F450525

General Info

Members Datasets Scaffolds Average Seq Length
471 297 942 106

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10672102|Ga0065704_106721022
Length 107
Sequence MAFNTRIRVPATAKAGEIVEIRAMIMHPMENGFRVDTQGTAIPVDIITDFVCSYDAAEIFRVRLEPGLAANPYFSFFLKATRSGVVEFAWTAQDESVTTASAPIEVT

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 0
Rhizoplane 1.27
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 9.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10672102 3300005289 Bacteria 573
2 JGI24735J21928_10116721 3300002067 Bacteria 768
3 rootH2_10065933 3300003320 Bacteria 1206
4 JGI25405J52794_10025960 3300003911 Bacteria 1202
5 Ga0065712_10438518 3300005290 Unclassified 692
6 Ga0065712_10731310 3300005290 Bacteria 505
7 Ga0065707_10089256 3300005295 Unclassified 4424
8 Ga0070658_10178017 3300005327 Bacteria 1789
9 Ga0070676_10447151 3300005328 Bacteria 908
10 Ga0070676_11381030 3300005328 Unclassified 540
11 Ga0070683_100147277 3300005329 Bacteria 2231
12 Ga0070690_100367343 3300005330 Bacteria 1049
13 Ga0070690_101368880 3300005330 Bacteria 569
14 Ga0070670_101153947 3300005331 Bacteria 707
15 Ga0068869_100550756 3300005334 Bacteria 969
16 Ga0070666_11064583 3300005335 Bacteria 601
17 Ga0070680_100881608 3300005336 Bacteria 772
18 Ga0070682_100498865 3300005337 Bacteria 943
19 Ga0068868_100898478 3300005338 Bacteria 805
20 Ga0070660_100258750 3300005339 Bacteria 1421
21 Ga0070689_100045420 3300005340 Bacteria 3383
22 Ga0070691_10431609 3300005341 Bacteria 749
23 Ga0070691_10560089 3300005341 Bacteria 669
24 Ga0070661_100040811 3300005344 Bacteria 3386
25 Ga0070692_10776772 3300005345 Bacteria 652
26 Ga0070668_100988811 3300005347 Bacteria 756
27 Ga0070669_100135312 3300005353 Bacteria 1895
28 Ga0070675_100324657 3300005354 Bacteria 1360
29 Ga0070675_100623610 3300005354 Bacteria 979
30 Ga0070675_102137076 3300005354 Bacteria 516
31 Ga0070674_100082895 3300005356 Bacteria 2295
32 Ga0070674_100194753 3300005356 Bacteria 1561
33 Ga0070673_100299210 3300005364 Bacteria 1416
34 Ga0070673_100384060 3300005364 Bacteria 1252
35 Ga0070673_100844235 3300005364 Bacteria 847
36 Ga0070673_101642553 3300005364 Bacteria 608
37 Ga0070673_101707272 3300005364 Bacteria 596
38 Ga0070688_100063109 3300005365 Bacteria 2347
39 Ga0070659_100087624 3300005366 Bacteria 2493
40 Ga0070667_101478643 3300005367 Bacteria 638
41 Ga0070713_100022074 3300005436 Bacteria 4912
42 Ga0070701_10036935 3300005438 Bacteria 2464
43 Ga0070700_101220382 3300005441 Unclassified 629
44 Ga0070663_100402053 3300005455 Bacteria 1120
45 Ga0070678_100066115 3300005456 Bacteria 2687
46 Ga0070681_10180925 3300005458 Bacteria 2030
47 Ga0070681_10449197 3300005458 Bacteria 1201
48 Ga0070706_100146663 3300005467 Bacteria 2204
49 Ga0070706_101903045 3300005467 Unclassified 540
50 Ga0070707_101962645 3300005468 Bacteria 553
51 Ga0070698_101758366 3300005471 Bacteria 573
52 Ga0070699_100816070 3300005518 Bacteria 854
53 Ga0070684_100016233 3300005535 Bacteria 6082
54 Ga0068853_100368441 3300005539 Bacteria 1340
55 Ga0068853_101637919 3300005539 Bacteria 624
56 Ga0070672_100043125 3300005543 Bacteria 3476
57 Ga0070672_100982013 3300005543 Bacteria 748
58 Ga0070686_101123660 3300005544 Bacteria 650
59 Ga0070686_101934791 3300005544 Unclassified 504
60 Ga0070693_100001438 3300005547 Bacteria 10728
61 Ga0070665_100002100 3300005548 Bacteria 22317
62 Ga0070665_100021601 3300005548 Bacteria 6471
63 Ga0070665_100113221 3300005548 Bacteria 2716
64 Ga0070665_100616471 3300005548 Bacteria 1098
65 Ga0070704_101983606 3300005549 Bacteria 540
66 Ga0068855_100137251 3300005563 Bacteria 2789
67 Ga0068855_100196051 3300005563 Bacteria 2275
68 Ga0070664_100021220 3300005564 Bacteria 5351
69 Ga0068857_100554692 3300005577 Bacteria 1083
70 Ga0068854_102065505 3300005578 Bacteria 526
71 Ga0068856_100076314 3300005614 Bacteria 3320
72 Ga0070702_100398451 3300005615 Bacteria 984
73 Ga0068852_100038038 3300005616 Bacteria 4040
74 Ga0068859_100254967 3300005617 Bacteria 1845
75 Ga0068859_100659696 3300005617 Bacteria 1138
76 Ga0068859_100691275 3300005617 Unclassified 1111
77 Ga0068864_100429455 3300005618 Bacteria 1260
78 Ga0068866_11302346 3300005718 Bacteria 528
79 Ga0068851_10826020 3300005834 Bacteria 577
80 Ga0068863_100575814 3300005841 Bacteria 1113
81 Ga0068858_100026227 3300005842 Bacteria 5417
82 Ga0068858_100251115 3300005842 Bacteria 1680
