Ga0070695_100644766 Ga0070695_1006447662 140
415 3300005547 Ga0070693_100855866 Ga0070693_1008558662 140
416 3300005615 Ga0070702_100377255 Ga0070702_1003772552 140
417 3300005618 Ga0068864_100621770 Ga0068864_1006217701 140
418 3300005844 Ga0068862_100140666 Ga0068862_1001406662 140
419 3300006058 Ga0075432_10147336 Ga0075432_101473363 140
420 3300006852 Ga0075433_10657633 Ga0075433_106576332 140
421 3300009147 Ga0114129_10001150 Ga0114129_1000115040 140
422 3300009553 Ga0105249_10657084 Ga0105249_106570843 140
423 3300013306 Ga0163162_11139509 Ga0163162_111395092 140
424 3300025918 Ga0207662_10010786 Ga0207662_100107864 140
425 3300025933 Ga0207706_10151544 Ga0207706_101515443 140
426 3300025961 Ga0207712_10370824 Ga0207712_103708242 140
427 3300026075 Ga0207708_10014559 Ga0207708_100145593 140
428 3300026095 Ga0207676_10690636 Ga0207676_106906362 140
429 3300026118 Ga0207675_100511218 Ga0207675_1005112182 140
430 3300028380 Ga0268265_10590498 Ga0268265_105904981 140
431 3300049568 Ga0501031_0032401 Ga0501031_0032401_980_1438 140
432 3300049569 Ga0501032_0112128 Ga0501032_0112128_62_520 140
433 3300049570 Ga0501033_0023237 Ga0501033_0023237_280_738 140
434 3300049572 Ga0501036_0002708 Ga0501036_0002708_9776_10234 140
435 3300049573 Ga0501037_0128224 Ga0501037_0128224_631_1089 140
436 3300049573 Ga0501037_0201186 Ga0501037_0201186_655_1113 140
437 3300049574 Ga0501038_0001811 Ga0501038_0001811_7702_8160 140
438 3300049575 Ga0501039_0001335 Ga0501039_0001335_9147_9605 140
439 3300049575 Ga0501039_0605323 Ga0501039_0605323_289_747 140
440 3300049576 Ga0501040_0011405 Ga0501040_0011405_3804_4262 140
441 3300049577 Ga0501041_0002087 Ga0501041_0002087_9220_9678 140
442 3300049578 Ga0501042_0000948 Ga0501042_0000948_5789_6247 140
443 3300049579 Ga0501043_0015166 Ga0501043_0015166_3866_4324 140
444 3300049580 Ga0501046_0005447 Ga0501046_0005447_9249_9707 140
445 3300049582 Ga0501048_0003958 Ga0501048_0003958_1564_2022 140
446 3300049584 Ga0501068_0008573 Ga0501068_0008573_3005_3463 140
447 3300049585 Ga0501069_0063926 Ga0501069_0063926_1517_1975 140
448 3300049587 Ga0501071_0000849 Ga0501071_0000849_6425_6883 140
449 3300049587 Ga0501071_0309922 Ga0501071_0309922_392_850 140
450 3300049588 Ga0501072_0003324 Ga0501072_0003324_2409_2867 140
451 3300049590 Ga0501074_0003006 Ga0501074_0003006_3380_3838 140
452 3300049591 Ga0501075_0001990 Ga0501075_0001990_9212_9670 140
453 3300049591 Ga0501075_1226865 Ga0501075_1226865_79_537 140
454 3300049592 Ga0501076_0004384 Ga0501076_0004384_313_771 140
455 3300049593 Ga0501077_0007258 Ga0501077_0007258_1436_1894 140
456 3300049593 Ga0501077_0098253 Ga0501077_0098253_334_792 140
457 3300049741 Ga0501079_0001475 Ga0501079_0001475_6634_7092 140
458 3300049742 Ga0501080_0069446 Ga0501080_0069446_312_770 140
459 3300049742 Ga0501080_1093054 Ga0501080_1093054_124_582 140
460 3300049743 Ga0501081_0001239 Ga0501081_0001239_5847_6305 140
461 3300049744 Ga0501083_0016891 Ga0501083_0016891_3998_4456 140
462 3300049822 Ga0501035_0029667 Ga0501035_0029667_2324_2782 140
463 3300049824 Ga0501045_0000682 Ga0501045_0000682_11821_12279 140
464 3300050507 nmdc:mga05p37_3121_c1 nmdc:mga05p37_3121_c1_9034_9492 140
465 3300050512 nmdc:mga0n895_474931_c1 nmdc:mga0n895_474931_c1_324_782 140
466 3300050515 nmdc:mga0a205_224039_c1 nmdc:mga0a205_224039_c1_563_1021 140
467 3300054114 Ga0501084_0000677 Ga0501084_0000677_15178_15636 140
468 3300054114 Ga0501084_0355356 Ga0501084_0355356_664_1122 140
469 3300054114 Ga0501084_0355891 Ga0501084_0355891_118_576 140
470 3300060353 Ga0501082_0002693 Ga0501082_0002693_11802_12260 140
471 3300060353 Ga0501082_0301222 Ga0501082_0301222_47_505 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

21

141

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8942 114 137
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.839 58 138
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8387 60 136
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8221 62 135
8p5d-assembly1.cif.gz_LQ0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.8049 64 138
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9237 64 135 3.100.10.10
af_P9WIY5_101_213_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9122 112 138 3.40.1350.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9099 63 136 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8992 54 138 3.100.10.10
1p90A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Dinitrogenase iron-molybdenum cofactor biosynthesis domain 0.8942 114 137 3.30.420.130
ID Description Score Start End GO Terms
AF-A0A0S2I9B7-F1-model_v4 50S ribosomal protein L15 0.9463 62 140 GO:0005840
GO:1990904
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.9427 55 138 GO:0003735
GO:0006412
GO:0022625
AF-A0A432EFN8-F1-model_v4 50S ribosomal protein L15 0.9385 63 139 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0MKD2-F1-model_v4 50S ribosomal protein L15 0.9363 56 140 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.9315 55 138 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
74.08 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map