F450276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 287 | 465 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0044531|Ga0395905_0044531_2273_2722 |
| Length | 137 |
| Sequence | MALKDRITDDMKDAMRARAAARLSTIRLLLAAIKQREVDERKALTDADVVAIIDRMIKQRKDSIAQFDAGQRPDLADAERAELAILETYLPQRMSDAEIGAGGSGPALMGKVMAALKPQLAGRADMAQVSARVKARL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 2 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 3 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 184 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 190 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 191 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 192 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 193 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 206 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 266 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 281 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 287 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.07 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.76 |
| Nodule | 0.21 |
| Rhizoplane | 4.26 |
| Rhizosphere | 87.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005518 | 3300000546 | Bacteria | 1379 |
| 2 | JGI25165J46597_1001030 | 3300003214 | Bacteria | 18251 |
| 3 | Ga0070658_10888916 | 3300005327 | Bacteria | 774 |
| 4 | Ga0070676_10260923 | 3300005328 | Bacteria | 1160 |
| 5 | Ga0070690_100033755 | 3300005330 | Bacteria | 3205 |
| 6 | Ga0068869_100317678 | 3300005334 | Bacteria | 1262 |
| 7 | Ga0070680_100024022 | 3300005336 | Bacteria | 4865 |
| 8 | Ga0070682_100056349 | 3300005337 | Bacteria | 2471 |
| 9 | Ga0070660_100737793 | 3300005339 | Bacteria | 827 |
| 10 | Ga0070689_100172765 | 3300005340 | Bacteria | 1751 |
| 11 | Ga0070689_100656800 | 3300005340 | Bacteria | 913 |
| 12 | Ga0070687_100286100 | 3300005343 | Bacteria | 1040 |
| 13 | Ga0070687_100301663 | 3300005343 | Bacteria | 1016 |
| 14 | Ga0070692_10160177 | 3300005345 | Bacteria | 1289 |
| 15 | Ga0070668_101142414 | 3300005347 | Bacteria | 704 |
| 16 | Ga0070668_101788352 | 3300005347 | Bacteria | 565 |
| 17 | Ga0070669_100260405 | 3300005353 | Bacteria | 1384 |
| 18 | Ga0070675_100368048 | 3300005354 | Bacteria | 1277 |
| 19 | Ga0070675_100599610 | 3300005354 | Bacteria | 999 |
| 20 | Ga0070674_100057181 | 3300005356 | Bacteria | 2707 |
| 21 | Ga0070674_100073544 | 3300005356 | Bacteria | 2423 |
| 22 | Ga0070674_101340365 | 3300005356 | Bacteria | 639 |
| 23 | Ga0070674_101900798 | 3300005356 | Bacteria | 541 |
| 24 | Ga0070673_100816739 | 3300005364 | Bacteria | 861 |
| 25 | Ga0070701_10034586 | 3300005438 | Bacteria | 2532 |
| 26 | Ga0070711_100051970 | 3300005439 | Bacteria | 2818 |
| 27 | Ga0070705_100011290 | 3300005440 | Bacteria | 4501 |
| 28 | Ga0070700_100051444 | 3300005441 | Bacteria | 2564 |
| 29 | Ga0070700_101165207 | 3300005441 | Bacteria | 642 |
| 30 | Ga0070694_100056259 | 3300005444 | Bacteria | 2671 |
| 31 | Ga0070663_100176371 | 3300005455 | Bacteria | 1655 |
| 32 | Ga0070678_100324273 | 3300005456 | Bacteria | 1316 |
| 33 | Ga0070678_100348420 | 3300005456 | Bacteria | 1273 |
| 34 | Ga0070662_100756890 | 3300005457 | Bacteria | 824 |
| 35 | Ga0068867_100001695 | 3300005459 | Bacteria | 15364 |
| 36 | Ga0068867_100249172 | 3300005459 | Bacteria | 1444 |
| 37 | Ga0068867_101331705 | 3300005459 | Bacteria | 664 |
| 38 | Ga0068867_102037535 | 3300005459 | Bacteria | 543 |
| 39 | Ga0070685_10311745 | 3300005466 | Bacteria | 1063 |
| 40 | Ga0070679_100036124 | 3300005530 | Bacteria | 4903 |
| 41 | Ga0068853_100486513 | 3300005539 | Bacteria | 1164 |
| 42 | Ga0068853_100812230 | 3300005539 | Bacteria | 896 |
| 43 | Ga0068853_101359973 | 3300005539 | Bacteria | 686 |
| 44 | Ga0070672_100152671 | 3300005543 | Bacteria | 1911 |
| 45 | Ga0070672_100570285 | 3300005543 | Bacteria | 984 |
| 46 | Ga0070686_100056706 | 3300005544 | Bacteria | 2513 |
| 47 | Ga0070686_101000778 | 3300005544 | Bacteria | 685 |
| 48 | Ga0070695_100041922 | 3300005545 | Bacteria | 2903 |
| 49 | Ga0070696_100000379 | 3300005546 | Bacteria | 27163 |
| 50 | Ga0070696_100012855 | 3300005546 | Bacteria | 5619 |