83 Ga0068858_101800726 3300005842 Bacteria 605
84 Ga0068860_100380718 3300005843 Bacteria 1393
85 Ga0068860_100538624 3300005843 Bacteria 1169
86 Ga0068860_100841920 3300005843 Bacteria 932
87 Ga0068862_100173039 3300005844 Bacteria 1934
88 Ga0081455_10002752 3300005937 Bacteria 20745
89 Ga0081455_10012872 3300005937 Bacteria 8305
90 Ga0081455_10525039 3300005937 Bacteria 789
91 Ga0081540_1129828 3300005983 Bacteria 1031
92 Ga0081539_10002706 3300005985 Bacteria 24048
93 Ga0081539_10005262 3300005985 Bacteria 13347
94 Ga0081539_10101871 3300005985 Bacteria 1462
95 Ga0075365_10038212 3300006038 Bacteria 3119
96 Ga0075365_10057933 3300006038 Bacteria 2578
97 Ga0075365_10098959 3300006038 Bacteria 1995
98 Ga0075365_10154226 3300006038 Bacteria 1598
99 Ga0075365_10265018 3300006038 Bacteria 1208
100 Ga0075365_10643164 3300006038 Bacteria 750
101 Ga0075365_10740041 3300006038 Bacteria 694
102 Ga0075368_10026549 3300006042 Bacteria 2228
103 Ga0075368_10136682 3300006042 Bacteria 1020
104 Ga0075363_100637017 3300006048 Bacteria 641
105 Ga0075363_100834846 3300006048 Unclassified 562
106 Ga0075364_10039056 3300006051 Bacteria 3076
107 Ga0075364_10069778 3300006051 Bacteria 2313
108 Ga0075364_10163588 3300006051 Bacteria 1503
109 Ga0075364_10746583 3300006051 Bacteria 668
110 Ga0070715_10172354 3300006163 Bacteria 1079
111 Ga0070716_101380727 3300006173 Bacteria 572
112 Ga0075362_10002810 3300006177 Bacteria 5939
113 Ga0075362_10006141 3300006177 Bacteria 4455
114 Ga0075362_10047945 3300006177 Bacteria 1904
115 Ga0075362_10167068 3300006177 Bacteria 1061
116 Ga0075362_10189125 3300006177 Bacteria 999
117 Ga0075362_10742627 3300006177 Bacteria 514
118 Ga0075367_10044810 3300006178 Bacteria 2594
119 Ga0075367_10162062 3300006178 Bacteria 1391
120 Ga0075369_10001108 3300006186 Bacteria 9048
121 Ga0075369_10003883 3300006186 Bacteria 5480
122 Ga0075369_10294653 3300006186 Bacteria 757
123 Ga0075366_10009792 3300006195 Bacteria 5358
124 Ga0075366_10107781 3300006195 Bacteria 1675
125 Ga0075366_10139782 3300006195 Bacteria 1464
126 Ga0097621_100065349 3300006237 Bacteria 2994
127 Ga0097621_100130176 3300006237 Bacteria 2141
128 Ga0097621_100456700 3300006237 Bacteria 1151
129 Ga0097621_100911987 3300006237 Bacteria 819
130 Ga0075370_10209458 3300006353 Bacteria 1151
131 Ga0075370_10307293 3300006353 Bacteria 944
132 Ga0068871_100016022 3300006358 Bacteria 5632
133 Ga0068871_100042618 3300006358 Bacteria 3645
134 Ga0068871_100380464 3300006358 Bacteria 1254
135 Ga0075428_100553433 3300006844 Bacteria 1230
136 Ga0068865_100109185 3300006881 Unclassified 2038
137 Ga0068865_101481298 3300006881 Bacteria 608
138 Ga0075436_101092913 3300006914 Bacteria 600
139 Ga0097620_100254988 3300006931 Bacteria 1845
140 Ga0097620_100659780 3300006931 Bacteria 1138
141 Ga0097620_100691283 3300006931 Unclassified 1111
142 Ga0099794_10042877 3300007265 Bacteria 2158
143 Ga0099795_10355758 3300007788 Bacteria 656
144 Ga0099795_10430985 3300007788 Bacteria 604
145 Ga0105240_11766262 3300009093 Bacteria 645
146 Ga0111539_10205043 3300009094 Bacteria 2298
147 Ga0111539_11552426 3300009094 Bacteria 768
148 Ga0105245_10013484 3300009098 Bacteria 7118
149 Ga0105245_10275843 3300009098 Bacteria 1642
150 Ga0105245_11721513 3300009098 Bacteria 679
151 Ga0105245_11881747 3300009098 Bacteria 651
152 Ga0105247_11596522 3300009101 Bacteria 535
153 Ga0105243_10459338 3300009148 Bacteria 1197
154 Ga0105243_12165002 3300009148 Bacteria 592
155 Ga0105243_13067254 3300009148 Bacteria 506
156 Ga0105241_10180370 3300009174 Bacteria 1751
157 Ga0105242_10034009 3300009176 Bacteria 4085
158 Ga0105242_10129551 3300009176 Bacteria 2175
159 Ga0105242_11057561 3300009176 Unclassified 823
160 Ga0105248_10011479 3300009177 Bacteria 9760
161 Ga0105248_10058661 3300009177 Bacteria 4323
162 Ga0105248_11577696 3300009177 Bacteria 743
163 Ga0105248_11866575 3300009177 Bacteria 682
164 Ga0105248_12072038 3300009177 Unclassified 647
165 Ga0105237_10000647 3300009545 Bacteria 48519
166 Ga0105237_10246422 3300009545 Bacteria 1788
167 Ga0105237_10711316 3300009545 Bacteria 1011
168 Ga0105238_10047370 3300009551 Bacteria 4335
169 Ga0105238_10354417 3300009551 Unclassified 1456
170 Ga0105249_12364214 3300009553 Bacteria 604
171 Ga0105029_113131 3300009984 Bacteria 649
172 Ga0099796_10000478 3300010159 Bacteria 6759
173 Ga0099796_10201818 3300010159 Bacteria 807
174 Ga0105239_10000238 3300010375 Bacteria 81412