| 51 | Ga0070693_100311910 | 3300005547 | Bacteria | 1064 |
| 52 | Ga0070693_100544857 | 3300005547 | Bacteria | 830 |
| 53 | Ga0070665_100010309 | 3300005548 | Bacteria | 9455 |
| 54 | Ga0070665_100060219 | 3300005548 | Bacteria | 3806 |
| 55 | Ga0070665_100131117 | 3300005548 | Bacteria | 2509 |
| 56 | Ga0070665_100225913 | 3300005548 | Bacteria | 1872 |
| 57 | Ga0070704_101572431 | 3300005549 | Bacteria | 606 |
| 58 | Ga0068855_100163952 | 3300005563 | Bacteria | 2521 |
| 59 | Ga0070664_100380459 | 3300005564 | Bacteria | 1288 |
| 60 | Ga0068857_100486836 | 3300005577 | Bacteria | 1156 |
| 61 | Ga0068854_100486688 | 3300005578 | Bacteria | 1037 |
| 62 | Ga0068854_101872772 | 3300005578 | Bacteria | 551 |
| 63 | Ga0070702_100185945 | 3300005615 | Bacteria | 1363 |
| 64 | Ga0068852_100009907 | 3300005616 | Bacteria | 7094 |
| 65 | Ga0068852_100882306 | 3300005616 | Bacteria | 911 |
| 66 | Ga0068859_100050338 | 3300005617 | Bacteria | 4185 |
| 67 | Ga0068859_100237912 | 3300005617 | Bacteria | 1910 |
| 68 | Ga0068859_100286751 | 3300005617 | Bacteria | 1739 |
| 69 | Ga0068859_100571179 | 3300005617 | Bacteria | 1225 |
| 70 | Ga0068859_100779426 | 3300005617 | Bacteria | 1044 |
| 71 | Ga0068864_100205178 | 3300005618 | Bacteria | 1813 |
| 72 | Ga0068866_10037278 | 3300005718 | Bacteria | 2387 |
| 73 | Ga0068866_10148489 | 3300005718 | Bacteria | 1354 |
| 74 | Ga0068861_100000582 | 3300005719 | Bacteria | 21639 |
| 75 | Ga0068861_100002436 | 3300005719 | Bacteria | 12130 |
| 76 | Ga0068861_101129306 | 3300005719 | Bacteria | 754 |
| 77 | Ga0068863_100048521 | 3300005841 | Bacteria | 4026 |
| 78 | Ga0068863_101166252 | 3300005841 | Bacteria | 776 |
| 79 | Ga0068858_100165433 | 3300005842 | Bacteria | 2084 |
| 80 | Ga0068858_100655028 | 3300005842 | Bacteria | 1020 |
| 81 | Ga0068860_100001910 | 3300005843 | Bacteria | 22116 |
| 82 | Ga0068860_100024966 | 3300005843 | Bacteria | 5770 |
| 83 | Ga0068862_100003469 | 3300005844 | Bacteria | 13560 |
| 84 | Ga0068862_100004043 | 3300005844 | Bacteria | 12431 |
| 85 | Ga0075364_10061759 | 3300006051 | Bacteria | 2458 |
| 86 | Ga0075364_10133615 | 3300006051 | Bacteria | 1666 |
| 87 | Ga0075364_10225422 | 3300006051 | Bacteria | 1273 |
| 88 | Ga0075367_10491958 | 3300006178 | Bacteria | 778 |
| 89 | Ga0075369_10074691 | 3300006186 | Bacteria | 1496 |
| 90 | Ga0075366_10015329 | 3300006195 | Bacteria | 4390 |
| 91 | Ga0075366_10076116 | 3300006195 | Bacteria | 2002 |
| 92 | Ga0075366_10133151 | 3300006195 | Bacteria | 1501 |
| 93 | Ga0075366_10199343 | 3300006195 | Bacteria | 1217 |
| 94 | Ga0097621_100007196 | 3300006237 | Bacteria | 7939 |
| 95 | Ga0097621_100318118 | 3300006237 | Bacteria | 1378 |
| 96 | Ga0097621_101825564 | 3300006237 | Bacteria | 580 |
| 97 | Ga0075370_10011625 | 3300006353 | Bacteria | 4630 |
| 98 | Ga0068871_100021745 | 3300006358 | Bacteria | 4936 |
| 99 | Ga0068871_100391773 | 3300006358 | Bacteria | 1236 |
| 100 | Ga0075428_100009589 | 3300006844 | Bacteria | 10750 |
| 101 | Ga0075428_101673882 | 3300006844 | Bacteria | 664 |
| 102 | Ga0075430_100042814 | 3300006846 | Bacteria | 3829 |
| 103 | Ga0075434_100211297 | 3300006871 | Bacteria | 1960 |
| 104 | Ga0075429_100001027 | 3300006880 | Bacteria | 22297 |
| 105 | Ga0075429_100943244 | 3300006880 | Bacteria | 755 |
| 106 | Ga0068865_100001694 | 3300006881 | Bacteria | 12918 |
| 107 | Ga0068865_101202119 | 3300006881 | Bacteria | 671 |
| 108 | Ga0097620_100050336 | 3300006931 | Bacteria | 4185 |
| 109 | Ga0097620_100237917 | 3300006931 | Bacteria | 1910 |
| 110 | Ga0097620_100571180 | 3300006931 | Bacteria | 1225 |
| 111 | Ga0097620_100779417 | 3300006931 | Bacteria | 1044 |
| 112 | Ga0099794_10024456 | 3300007265 | Bacteria | 2772 |
| 113 | Ga0111539_10012497 | 3300009094 | Bacteria | 10641 |
| 114 | Ga0105243_10020653 | 3300009148 | Bacteria | 4994 |
| 115 | Ga0105243_12647501 | 3300009148 | Bacteria | 541 |
| 116 | Ga0105241_11710582 | 3300009174 | Bacteria | 611 |
| 117 | Ga0105242_11406720 | 3300009176 | Bacteria | 725 |
| 118 | Ga0105248_11464868 | 3300009177 | Bacteria | 773 |
| 119 | Ga0105237_11532494 | 3300009545 | Bacteria | 673 |
| 120 | Ga0105238_10139100 | 3300009551 | Bacteria | 2405 |
| 121 | Ga0099796_10204413 | 3300010159 | Bacteria | 803 |
| 122 | Ga0157369_11660015 | 3300013105 | Bacteria | 649 |
| 123 | Ga0157374_10025500 | 3300013296 | Bacteria | 5309 |
| 124 | Ga0157378_10000558 | 3300013297 | Bacteria | 35454 |
| 125 | Ga0157378_10527560 | 3300013297 | Bacteria | 1183 |
| 126 | Ga0157378_10963415 | 3300013297 | Bacteria | 886 |
| 127 | Ga0163162_10002211 | 3300013306 | Bacteria | 18267 |
| 128 | Ga0163162_10517998 | 3300013306 | Bacteria | 1322 |
| 129 | Ga0157375_10266536 | 3300013308 | Bacteria | 1874 |
| 130 | Ga0157375_10291884 | 3300013308 | Bacteria | 1794 |
| 131 | Ga0157375_11713847 | 3300013308 | Bacteria | 744 |
| 132 | Ga0157380_10022686 | 3300014326 | Bacteria | 4731 |
| 133 | Ga0157380_11103722 | 3300014326 | Bacteria | 832 |
| 134 | Ga0182008_10119373 | 3300014497 | Bacteria | 1310 |
| 135 | Ga0157379_10294207 | 3300014968 | Bacteria | 1479 |
| 136 | Ga0157379_11241663 | 3300014968 | Bacteria | 718 |
| 137 | Ga0157376_10247152 | 3300014969 | Bacteria | 1664 |
| 138 | Ga0163161_10022683 | 3300017792 | Bacteria | 4421 |
| 139 | Ga0163161_10437150 | 3300017792 | Bacteria | 1055 |
| 140 | Ga0163161_10705556 | 3300017792 | Bacteria | 840 |
| 141 | Ga0213873_10137084 | 3300021358 | Bacteria | 729 |
| 142 | Ga0207427_103927 | 3300025231 | Bacteria | 2769 |
| 143 | Ga0209759_1001704 | 3300025256 | Bacteria | 11392 |
| 144 | Ga0209233_1000177 | 3300025261 | Bacteria | 141716 |
| 145 | Ga0207666_1008614 | 3300025271 | Bacteria | 1365 |
| 146 | Ga0207653_10157580 | 3300025885 | Bacteria | 839 |
| 147 | Ga0207682_10134882 | 3300025893 | Bacteria | 1104 |
| 148 | Ga0207692_10311791 | 3300025898 | Bacteria | 960 |
| 149 | Ga0207692_10491713 | 3300025898 | Bacteria | 777 |
| 150 | Ga0207642_10101490 | 3300025899 | Bacteria | 1445 |
| 151 | Ga0207642_10291387 | 3300025899 | Bacteria | 943 |
| 152 | Ga0207680_10631629 | 3300025903 | Bacteria | 766 |
| 153 | Ga0207685_10146088 | 3300025905 | Bacteria | 1065 |
| 154 | Ga0207685_10222998 | 3300025905 | Bacteria | 898 |
| 155 | Ga0207699_10088549 | 3300025906 | Bacteria | 1938 |
| 156 | Ga0207699_10581069 | 3300025906 | Bacteria | 815 |
| 157 | Ga0207645_10222979 | 3300025907 | Bacteria | 1243 |
| 158 | Ga0207643_10008880 | 3300025908 | Bacteria | 5395 |
| 159 | Ga0207643_10614500 | 3300025908 | Bacteria | 700 |
| 160 | Ga0207705_10794808 | 3300025909 | Bacteria | 734 |
| 161 | Ga0207705_11005936 | 3300025909 | Bacteria | 644 |
| 162 | Ga0207707_10067151 | 3300025912 | Bacteria | 3124 |
| 163 | Ga0207693_10050535 | 3300025915 | Bacteria | 3265 |
| 164 | Ga0207663_10489185 | 3300025916 | Bacteria | 954 |
| 165 | Ga0207660_10146686 | 3300025917 | Bacteria | 1809 |
| 166 | Ga0207662_10354785 | 3300025918 | Bacteria | 986 |
| 167 | Ga0207657_10061961 | 3300025919 | Bacteria | 3204 |
| 168 | Ga0207657_10899705 | 3300025919 | Bacteria | 682 |
| 169 | Ga0207652_10002539 | 3300025921 | Bacteria | 15323 |
| 170 | Ga0207681_10312833 | 3300025923 | Bacteria | 1246 |
| 171 | Ga0207694_10176768 | 3300025924 | Bacteria | 1730 |
| 172 | Ga0207659_10503147 | 3300025926 | Bacteria | 1026 |
| 173 | Ga0207700_10104016 | 3300025928 | Bacteria | 2271 |
| 174 | Ga0207700_11223431 | 3300025928 | Bacteria | 670 |
| 175 | Ga0207664_10107550 | 3300025929 | Bacteria | 2314 |
| 176 | Ga0207644_10385972 | 3300025931 | Bacteria | 1143 |
| 177 | Ga0207690_10473107 | 3300025932 | Bacteria | 1010 |
| 178 | Ga0207706_10693401 | 3300025933 | Bacteria | 870 |
| 179 | Ga0207686_10263993 | 3300025934 | Bacteria | 1263 |
| 180 | Ga0207709_10047935 | 3300025935 | Bacteria | 2601 |
| 181 | Ga0207709_10180738 | 3300025935 | Bacteria | 1489 |
| 182 | Ga0207670_10099386 | 3300025936 | Bacteria | 2075 |
| 183 | Ga0207670_10255380 | 3300025936 | Bacteria | 1356 |
| 184 | Ga0207669_10145601 | 3300025937 | Bacteria | 1651 |
| 185 | Ga0207669_10226346 | 3300025937 | Bacteria | 1376 |
| 186 | Ga0207669_10396791 | 3300025937 | Bacteria | 1079 |
| 187 | Ga0207669_10764901 | 3300025937 | Bacteria | 799 |
| 188 | Ga0207704_10016265 | 3300025938 | Bacteria | 3819 |
| 189 | Ga0207704_10094487 | 3300025938 | Bacteria | 1974 |