175 Ga0105239_10065390 3300010375 Bacteria 3994
176 Ga0157371_10305197 3300013102 Bacteria 1153
177 Ga0157369_10064867 3300013105 Bacteria 3932
178 Ga0157374_10439800 3300013296 Bacteria 1304
179 Ga0157374_12683434 3300013296 Bacteria 526
180 Ga0157378_10106129 3300013297 Unclassified 2569
181 Ga0157378_11966910 3300013297 Bacteria 634
182 Ga0163162_10149043 3300013306 Bacteria 2456
183 Ga0163162_11441084 3300013306 Bacteria 784
184 Ga0157372_10077052 3300013307 Bacteria 3765
185 Ga0157372_13223605 3300013307 Unclassified 520
186 Ga0157375_10466816 3300013308 Bacteria 1428
187 Ga0163163_13240352 3300014325 Bacteria 507
188 Ga0157380_13491557 3300014326 Bacteria 503
189 Ga0157379_10421437 3300014968 Unclassified 1229
190 Ga0157379_11408915 3300014968 Bacteria 676
191 Ga0157379_11879704 3300014968 Bacteria 590
192 Ga0157376_10215609 3300014969 Bacteria 1775
193 Ga0157376_10309033 3300014969 Bacteria 1499
194 Ga0157376_11262881 3300014969 Bacteria 768
195 Ga0157376_12114009 3300014969 Bacteria 601
196 Ga0213872_10164293 3300021361 Bacteria 965
197 Ga0213871_10002248 3300021441 Bacteria 3517
198 Ga0207426_1011774 3300025302 Bacteria 3312
199 Ga0207426_1032286 3300025302 Bacteria 1699
200 Ga0207710_10517857 3300025900 Bacteria 620
201 Ga0207688_10055872 3300025901 Bacteria 2217
202 Ga0207680_10175229 3300025903 Bacteria 1447
203 Ga0207647_10066429 3300025904 Bacteria 2187
204 Ga0207645_10248647 3300025907 Bacteria 1176
205 Ga0207684_10651603 3300025910 Bacteria 897
206 Ga0207654_10236391 3300025911 Bacteria 1219
207 Ga0207707_10113672 3300025912 Bacteria 2366
208 Ga0207707_10862359 3300025912 Unclassified 751
209 Ga0207695_10306458 3300025913 Bacteria 1479
210 Ga0207671_10000098 3300025914 Bacteria 133010
211 Ga0207663_10844056 3300025916 Bacteria 731
212 Ga0207660_10816561 3300025917 Bacteria 761
213 Ga0207657_10298428 3300025919 Bacteria 1276
214 Ga0207657_10606964 3300025919 Bacteria 853
215 Ga0207649_10015573 3300025920 Bacteria 4271
216 Ga0207646_10324810 3300025922 Bacteria 1390
217 Ga0207646_11165008 3300025922 Bacteria 677
218 Ga0207681_10325575 3300025923 Bacteria 1223
219 Ga0207694_10187513 3300025924 Bacteria 1679
220 Ga0207694_10368602 3300025924 Bacteria 1191
221 Ga0207650_11173515 3300025925 Bacteria 654
222 Ga0207659_10665482 3300025926 Bacteria 890
223 Ga0207687_10556753 3300025927 Unclassified 963
224 Ga0207687_10660473 3300025927 Unclassified 885
225 Ga0207687_11073463 3300025927 Bacteria 691
226 Ga0207700_11020110 3300025928 Bacteria 740
227 Ga0207664_10725095 3300025929 Bacteria 894
228 Ga0207644_10429479 3300025931 Bacteria 1083
229 Ga0207690_10497964 3300025932 Bacteria 985
230 Ga0207686_10104021 3300025934 Bacteria 1901
231 Ga0207709_11375490 3300025935 Bacteria 584
232 Ga0207709_11642057 3300025935 Bacteria 534
233 Ga0207709_11763815 3300025935 Bacteria 515
234 Ga0207670_10002294 3300025936 Bacteria 10024
235 Ga0207670_10914333 3300025936 Bacteria 735
236 Ga0207670_10955981 3300025936 Bacteria 719
237 Ga0207669_10057303 3300025937 Bacteria 2371
238 Ga0207669_10153355 3300025937 Bacteria 1617
239 Ga0207669_10559517 3300025937 Bacteria 924
240 Ga0207704_10168093 3300025938 Unclassified 1569
241 Ga0207704_10945964 3300025938 Bacteria 726
242 Ga0207665_11020504 3300025939 Bacteria 658
243 Ga0207691_10311959 3300025940 Bacteria 1350
244 Ga0207691_10437487 3300025940 Bacteria 1114
245 Ga0207691_10774426 3300025940 Bacteria 807
246 Ga0207711_10227108 3300025941 Bacteria 1709
247 Ga0207711_10833622 3300025941 Bacteria 858
248 Ga0207689_10093777 3300025942 Bacteria 2466
249 Ga0207689_10215854 3300025942 Unclassified 1585
250 Ga0207661_10195073 3300025944 Bacteria 1777
251 Ga0207679_10174868 3300025945 Bacteria 1771
252 Ga0207667_10102446 3300025949 Bacteria 2953
253 Ga0207667_11867555 3300025949 Bacteria 563
254 Ga0207651_10457308 3300025960 Bacteria 1096
255 Ga0207651_10515982 3300025960 Bacteria 1035
256 Ga0207651_10690218 3300025960 Unclassified 899
257 Ga0207651_10763063 3300025960 Bacteria 855
258 Ga0207651_11568471 3300025960 Bacteria 593
259 Ga0207712_11246435 3300025961 Bacteria 664
260 Ga0207668_10434801 3300025972 Bacteria 1117
261 Ga0207658_11847810 3300025986 Bacteria 551
262 Ga0207677_10117080 3300026023 Bacteria 1996
263 Ga0207703_10060462 3300026035 Bacteria 3098
264 Ga0207703_10514973 3300026035 Bacteria 1124
265 Ga0207703_10726118 3300026035 Bacteria 946