| 190 | Ga0207704_10457158 | 3300025938 | Bacteria | 1020 |
| 191 | Ga0207704_10695977 | 3300025938 | Bacteria | 841 |
| 192 | Ga0207665_10065735 | 3300025939 | Bacteria | 2466 |
| 193 | Ga0207691_10486908 | 3300025940 | Bacteria | 1048 |
| 194 | Ga0207711_10197786 | 3300025941 | Bacteria | 1834 |
| 195 | Ga0207689_10056644 | 3300025942 | Bacteria | 3226 |
| 196 | Ga0207689_10309195 | 3300025942 | Bacteria | 1311 |
| 197 | Ga0207667_10053503 | 3300025949 | Bacteria | 4248 |
| 198 | Ga0207651_10096953 | 3300025960 | Bacteria | 2176 |
| 199 | Ga0207651_10393571 | 3300025960 | Bacteria | 1177 |
| 200 | Ga0207651_10480144 | 3300025960 | Bacteria | 1071 |
| 201 | Ga0207712_10045602 | 3300025961 | Bacteria | 3036 |
| 202 | Ga0207668_10110057 | 3300025972 | Bacteria | 2065 |
| 203 | Ga0207668_10646579 | 3300025972 | Bacteria | 925 |
| 204 | Ga0207640_10398982 | 3300025981 | Bacteria | 1119 |
| 205 | Ga0207658_10697793 | 3300025986 | Bacteria | 917 |
| 206 | Ga0207658_11396921 | 3300025986 | Bacteria | 640 |
| 207 | Ga0207677_11071491 | 3300026023 | Bacteria | 734 |
| 208 | Ga0207677_11524379 | 3300026023 | Bacteria | 618 |
| 209 | Ga0207703_10109980 | 3300026035 | Bacteria | 2350 |
| 210 | Ga0207678_10146483 | 3300026067 | Bacteria | 2015 |
| 211 | Ga0207678_10192484 | 3300026067 | Bacteria | 1743 |
| 212 | Ga0207708_10053340 | 3300026075 | Bacteria | 3081 |
| 213 | Ga0207708_10147530 | 3300026075 | Bacteria | 1849 |
| 214 | Ga0207641_10039796 | 3300026088 | Bacteria | 3933 |
| 215 | Ga0207641_10318287 | 3300026088 | Bacteria | 1475 |
| 216 | Ga0207641_11439400 | 3300026088 | Bacteria | 690 |
| 217 | Ga0207648_10002481 | 3300026089 | Bacteria | 19810 |
| 218 | Ga0207648_11120321 | 3300026089 | Bacteria | 738 |
| 219 | Ga0207676_10178351 | 3300026095 | Bacteria | 1858 |
| 220 | Ga0207676_10874543 | 3300026095 | Bacteria | 880 |
| 221 | Ga0207674_10192176 | 3300026116 | Bacteria | 1991 |
| 222 | Ga0207675_100000738 | 3300026118 | Bacteria | 32437 |
| 223 | Ga0207675_100009279 | 3300026118 | Bacteria | 9227 |
| 224 | Ga0207675_100484854 | 3300026118 | Bacteria | 1229 |
| 225 | Ga0207683_10192077 | 3300026121 | Bacteria | 1854 |
| 226 | Ga0207683_10708977 | 3300026121 | Bacteria | 933 |
| 227 | Ga0207698_10032433 | 3300026142 | Bacteria | 3784 |
| 228 | Ga0209981_1021988 | 3300027378 | Bacteria | 913 |
| 229 | Ga0209996_1007946 | 3300027395 | Bacteria | 1386 |
| 230 | Ga0209995_1012200 | 3300027471 | Bacteria | 1401 |
| 231 | Ga0209968_1002540 | 3300027526 | Bacteria | 2751 |
| 232 | Ga0209999_1015476 | 3300027543 | Bacteria | 1388 |
| 233 | Ga0209966_1000001 | 3300027695 | Bacteria | 139125 |
| 234 | Ga0207428_10001508 | 3300027907 | Bacteria | 24337 |
| 235 | Ga0207428_10543729 | 3300027907 | Bacteria | 840 |
| 236 | Ga0268266_10105590 | 3300028379 | Bacteria | 2489 |
| 237 | Ga0268266_10140992 | 3300028379 | Bacteria | 2163 |
| 238 | Ga0268265_10005309 | 3300028380 | Bacteria | 8830 |
| 239 | Ga0268265_10038468 | 3300028380 | Bacteria | 3519 |
| 240 | Ga0268265_10252805 | 3300028380 | Bacteria | 1562 |
| 241 | Ga0268264_10004254 | 3300028381 | Bacteria | 12219 |
| 242 | Ga0268264_10566238 | 3300028381 | Bacteria | 1116 |
| 243 | Ga0307515_10006495 | 3300028794 | Bacteria | 23397 |
| 244 | Ga0307515_10229316 | 3300028794 | Bacteria | 1654 |
| 245 | Ga0265762_1020541 | 3300030760 | Bacteria | 1215 |
| 246 | Ga0265340_10100391 | 3300031247 | Bacteria | 1345 |
| 247 | Ga0307513_10021824 | 3300031456 | Bacteria | 7548 |
| 248 | Ga0307408_100098797 | 3300031548 | Bacteria | 2220 |
| 249 | Ga0307405_10338506 | 3300031731 | Bacteria | 1156 |
| 250 | Ga0307405_10917778 | 3300031731 | Bacteria | 742 |
| 251 | Ga0307405_11046604 | 3300031731 | Bacteria | 699 |
| 252 | Ga0307413_10089002 | 3300031824 | Bacteria | 2004 |
| 253 | Ga0307413_10243880 | 3300031824 | Bacteria | 1328 |
| 254 | Ga0307413_10275197 | 3300031824 | Bacteria | 1263 |
| 255 | Ga0307413_11099302 | 3300031824 | Bacteria | 687 |
| 256 | Ga0307410_10022166 | 3300031852 | Bacteria | 3920 |
| 257 | Ga0307410_10033204 | 3300031852 | Bacteria | 3330 |
| 258 | Ga0307410_10321200 | 3300031852 | Bacteria | 1228 |
| 259 | Ga0307406_10062211 | 3300031901 | Bacteria | 2414 |
| 260 | Ga0307406_10468007 | 3300031901 | Bacteria | 1015 |
| 261 | Ga0307407_10063025 | 3300031903 | Bacteria | 2173 |
| 262 | Ga0307407_10531695 | 3300031903 | Bacteria | 866 |
| 263 | Ga0307412_10313417 | 3300031911 | Bacteria | 1245 |
| 264 | Ga0307412_10562745 | 3300031911 | Bacteria | 959 |
| 265 | Ga0307409_100006954 | 3300031995 | Bacteria | 6719 |
| 266 | Ga0307409_100016465 | 3300031995 | Bacteria | 4892 |
| 267 | Ga0307409_100061135 | 3300031995 | Bacteria | 2942 |
| 268 | Ga0307409_101255702 | 3300031995 | Bacteria | 765 |
| 269 | Ga0307416_100183384 | 3300032002 | Bacteria | 1964 |
| 270 | Ga0307416_100412445 | 3300032002 | Bacteria | 1392 |
| 271 | Ga0307416_100657730 | 3300032002 | Bacteria | 1133 |
| 272 | Ga0307416_102624539 | 3300032002 | Bacteria | 601 |
| 273 | Ga0307414_10260166 | 3300032004 | Bacteria | 1448 |
| 274 | Ga0307414_10576816 | 3300032004 | Bacteria | 1006 |
| 275 | Ga0307411_10039548 | 3300032005 | Bacteria | 2984 |
| 276 | Ga0307411_10106401 | 3300032005 | Bacteria | 1996 |
| 277 | Ga0307411_10290339 | 3300032005 | Bacteria | 1306 |
| 278 | Ga0307411_10401048 | 3300032005 | Bacteria | 1134 |
| 279 | Ga0307415_100836804 | 3300032126 | Bacteria | 843 |
| 280 | Ga0373932_0047877 | 3300035112 | Bacteria | 1258 |
| 281 | Ga0373946_0151072 | 3300035171 | Bacteria | 1084 |
| 282 | Ga0373924_0365736 | 3300035410 | Bacteria | 643 |
| 283 | Ga0373927_0344136 | 3300035695 | Bacteria | 982 |
| 284 | Ga0373947_0191067 | 3300035725 | Bacteria | 1336 |
| 285 | Ga0373937_0170035 | 3300036401 | Bacteria | 2045 |
| 286 | Ga0373925_0019888 | 3300037068 | Bacteria | 4884 |
| 287 | Ga0373925_0084790 | 3300037068 | Bacteria | 2415 |
| 288 | Ga0395899_0300017 | 3300037312 | Bacteria | 1087 |
| 289 | Ga0395900_0000109 | 3300037418 | Bacteria | 146053 |
| 290 | Ga0395900_0037275 | 3300037418 | Bacteria | 5014 |
| 291 | Ga0395900_0235102 | 3300037418 | Bacteria | 1841 |
| 292 | Ga0395898_0000868 | 3300037466 | Bacteria | 49428 |
| 293 | Ga0395898_0059151 | 3300037466 | Bacteria | 3729 |
| 294 | Ga0395905_0015072 | 3300037471 | Bacteria | 7363 |
| 295 | Ga0395905_0044531 | 3300037471 | Bacteria | 4165 |
| 296 | Ga0395905_0356852 | 3300037471 | Bacteria | 1354 |
| 297 | Ga0395905_0486193 | 3300037471 | Bacteria | 1134 |
| 298 | Ga0395901_0000034 | 3300038443 | Bacteria | 230365 |
| 299 | Ga0395901_0388637 | 3300038443 | Bacteria | 1435 |
| 300 | Ga0395901_1351599 | 3300038443 | Bacteria | 672 |
| 301 | Ga0436365_0763559 | 3300039437 | Bacteria | 1218 |
| 302 | Ga0436360_0708455 | 3300039438 | Bacteria | 1779 |
| 303 | Ga0436363_1016859 | 3300039450 | Bacteria | 1061 |
| 304 | Ga0436363_1263821 | 3300039450 | Bacteria | 939 |
| 305 | Ga0439436_0114397 | 3300041404 | Bacteria | 754 |
| 306 | Ga0439461_0078139 | 3300041410 | Bacteria | 777 |
| 307 | Ga0439465_0150332 | 3300041413 | Bacteria | 831 |
| 308 | Ga0451791_1757947 | 3300041451 | Bacteria | 528 |
| 309 | Ga0451795_0350967 | 3300041456 | Bacteria | 576 |
| 310 | Ga0451843_0525946 | 3300041509 | Bacteria | 1319 |
| 311 | Ga0439432_119988 | 3300042006 | Bacteria | 779 |
| 312 | Ga0439454_007975 | 3300042011 | Bacteria | 1341 |
| 313 | Ga0439455_0020321 | 3300042012 | Bacteria | 1574 |
| 314 | Ga0450921_038294 | 3300042123 | Bacteria | 507 |
| 315 | Ga0450896_078199 | 3300042133 | Bacteria | 555 |
| 316 | Ga0439458_0152469 | 3300042157 | Bacteria | 620 |
| 317 | Ga0450893_0009449 | 3300042532 | Bacteria | 1593 |
| 318 | Ga0451577_0001509 | 3300042876 | Bacteria | 30757 |
| 319 | Ga0451577_0002068 | 3300042876 | Bacteria | 24786 |
| 320 | Ga0451577_0029130 | 3300042876 | Bacteria | 4991 |
| 321 | Ga0451577_0161635 | 3300042876 | Bacteria | 2017 |
| 322 | Ga0466969_0000385 | 3300044656 | Bacteria | 24302 |
| 323 | Ga0466969_0004246 | 3300044656 | Bacteria | 7619 |
| 324 | Ga0466969_0058054 | 3300044656 | Bacteria | 1884 |
| 325 | Ga0466969_0063985 | 3300044656 | Bacteria | 1781 |
| 326 | Ga0466972_0081430 | 3300044658 | Bacteria | 1541 |
| 327 | Ga0466965_0004790 | 3300044683 | Bacteria | 6034 |
| 328 | Ga0466965_0011530 | 3300044683 | Bacteria | 4147 |
| 329 | Ga0466965_0013111 | 3300044683 | Bacteria | 3907 |