266 Ga0207703_11338275 3300026035 Bacteria 689
267 Ga0207703_11604268 3300026035 Bacteria 626
268 Ga0207639_10297971 3300026041 Bacteria 1424
269 Ga0207708_10507316 3300026075 Bacteria 1012
270 Ga0207708_10647557 3300026075 Bacteria 899
271 Ga0207702_10556713 3300026078 Bacteria 1122
272 Ga0207641_10370836 3300026088 Bacteria 1369
273 Ga0207648_10567034 3300026089 Bacteria 1044
274 Ga0207648_10689114 3300026089 Bacteria 946
275 Ga0207648_11769569 3300026089 Bacteria 580
276 Ga0207676_10636581 3300026095 Bacteria 1028
277 Ga0207675_100897741 3300026118 Bacteria 902
278 Ga0207675_101215644 3300026118 Bacteria 774
279 Ga0207683_10084326 3300026121 Bacteria 2824
280 Ga0207683_10540792 3300026121 Bacteria 1077
281 Ga0207698_10078550 3300026142 Bacteria 2650
282 Ga0209813_10101802 3300027866 Bacteria 978
283 Ga0209813_10291725 3300027866 Bacteria 631
284 Ga0207428_10741089 3300027907 Bacteria 701
285 Ga0268266_10000331 3300028379 Bacteria 74549
286 Ga0268266_10013446 3300028379 Bacteria 7047
287 Ga0268266_10078485 3300028379 Bacteria 2873
288 Ga0268266_10866785 3300028379 Bacteria 873
289 Ga0268265_11499589 3300028380 Bacteria 678
290 Ga0268264_10080895 3300028381 Bacteria 2775
291 Ga0268264_11004959 3300028381 Bacteria 841
292 Ga0265319_1004288 3300028563 Bacteria 7100
293 Ga0265334_10000661 3300028573 Bacteria 17356
294 Ga0265334_10002832 3300028573 Bacteria 7983
295 Ga0265318_10003204 3300028577 Bacteria 8347
296 Ga0265338_10024812 3300028800 Bacteria 6109
297 Ga0265324_10317326 3300029957 Unclassified 531
298 Ga0265330_10003059 3300031235 Bacteria 8863
299 Ga0265332_10002585 3300031238 Bacteria 9160
300 Ga0265332_10040674 3300031238 Unclassified 2012
301 Ga0265328_10004996 3300031239 Bacteria 5717
302 Ga0265328_10371913 3300031239 Unclassified 558
303 Ga0265320_10012739 3300031240 Bacteria 4876
304 Ga0265325_10003217 3300031241 Bacteria 10748
305 Ga0265325_10183070 3300031241 Bacteria 975
306 Ga0265340_10347757 3300031247 Unclassified 655
307 Ga0265339_10090362 3300031249 Bacteria 1606
308 Ga0265331_10021616 3300031250 Bacteria 3290
309 Ga0265331_10535592 3300031250 Bacteria 528
310 Ga0265327_10024072 3300031251 Bacteria 3587
311 Ga0265316_10011055 3300031344 Bacteria 8178
312 Ga0265316_10277153 3300031344 Unclassified 1226
313 Ga0307513_10687973 3300031456 Bacteria 729
314 Ga0307408_100707092 3300031548 Bacteria 906
315 Ga0265314_10008056 3300031711 Bacteria 9069
316 Ga0265342_10005889 3300031712 Bacteria 9245
317 Ga0307405_11977295 3300031731 Bacteria 521
318 Ga0307409_102036458 3300031995 Bacteria 604
319 Ga0307416_100457525 3300032002 Bacteria 1330
320 Ga0307414_11448337 3300032004 Bacteria 639
321 Ga0373938_0218964 3300034957 Bacteria 534
322 Ga0373928_0036361 3300035084 Bacteria 1113
323 Ga0373934_0042169 3300035086 Bacteria 1802
324 Ga0373940_0293994 3300035088 Bacteria 558
325 Ga0373951_0165078 3300035091 Bacteria 628
326 Ga0373932_0038256 3300035112 Bacteria 1371
327 Ga0373936_0157833 3300035113 Bacteria 987
328 Ga0373941_0110516 3300035115 Bacteria 968
329 Ga0373941_0127622 3300035115 Bacteria 913
330 Ga0373953_0239177 3300035117 Bacteria 788
331 Ga0373956_0205687 3300035119 Bacteria 933
332 Ga0373957_0112564 3300035120 Bacteria 1097
333 Ga0373955_0052831 3300035172 Unclassified 2217
334 Ga0373942_0207760 3300035207 Bacteria 652
335 Ga0373931_0099904 3300035691 Bacteria 1630
336 Ga0373935_0440312 3300035692 Bacteria 940
337 Ga0373935_0834868 3300035692 Unclassified 681
338 Ga0373927_0231979 3300035695 Bacteria 1213
339 Ga0373927_0312762 3300035695 Bacteria 1034
340 Ga0373927_0656429 3300035695 Bacteria 693
341 Ga0373933_0107595 3300035724 Bacteria 1736
342 Ga0373947_0989436 3300035725 Bacteria 574
343 Ga0373937_0151428 3300036401 Bacteria 2173
344 Ga0373925_0385772 3300037068 Bacteria 1141
345 Ga0373925_0572078 3300037068 Bacteria 930
346 Ga0373925_0774501 3300037068 Bacteria 791
347 Ga0395900_0351058 3300037418 Bacteria 1448
348 Ga0395898_0108306 3300037466 Bacteria 2664
349 Ga0395905_0223068 3300037471 Bacteria 1764
350 Ga0395901_0002647 3300038443 Bacteria 18098
351 Ga0395901_0012080 3300038443 Bacteria 8761
352 Ga0436365_1197405 3300039437 Bacteria 1023
353 Ga0436360_0553710 3300039438 Bacteria 8471
354 Ga0436360_0775085 3300039438 Bacteria 763
355 Ga0436360_0801921 3300039438 Bacteria 559
356 Ga0436360_0823243 3300039438 Bacteria 898
357 Ga0436361_0659932 3300039447 Bacteria 5108
358 Ga0436361_0682684 3300039447 Bacteria 500
359 Ga0436361_1174816 3300039447 Bacteria 1386
360 Ga0436363_0622418 3300039450 Bacteria 788
361 Ga0436363_0662840 3300039450 Unclassified 636
362 Ga0436362_0728295 3300039453 Bacteria 570
363 Ga0451800_1534378 3300041459 Bacteria 526
364 Ga0451802_1900323 3300041460 Bacteria 803
365 Ga0451807_1752039 3300041486 Bacteria 548
366 Ga0439448_0123659 3300042005 Bacteria 889
367 Ga0439432_210337 3300042006 Bacteria 563
368 Ga0439454_055058 3300042011 Bacteria 680
369 Ga0439458_0048244 3300042157 Bacteria 1047
370 Ga0439459_0004465 3300042438 Bacteria 2251
371 Ga0439464_0155601 3300042439 Bacteria 717
372 Ga0466963_0031606 3300044694 Bacteria 3423
373 Ga0466964_0213578 3300044706 Bacteria 933
374 Ga0466968_0290768 3300044735 Bacteria 784
375 Ga0466957_0027162 3300044842 Bacteria 3400
376 Ga0466967_0006352 3300045976 Bacteria 8348
377 Ga0495592_0117228 3300046454 Unclassified 1878
378 Ga0495638_0000468 3300046460 Bacteria 48578
379 Ga0495651_0308382 3300046462 Bacteria 1059
380 Ga0495653_0695220 3300046463 Unclassified 618
381 Ga0495608_0030535 3300046511 Bacteria 3648
382 Ga0495587_0015087 3300046536 Bacteria 4828
383 Ga0495667_0208438 3300046559 Bacteria 1249
384 Ga0495634_0634507 3300046642 Bacteria 618
385 Ga0495625_0010253 3300046660 Bacteria 7770
386 Ga0495635_0095346 3300046663 Unclassified 2034
387 Ga0495657_0036258 3300046675 Bacteria 3410
388 Ga0495657_0742756 3300046675 Bacteria 563
389 Ga0495599_0004850 3300046678 Bacteria 8001
390 Ga0495623_0172770 3300046679 Bacteria 1261
391 Ga0495647_0235102 3300046681 Bacteria 812
392 Ga0495647_0244090 3300046681 Bacteria 798
393 Ga0495600_0101471 3300046809 Unclassified 1876
394 Ga0495604_0104015 3300047317 Unclassified 2081
395 Ga0495680_0473052 3300047322 Unclassified 854
396 Ga0495675_0120012 3300047444 Unclassified 1638
397 Ga0495684_0258322 3300047471 Bacteria 1264
398 Ga0495602_0106891 3300048088 Unclassified 2283
399 Ga0496104_1215109 3300048907 Bacteria 657
400 Ga0496106_0575594 3300048909 Bacteria 903
401 Ga0496114_1360092 3300048917 Unclassified 597
402 Ga0496118_0155983 3300048921 Unclassified 1420
403 Ga0496121_0061879 3300048924 Bacteria 3069
404 Ga0496126_0097318 3300048929 Bacteria 2579
405 Ga0501033_0209910 3300049570 Bacteria 1389
406 Ga0501034_0004963 3300049571 Bacteria 14647
407 Ga0501034_0008067 3300049571 Bacteria 11173
408 Ga0501034_0208140 3300049571 Bacteria 1912
409 Ga0501036_0601479 3300049572 Bacteria 912
410 Ga0501037_0630290 3300049573 Bacteria 718
411 Ga0501037_0895547 3300049573 Bacteria 582
412 Ga0501038_1143568 3300049574 Bacteria 567
413 Ga0501046_0512108 3300049580 Bacteria 859
414 Ga0501047_0808956 3300049581 Bacteria 752
415 Ga0501068_0003254 3300049584 Bacteria 8707
416 Ga0501070_0821962 3300049586 Bacteria 729
417 Ga0501081_1509603 3300049743 Bacteria 510
418 Ga0501044_0172404 3300049823 Bacteria 2134
419 nmdc:mga03683_4909_c1 3300050489 Bacteria 4472
420 nmdc:mga03683_640183_c1 3300050489 Unclassified 523
421 nmdc:mga03683_6864_c1 3300050489 Bacteria 3922
422 nmdc:mga03n38_315398_c1 3300050490 Bacteria 843
423 nmdc:mga00v17_1088310_c1 3300050491 Bacteria 501
424 nmdc:mga00v17_54880_c1 3300050491 Bacteria 2431
425 nmdc:mga00v17_70670_c1 3300050491 Bacteria 2162
426 nmdc:mga0yw44_1182856_c1 3300050492 Bacteria 516
427 nmdc:mga0yw44_168472_c1 3300050492 Bacteria 1437
428 nmdc:mga0yw44_25134_c1 3300050492 Bacteria 3381
429 nmdc:mga0yw44_366236_c1 3300050492 Bacteria 972
430 nmdc:mga0yw44_386756_c1 3300050492 Bacteria 945
431 nmdc:mga0yw44_412779_c1 3300050492 Bacteria 914
432 nmdc:mga0yw44_54272_c1 3300050492 Bacteria 2435
433 nmdc:mga0yw44_83781_c1 3300050492 Bacteria 2003
434 nmdc:mga0k408_170079_c1 3300050493 Bacteria 1299
435 nmdc:mga0k408_206318_c1 3300050493 Bacteria 1173
436 nmdc:mga0k408_699603_c1 3300050493 Bacteria 594
437 nmdc:mga0k408_7288_c2 3300050493 Bacteria 4720
438 nmdc:mga06z11_168508_c1 3300050494 Bacteria 1256
439 nmdc:mga06z11_368125_c1 3300050494 Bacteria 862
440 nmdc:mga04h51_120174_c1 3300050495 Bacteria 978
441 nmdc:mga04h51_416166_c1 3300050495 Bacteria 565
442 nmdc:mga07m45_218082_c1 3300050496 Bacteria 1110
443 nmdc:mga07m45_333702_c1 3300050496 Bacteria 881
444 nmdc:mga07m45_790519_c1 3300050496 Unclassified 544
445 nmdc:mga05p37_1552874_c1 3300050507 Bacteria 655
446 nmdc:mga08y16_483115_c1 3300050511 Bacteria 1260
447 nmdc:mga08y16_534982_c1 3300050511 Bacteria 1187