| 330 | Ga0466965_0127947 | 3300044683 | Bacteria | 1315 |
| 331 | Ga0466966_0006769 | 3300044684 | Bacteria | 7588 |
| 332 | Ga0466966_0008119 | 3300044684 | Bacteria | 6959 |
| 333 | Ga0466966_0114503 | 3300044684 | Bacteria | 1660 |
| 334 | Ga0466966_0501182 | 3300044684 | Bacteria | 730 |
| 335 | Ga0466961_0016947 | 3300044693 | Bacteria | 4681 |
| 336 | Ga0466961_0024171 | 3300044693 | Bacteria | 3907 |
| 337 | Ga0466961_0034680 | 3300044693 | Bacteria | 3239 |
| 338 | Ga0466963_0037912 | 3300044694 | Bacteria | 3150 |
| 339 | Ga0466964_0004724 | 3300044706 | Bacteria | 5032 |
| 340 | Ga0466964_0170101 | 3300044706 | Bacteria | 1025 |
| 341 | Ga0453684_0034917 | 3300044712 | Bacteria | 6964 |
| 342 | Ga0453684_0107132 | 3300044712 | Bacteria | 3404 |
| 343 | Ga0466971_0049165 | 3300044719 | Bacteria | 1897 |
| 344 | Ga0466971_0083046 | 3300044719 | Bacteria | 1462 |
| 345 | Ga0466971_0460213 | 3300044719 | Bacteria | 624 |
| 346 | Ga0466968_0055678 | 3300044735 | Bacteria | 1697 |
| 347 | Ga0466968_0114921 | 3300044735 | Bacteria | 1213 |
| 348 | Ga0466968_0133716 | 3300044735 | Bacteria | 1130 |
| 349 | Ga0466970_0006015 | 3300044765 | Bacteria | 6049 |
| 350 | Ga0466970_0031405 | 3300044765 | Bacteria | 2805 |
| 351 | Ga0466970_0341655 | 3300044765 | Bacteria | 848 |
| 352 | Ga0466957_0008708 | 3300044842 | Bacteria | 5780 |
| 353 | Ga0466957_0033045 | 3300044842 | Bacteria | 3102 |
| 354 | Ga0466957_0065983 | 3300044842 | Bacteria | 2230 |
| 355 | Ga0466957_0134428 | 3300044842 | Bacteria | 1588 |
| 356 | Ga0466959_0000371 | 3300045049 | Bacteria | 26505 |
| 357 | Ga0466959_0019821 | 3300045049 | Bacteria | 4949 |
| 358 | Ga0466959_0068137 | 3300045049 | Bacteria | 2579 |
| 359 | Ga0466959_0230665 | 3300045049 | Bacteria | 1281 |
| 360 | Ga0451576_0050384 | 3300045051 | Bacteria | 4367 |
| 361 | Ga0451576_0165519 | 3300045051 | Bacteria | 2307 |
| 362 | Ga0466958_0064403 | 3300045836 | Bacteria | 2235 |
| 363 | Ga0466967_0029942 | 3300045976 | Bacteria | 4562 |
| 364 | Ga0466967_0834771 | 3300045976 | Bacteria | 915 |
| 365 | Ga0495603_0483499 | 3300046455 | Bacteria | 709 |
| 366 | Ga0495591_057177 | 3300046458 | Bacteria | 1047 |
| 367 | Ga0495638_0027785 | 3300046460 | Bacteria | 3659 |
| 368 | Ga0495605_0002703 | 3300046474 | Bacteria | 10844 |
| 369 | Ga0495584_0035996 | 3300046491 | Bacteria | 2501 |
| 370 | Ga0495585_0100349 | 3300046492 | Bacteria | 1548 |
| 371 | Ga0495596_0103798 | 3300046500 | Bacteria | 1104 |
| 372 | Ga0495596_0156998 | 3300046500 | Bacteria | 884 |
| 373 | Ga0495607_0063268 | 3300046501 | Bacteria | 2094 |
| 374 | Ga0495616_0256712 | 3300046513 | Bacteria | 749 |
| 375 | Ga0495620_0354730 | 3300046515 | Bacteria | 556 |
| 376 | Ga0495644_0233840 | 3300046523 | Bacteria | 712 |
| 377 | Ga0495668_0084078 | 3300046616 | Bacteria | 1745 |
| 378 | Ga0495625_0047245 | 3300046660 | Bacteria | 3104 |
| 379 | Ga0495647_0103716 | 3300046681 | Bacteria | 1180 |
| 380 | Ga0495670_0063648 | 3300046691 | Bacteria | 1857 |
| 381 | Ga0495589_0007503 | 3300046794 | Bacteria | 5715 |
| 382 | Ga0495636_0067752 | 3300047318 | Bacteria | 1519 |
| 383 | Ga0495677_0119164 | 3300047445 | Bacteria | 1006 |
| 384 | Ga0495685_224418 | 3300047447 | Bacteria | 599 |
| 385 | Ga0496100_0298902 | 3300048903 | Bacteria | 1204 |
| 386 | Ga0496101_0066810 | 3300048904 | Bacteria | 2624 |
| 387 | Ga0496102_0440243 | 3300048905 | Bacteria | 1223 |
| 388 | Ga0496103_0238298 | 3300048906 | Bacteria | 1170 |
| 389 | Ga0496104_0158503 | 3300048907 | Bacteria | 2171 |
| 390 | Ga0496106_0089038 | 3300048909 | Bacteria | 2380 |
| 391 | Ga0496106_0539501 | 3300048909 | Bacteria | 936 |
| 392 | Ga0496107_0029263 | 3300048910 | Bacteria | 3918 |
| 393 | Ga0496107_0180875 | 3300048910 | Bacteria | 1566 |
| 394 | Ga0496108_0393542 | 3300048911 | Bacteria | 1210 |
| 395 | Ga0496110_0055321 | 3300048913 | Bacteria | 3491 |
| 396 | Ga0496110_0269288 | 3300048913 | Bacteria | 1551 |
| 397 | Ga0496112_0345302 | 3300048915 | Bacteria | 1431 |
| 398 | Ga0496112_1039726 | 3300048915 | Bacteria | 738 |
| 399 | Ga0496114_0164802 | 3300048917 | Bacteria | 1929 |