448 nmdc:mga0sz30_254_c1 3300050516 Bacteria 20523
449 nmdc:mga0sz30_480771_c1 3300050516 Bacteria 558
450 nmdc:mga0sz30_59776_c1 3300050516 Bacteria 1627
451 Ga0495601_0004582 3300053077 Bacteria 7995
452 Ga0495601_0708455 3300053077 Bacteria 642
453 Ga0495612_0383082 3300053078 Bacteria 638
454 Ga0495595_0016761 3300053084 Bacteria 3141
455 Ga0495619_1032268 3300053085 Unclassified 549
456 Ga0500644_0029259 3300053088 Bacteria 1731
457 Ga0500644_0270248 3300053088 Bacteria 721
458 Ga0500647_0162588 3300053091 Bacteria 1035
459 Ga0500583_0267818 3300053092 Bacteria 841
460 Ga0500583_0317398 3300053092 Bacteria 760
461 Ga0500651_0110361 3300053093 Bacteria 1679
462 Ga0500641_0000610 3300053096 Bacteria 12905
463 Ga0500557_039318 3300053105 Bacteria 1477
464 Ga0500595_099070 3300053119 Bacteria 836
465 Ga0500655_128055 3300053133 Bacteria 541
466 Ga0500658_0234273 3300053134 Bacteria 843
467 Ga0500577_0401860 3300053142 Unclassified 599
468 Ga0500577_0498383 3300053142 Bacteria 532
469 Ga0500616_0002441 3300053153 Bacteria 15468
470 Ga0500616_0399786 3300053153 Bacteria 549
471 Ga0500609_013127 3300053731 Bacteria 1121
472 Ga0065704_10672102
473 JGI24735J21928_10116721
474 rootH2_10065933
475 JGI25405J52794_10025960
476 Ga0065712_10438518
477 Ga0065712_10731310
478 Ga0065707_10089256
479 Ga0070658_10178017
480 Ga0070676_10447151
481 Ga0070676_11381030
482 Ga0070683_100147277
483 Ga0070690_100367343
484 Ga0070690_101368880
485 Ga0070670_101153947
486 Ga0068869_100550756
487 Ga0070666_11064583
488 Ga0070680_100881608
489 Ga0070682_100498865
490 Ga0068868_100898478
491 Ga0070660_100258750
492 Ga0070689_100045420
493 Ga0070691_10431609
494 Ga0070691_10560089
495 Ga0070661_100040811
496 Ga0070692_10776772
497 Ga0070668_100988811
498 Ga0070669_100135312
499 Ga0070675_100324657
500 Ga0070675_100623610
501 Ga0070675_102137076
502 Ga0070674_100082895
503 Ga0070674_100194753
504 Ga0070673_100299210
505 Ga0070673_100384060
506 Ga0070673_100844235
507 Ga0070673_101642553
508 Ga0070673_101707272
509 Ga0070688_100063109
510 Ga0070659_100087624
511 Ga0070667_101478643
512 Ga0070713_100022074
513 Ga0070701_10036935
514 Ga0070700_101220382
515 Ga0070663_100402053
516 Ga0070678_100066115
517 Ga0070681_10180925
518 Ga0070681_10449197
519 Ga0070706_100146663
520 Ga0070706_101903045
521 Ga0070707_101962645
522 Ga0070698_101758366
523 Ga0070699_100816070
524 Ga0070684_100016233
525 Ga0068853_100368441
526 Ga0068853_101637919
527 Ga0070672_100043125
528 Ga0070672_100982013
529 Ga0070686_101123660
530 Ga0070686_101934791
531 Ga0070693_100001438
532 Ga0070665_100002100
533 Ga0070665_100021601
534 Ga0070665_100113221
535 Ga0070665_100616471
536 Ga0070704_101983606
537 Ga0068855_100137251
538 Ga0068855_100196051
539 Ga0070664_100021220
540 Ga0068857_100554692
541 Ga0068854_102065505
542 Ga0068856_100076314
543 Ga0070702_100398451
544 Ga0068852_100038038
545 Ga0068859_100254967
546 Ga0068859_100659696
547 Ga0068859_100691275
548 Ga0068864_100429455
549 Ga0068866_11302346
550 Ga0068851_10826020
551 Ga0068863_100575814
552 Ga0068858_100026227
553 Ga0068858_100251115
554 Ga0068858_101800726
555 Ga0068860_100380718
556 Ga0068860_100538624
557 Ga0068860_100841920
558 Ga0068862_100173039
559 Ga0081455_10002752
560 Ga0081455_10012872
561 Ga0081455_10525039
562 Ga0081540_1129828
563 Ga0081539_10002706
564 Ga0081539_10005262
565 Ga0081539_10101871
566 Ga0075365_10038212
567 Ga0075365_10057933
568 Ga0075365_10098959
569 Ga0075365_10154226
570 Ga0075365_10265018
571 Ga0075365_10643164
572 Ga0075365_10740041
573 Ga0075368_10026549
574 Ga0075368_10136682
575 Ga0075363_100637017
576 Ga0075363_100834846
577 Ga0075364_10039056
578 Ga0075364_10069778
579 Ga0075364_10163588
580 Ga0075364_10746583
581 Ga0070715_10172354
582 Ga0070716_101380727
583 Ga0075362_10002810
584 Ga0075362_10006141
585 Ga0075362_10047945
586 Ga0075362_10167068
587 Ga0075362_10189125
588 Ga0075362_10742627
589 Ga0075367_10044810
590 Ga0075367_10162062
591 Ga0075369_10001108
592 Ga0075369_10003883
593 Ga0075369_10294653
594 Ga0075366_10009792
595 Ga0075366_10107781
596 Ga0075366_10139782
597 Ga0097621_100065349
598 Ga0097621_100130176
599 Ga0097621_100456700
600 Ga0097621_100911987
601 Ga0075370_10209458
602 Ga0075370_10307293
603 Ga0068871_100016022
604 Ga0068871_100042618
605 Ga0068871_100380464
606 Ga0075428_100553433
607 Ga0068865_100109185
608 Ga0068865_101481298
609 Ga0075436_101092913