| 400 | Ga0496114_0305742 | 3300048917 | Bacteria | 1404 |
| 401 | Ga0496114_1227508 | 3300048917 | Bacteria | 636 |
| 402 | Ga0496115_0659536 | 3300048918 | Bacteria | 826 |
| 403 | Ga0496121_0005472 | 3300048924 | Bacteria | 16262 |
| 404 | Ga0496123_0161144 | 3300048926 | Bacteria | 1196 |
| 405 | Ga0496125_0008779 | 3300048928 | Bacteria | 10512 |
| 406 | Ga0501308_000354 | 3300049128 | Bacteria | 2888 |
| 407 | Ga0501304_008706 | 3300049160 | Bacteria | 859 |
| 408 | Ga0501312_022972 | 3300049528 | Bacteria | 937 |
| 409 | Ga0501034_0000782 | 3300049571 | Bacteria | 47617 |
| 410 | Ga0501036_0012821 | 3300049572 | Bacteria | 6956 |
| 411 | Ga0501037_0001742 | 3300049573 | Bacteria | 15796 |
| 412 | Ga0501038_0019217 | 3300049574 | Bacteria | 6161 |
| 413 | Ga0501038_0829491 | 3300049574 | Bacteria | 686 |
| 414 | Ga0501039_0818607 | 3300049575 | Bacteria | 726 |
| 415 | Ga0501040_0569152 | 3300049576 | Bacteria | 818 |
| 416 | Ga0501040_0990743 | 3300049576 | Bacteria | 609 |
| 417 | Ga0501043_0010954 | 3300049579 | Bacteria | 7104 |
| 418 | Ga0501043_0417886 | 3300049579 | Bacteria | 1011 |
| 419 | Ga0501046_0191879 | 3300049580 | Bacteria | 1523 |
| 420 | Ga0501046_0471045 | 3300049580 | Bacteria | 902 |
| 421 | Ga0501047_0003501 | 3300049581 | Bacteria | 14834 |
| 422 | Ga0501047_0270217 | 3300049581 | Bacteria | 1546 |
| 423 | Ga0501048_0327676 | 3300049582 | Bacteria | 1091 |
| 424 | Ga0501068_0498287 | 3300049584 | Bacteria | 790 |
| 425 | Ga0501070_1356794 | 3300049586 | Bacteria | 541 |
| 426 | Ga0501071_0051711 | 3300049587 | Bacteria | 2962 |
| 427 | Ga0501073_0011794 | 3300049589 | Bacteria | 6379 |
| 428 | Ga0501074_0018945 | 3300049590 | Bacteria | 5000 |
| 429 | Ga0501074_0707138 | 3300049590 | Bacteria | 711 |
| 430 | Ga0501222_003042 | 3300049662 | Bacteria | 2305 |
| 431 | Ga0501248_003193 | 3300049678 | Bacteria | 1168 |
| 432 | Ga0501080_0001498 | 3300049742 | Bacteria | 19702 |
| 433 | Ga0501080_0011561 | 3300049742 | Bacteria | 8084 |
| 434 | Ga0501083_0028970 | 3300049744 | Bacteria | 3813 |
| 435 | Ga0501035_0031986 | 3300049822 | Bacteria | 4791 |
| 436 | Ga0501035_0734891 | 3300049822 | Bacteria | 793 |
| 437 | Ga0501044_0027547 | 3300049823 | Bacteria | 6004 |
| 438 | Ga0501044_0070992 | 3300049823 | Bacteria | 3542 |
| 439 | Ga0501044_0562340 | 3300049823 | Bacteria | 1037 |
| 440 | nmdc:mga03683_391187_c1 | 3300050489 | Bacteria | 663 |
| 441 | nmdc:mga00v17_10262_c1 | 3300050491 | Bacteria | 5107 |
| 442 | nmdc:mga0k408_130108_c1 | 3300050493 | Bacteria | 1494 |
| 443 | nmdc:mga0k408_184286_c1 | 3300050493 | Bacteria | 1245 |
| 444 | nmdc:mga0k408_23053_c1 | 3300050493 | Bacteria | 3509 |
| 445 | nmdc:mga0k408_36032_c1 | 3300050493 | Bacteria | 2838 |
| 446 | nmdc:mga0k408_567323_c1 | 3300050493 | Bacteria | 670 |
| 447 | nmdc:mga0k408_71133_c1 | 3300050493 | Bacteria | 2030 |
| 448 | nmdc:mga0k408_96536_c1 | 3300050493 | Bacteria | 1740 |
| 449 | nmdc:mga06z11_190279_c1 | 3300050494 | Bacteria | 1187 |
| 450 | nmdc:mga07m45_4922_c1 | 3300050496 | Bacteria | 6581 |
| 451 | nmdc:mga09592_3159_c1 | 3300050508 | Bacteria | 13376 |
| 452 | nmdc:mga09592_85620_c1 | 3300050508 | Bacteria | 2688 |
| 453 | nmdc:mga08y16_1378_c1 | 3300050511 | Bacteria | 24279 |
| 454 | nmdc:mga08y16_928350_c1 | 3300050511 | Bacteria | 855 |
| 455 | nmdc:mga0n895_108750_c1 | 3300050512 | Bacteria | 2787 |
| 456 | nmdc:mga0sz30_17214_c1 | 3300050516 | Bacteria | 2880 |
| 457 | Ga0500573_0085281 | 3300053140 | Bacteria | 1791 |
| 458 | Ga0500611_118544 | 3300053727 | Bacteria | 703 |
| 459 | Ga0501084_1310832 | 3300054114 | Bacteria | 607 |
| 460 | Ga0587070_080667 | 3300059491 | Bacteria | 713 |
| 461 | Ga0501082_0035136 | 3300060353 | Bacteria | 4320 |
| 462 | Ga0466962_0038021 | 3300061719 | Bacteria | 2305 |
| 463 | Ga0466962_0052241 | 3300061719 | Bacteria | 1953 |
| 464 | Ga0466962_0248603 | 3300061719 | Bacteria | 873 |
| 465 | Ga0530510_0326330 | 3300061734 | Bacteria | 1151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005546 | Ga0070696_100000379 | Ga0070696_10000037911 | 110 |
| 2 | 3300006195 | Ga0075366_10133151 | Ga0075366_101331512 | 114 |