610 Ga0097620_100254988
611 Ga0097620_100659780
612 Ga0097620_100691283
613 Ga0099794_10042877
614 Ga0099795_10355758
615 Ga0099795_10430985
616 Ga0105240_11766262
617 Ga0111539_10205043
618 Ga0111539_11552426
619 Ga0105245_10013484
620 Ga0105245_10275843
621 Ga0105245_11721513
622 Ga0105245_11881747
623 Ga0105247_11596522
624 Ga0105243_10459338
625 Ga0105243_12165002
626 Ga0105243_13067254
627 Ga0105241_10180370
628 Ga0105242_10034009
629 Ga0105242_10129551
630 Ga0105242_11057561
631 Ga0105248_10011479
632 Ga0105248_10058661
633 Ga0105248_11577696
634 Ga0105248_11866575
635 Ga0105248_12072038
636 Ga0105237_10000647
637 Ga0105237_10246422
638 Ga0105237_10711316
639 Ga0105238_10047370
640 Ga0105238_10354417
641 Ga0105249_12364214
642 Ga0105029_113131
643 Ga0099796_10000478
644 Ga0099796_10201818
645 Ga0105239_10000238
646 Ga0105239_10065390
647 Ga0157371_10305197
648 Ga0157369_10064867
649 Ga0157374_10439800
650 Ga0157374_12683434
651 Ga0157378_10106129
652 Ga0157378_11966910
653 Ga0163162_10149043
654 Ga0163162_11441084
655 Ga0157372_10077052
656 Ga0157372_13223605
657 Ga0157375_10466816
658 Ga0163163_13240352
659 Ga0157380_13491557
660 Ga0157379_10421437
661 Ga0157379_11408915
662 Ga0157379_11879704
663 Ga0157376_10215609
664 Ga0157376_10309033
665 Ga0157376_11262881
666 Ga0157376_12114009
667 Ga0213872_10164293
668 Ga0213871_10002248
669 Ga0207426_1011774
670 Ga0207426_1032286
671 Ga0207710_10517857
672 Ga0207688_10055872
673 Ga0207680_10175229
674 Ga0207647_10066429
675 Ga0207645_10248647
676 Ga0207684_10651603
677 Ga0207654_10236391
678 Ga0207707_10113672
679 Ga0207707_10862359
680 Ga0207695_10306458
681 Ga0207671_10000098
682 Ga0207663_10844056
683 Ga0207660_10816561
684 Ga0207657_10298428
685 Ga0207657_10606964
686 Ga0207649_10015573
687 Ga0207646_10324810
688 Ga0207646_11165008
689 Ga0207681_10325575
690 Ga0207694_10187513
691 Ga0207694_10368602
692 Ga0207650_11173515
693 Ga0207659_10665482
694 Ga0207687_10556753
695 Ga0207687_10660473
696 Ga0207687_11073463
697 Ga0207700_11020110
698 Ga0207664_10725095
699 Ga0207644_10429479
700 Ga0207690_10497964
701 Ga0207686_10104021
702 Ga0207709_11375490
703 Ga0207709_11642057
704 Ga0207709_11763815
705 Ga0207670_10002294
706 Ga0207670_10914333
707 Ga0207670_10955981
708 Ga0207669_10057303
709 Ga0207669_10153355
710 Ga0207669_10559517
711 Ga0207704_10168093
712 Ga0207704_10945964
713 Ga0207665_11020504
714 Ga0207691_10311959
715 Ga0207691_10437487
716 Ga0207691_10774426
717 Ga0207711_10227108
718 Ga0207711_10833622
719 Ga0207689_10093777
720 Ga0207689_10215854
721 Ga0207661_10195073
722 Ga0207679_10174868
723 Ga0207667_10102446
724 Ga0207667_11867555
725 Ga0207651_10457308
726 Ga0207651_10515982
727 Ga0207651_10690218
728 Ga0207651_10763063
729 Ga0207651_11568471
730 Ga0207712_11246435
731 Ga0207668_10434801
732 Ga0207658_11847810
733 Ga0207677_10117080
734 Ga0207703_10060462
735 Ga0207703_10514973
736 Ga0207703_10726118
737 Ga0207703_11338275
738 Ga0207703_11604268
739 Ga0207639_10297971
740 Ga0207708_10507316
741 Ga0207708_10647557
742 Ga0207702_10556713
743 Ga0207641_10370836
744 Ga0207648_10567034
745 Ga0207648_10689114
746 Ga0207648_11769569
747 Ga0207676_10636581
748 Ga0207675_100897741
749 Ga0207675_101215644
750 Ga0207683_10084326
751 Ga0207683_10540792
752 Ga0207698_10078550
753 Ga0209813_10101802
754 Ga0209813_10291725
755 Ga0207428_10741089
756 Ga0268266_10000331
757 Ga0268266_10013446
758 Ga0268266_10078485
759 Ga0268266_10866785
760 Ga0268265_11499589
761 Ga0268264_10080895
762 Ga0268264_11004959
763 Ga0265319_1004288
764 Ga0265334_10000661
765 Ga0265334_10002832
766 Ga0265318_10003204
767 Ga0265338_10024812
768 Ga0265324_10317326
769 Ga0265330_10003059
770 Ga0265332_10002585
771 Ga0265332_10040674
772 Ga0265328_10004996
773 Ga0265328_10371913
774 Ga0265320_10012739
775 Ga0265325_10003217
776 Ga0265325_10183070
777 Ga0265340_10347757
778 Ga0265339_10090362
779 Ga0265331_10021616
780 Ga0265331_10535592
781 Ga0265327_10024072
782 Ga0265316_10011055
783 Ga0265316_10277153
784 Ga0307513_10687973
785 Ga0307408_100707092
786 Ga0265314_10008056
787 Ga0265342_10005889
788 Ga0307405_11977295
789 Ga0307409_102036458
790 Ga0307416_100457525
791 Ga0307414_11448337
792 Ga0373938_0218964
793 Ga0373928_0036361
794 Ga0373934_0042169
795 Ga0373940_0293994
796 Ga0373951_0165078
797 Ga0373932_0038256
798 Ga0373936_0157833
799 Ga0373941_0110516
800 Ga0373941_0127622
801 Ga0373953_0239177
802 Ga0373956_0205687
803 Ga0373957_0112564
804 Ga0373955_0052831
805 Ga0373942_0207760
806 Ga0373931_0099904
807 Ga0373935_0440312
808 Ga0373935_0834868
809 Ga0373927_0231979
810 Ga0373927_0312762
811 Ga0373927_0656429
812 Ga0373933_0107595
813 Ga0373947_0989436
814 Ga0373937_0151428
815 Ga0373925_0385772
816 Ga0373925_0572078
817 Ga0373925_0774501
818 Ga0395900_0351058
819 Ga0395898_0108306
820 Ga0395905_0223068
821 Ga0395901_0002647
822 Ga0395901_0012080
823 Ga0436365_1197405
824 Ga0436360_0553710
825 Ga0436360_0775085
826 Ga0436360_0801921
827 Ga0436360_0823243
828 Ga0436361_0659932
829 Ga0436361_0682684
830 Ga0436361_1174816
831 Ga0436363_0622418
832 Ga0436363_0662840
833 Ga0436362_0728295
834 Ga0451800_1534378
835 Ga0451802_1900323
836 Ga0451807_1752039
837 Ga0439448_0123659
838 Ga0439432_210337
839 Ga0439454_055058
840 Ga0439458_0048244
841 Ga0439459_0004465
842 Ga0439464_0155601
843 Ga0466963_0031606
844 Ga0466964_0213578
845 Ga0466968_0290768
846 Ga0466957_0027162
847 Ga0466967_0006352
848 Ga0495592_0117228
849 Ga0495638_0000468
850 Ga0495651_0308382
851 Ga0495653_0695220
852 Ga0495608_0030535
853 Ga0495587_0015087
854 Ga0495667_0208438
855 Ga0495634_0634507
856 Ga0495625_0010253
857 Ga0495635_0095346
858 Ga0495657_0036258
859 Ga0495657_0742756
860 Ga0495599_0004850
861 Ga0495623_0172770
862 Ga0495647_0235102
863 Ga0495647_0244090
864 Ga0495600_0101471
865 Ga0495604_0104015
866 Ga0495680_0473052
867 Ga0495675_0120012
868 Ga0495684_0258322
869 Ga0495602_0106891
870 Ga0496104_1215109
871 Ga0496106_0575594
872 Ga0496114_1360092
873 Ga0496118_0155983
874 Ga0496121_0061879
875 Ga0496126_0097318
876 Ga0501033_0209910
877 Ga0501034_0004963
878 Ga0501034_0008067
879 Ga0501034_0208140
880 Ga0501036_0601479
881 Ga0501037_0630290
882 Ga0501037_0895547
883 Ga0501038_1143568
884 Ga0501046_0512108
885 Ga0501047_0808956
886 Ga0501068_0003254
887 Ga0501070_0821962
888 Ga0501081_1509603
889 Ga0501044_0172404
890 nmdc:mga03683_4909_c1
891 nmdc:mga03683_640183_c1
892 nmdc:mga03683_6864_c1
893 nmdc:mga03n38_315398_c1
894 nmdc:mga00v17_1088310_c1
895 nmdc:mga00v17_54880_c1
896 nmdc:mga00v17_70670_c1
897 nmdc:mga0yw44_1182856_c1
898 nmdc:mga0yw44_168472_c1
899 nmdc:mga0yw44_25134_c1
900 nmdc:mga0yw44_366236_c1
901 nmdc:mga0yw44_386756_c1
902 nmdc:mga0yw44_412779_c1
903 nmdc:mga0yw44_54272_c1
904 nmdc:mga0yw44_83781_c1
905 nmdc:mga0k408_170079_c1
906 nmdc:mga0k408_206318_c1
907 nmdc:mga0k408_699603_c1
908 nmdc:mga0k408_7288_c2
909 nmdc:mga06z11_168508_c1
910 nmdc:mga06z11_368125_c1
911 nmdc:mga04h51_120174_c1
912 nmdc:mga04h51_416166_c1
913 nmdc:mga07m45_218082_c1
914 nmdc:mga07m45_333702_c1
915 nmdc:mga07m45_790519_c1
916 nmdc:mga05p37_1552874_c1
917 nmdc:mga08y16_483115_c1
918 nmdc:mga08y16_534982_c1
919 nmdc:mga0sz30_254_c1
920 nmdc:mga0sz30_480771_c1
921 nmdc:mga0sz30_59776_c1
922 Ga0495601_0004582
923 Ga0495601_0708455
924 Ga0495612_0383082
925 Ga0495595_0016761
926 Ga0495619_1032268
927 Ga0500644_0029259
928 Ga0500644_0270248
929 Ga0500647_0162588
930 Ga0500583_0267818
931 Ga0500583_0317398
932 Ga0500651_0110361
933 Ga0500641_0000610
934 Ga0500557_039318
935 Ga0500595_099070
936 Ga0500655_128055
937 Ga0500658_0234273
938 Ga0500577_0401860
939 Ga0500577_0498383
940 Ga0500616_0002441
941 Ga0500616_0399786
942 Ga0500609_013127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

7

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8807 4 106
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8756 4 106
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8748 2 105
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.855 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8477 4 106
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8807 4 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8477 4 106 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8346 1 106 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8138 4 104 2.60.40.10
4brvA00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.767 4 106 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A6P1B118-F1-model_v4 deleted 0.9063 41 106
AF-A0A257JGP6-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.8886 38 106
AF-A0A6P1B118-F1-model_v4 deleted 0.8813 41 106
AF-A0A3B8RJ57-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.8791 1 106
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.8775 41 106

Map