| 3 | 3300006353 | Ga0075370_10011625 | Ga0075370_100116254 | 114 |
| 4 | 3300030760 | Ga0265762_1020541 | Ga0265762_10205412 | 114 |
| 5 | 3300050489 | nmdc:mga03683_391187_c1 | nmdc:mga03683_391187_c1_176_625 | 114 |
| 6 | 3300050493 | nmdc:mga0k408_130108_c1 | nmdc:mga0k408_130108_c1_542_991 | 114 |
| 7 | 3300050496 | nmdc:mga07m45_4922_c1 | nmdc:mga07m45_4922_c1_4161_4610 | 114 |
| 8 | 3300037471 | Ga0395905_0044531 | Ga0395905_0044531_2273_2722 | 115 |
| 9 | iso_pu_bacteria | 2526164713 | 2527079590 | 120 |
| 10 | iso_pu_bacteria | 2834641062 | 2834644818 | 120 |
| 11 | iso_pu_bacteria | 2939631187 | 2939632925 | 120 |
| 12 | iso_pu_bacteria | 8003400568 | 8003401828 | 120 |
| 13 | 3300009176 | Ga0105242_11406720 | Ga0105242_114067202 | 122 |
| 14 | 3300010159 | Ga0099796_10204413 | Ga0099796_102044132 | 122 |
| 15 | 3300046515 | Ga0495620_0354730 | Ga0495620_0354730_35_481 | 122 |
| 16 | 3300005364 | Ga0070673_100816739 | Ga0070673_1008167391 | 123 |
| 17 | 3300005578 | Ga0068854_101872772 | Ga0068854_1018727721 | 123 |
| 18 | 3300007265 | Ga0099794_10024456 | Ga0099794_100244564 | 123 |
| 19 | 3300013297 | Ga0157378_10963415 | Ga0157378_109634152 | 123 |
| 20 | 3300025893 | Ga0207682_10134882 | Ga0207682_101348823 | 123 |
| 21 | 3300025960 | Ga0207651_10480144 | Ga0207651_104801443 | 123 |
| 22 | 3300044712 | Ga0453684_0034917 | Ga0453684_0034917_780_1223 | 123 |
| 23 | 3300045051 | Ga0451576_0165519 | Ga0451576_0165519_280_723 | 123 |
| 24 | 3300046455 | Ga0495603_0483499 | Ga0495603_0483499_82_528 | 123 |
| 25 | 3300046500 | Ga0495596_0156998 | Ga0495596_0156998_366_812 | 123 |
| 26 | 3300003214 | JGI25165J46597_1001030 | JGI25165J46597_100103014 | 124 |
| 27 | 3300005327 | Ga0070658_10888916 | Ga0070658_108889161 | 124 |
| 28 | 3300005328 | Ga0070676_10260923 | Ga0070676_102609232 | 124 |
| 29 | 3300005330 | Ga0070690_100033755 | Ga0070690_1000337554 | 124 |
| 30 | 3300005334 | Ga0068869_100317678 | Ga0068869_1003176783 | 124 |
| 31 | 3300005336 | Ga0070680_100024022 | Ga0070680_1000240224 | 124 |
| 32 | 3300005337 | Ga0070682_100056349 | Ga0070682_1000563493 | 124 |
| 33 | 3300005339 | Ga0070660_100737793 | Ga0070660_1007377931 | 124 |
| 34 | 3300005340 | Ga0070689_100172765 | Ga0070689_1001727651 | 124 |
| 35 | 3300005340 | Ga0070689_100656800 | Ga0070689_1006568002 | 124 |
| 36 | 3300005343 | Ga0070687_100286100 | Ga0070687_1002861002 | 124 |
| 37 | 3300005343 | Ga0070687_100301663 | Ga0070687_1003016632 | 124 |
| 38 | 3300005345 | Ga0070692_10160177 | Ga0070692_101601772 | 124 |
| 39 | 3300005347 | Ga0070668_101142414 | Ga0070668_1011424141 | 124 |
| 40 | 3300005347 | Ga0070668_101788352 | Ga0070668_1017883521 | 124 |
| 41 | 3300005353 | Ga0070669_100260405 | Ga0070669_1002604052 | 124 |
| 42 | 3300005354 | Ga0070675_100368048 | Ga0070675_1003680482 | 124 |
| 43 | 3300005354 | Ga0070675_100599610 | Ga0070675_1005996101 | 124 |
| 44 | 3300005356 | Ga0070674_100057181 | Ga0070674_1000571812 | 124 |
| 45 | 3300005356 | Ga0070674_100073544 | Ga0070674_1000735442 | 124 |
| 46 | 3300005356 | Ga0070674_101340365 | Ga0070674_1013403651 | 124 |
| 47 | 3300005356 | Ga0070674_101900798 | Ga0070674_1019007981 | 124 |
| 48 | 3300005438 | Ga0070701_10034586 | Ga0070701_100345863 | 124 |
| 49 | 3300005439 | Ga0070711_100051970 | Ga0070711_1000519703 | 124 |
| 50 | 3300005440 | Ga0070705_100011290 | Ga0070705_1000112905 | 124 |
| 51 | 3300005441 | Ga0070700_100051444 | Ga0070700_1000514444 | 124 |
| 52 | 3300005441 | Ga0070700_101165207 | Ga0070700_1011652071 | 124 |
| 53 | 3300005444 | Ga0070694_100056259 | Ga0070694_1000562594 | 124 |
| 54 | 3300005455 | Ga0070663_100176371 | Ga0070663_1001763712 | 124 |
| 55 | 3300005456 | Ga0070678_100324273 | Ga0070678_1003242732 | 124 |
| 56 | 3300005456 | Ga0070678_100348420 | Ga0070678_1003484203 | 124 |
| 57 | 3300005457 | Ga0070662_100756890 | Ga0070662_1007568902 | 124 |
| 58 | 3300005459 | Ga0068867_100001695 | Ga0068867_1000016955 | 124 |
| 59 | 3300005459 | Ga0068867_100249172 | Ga0068867_1002491722 | 124 |
| 60 | 3300005459 | Ga0068867_101331705 | Ga0068867_1013317051 | 124 |
| 61 | 3300005459 | Ga0068867_102037535 | Ga0068867_1020375351 | 124 |
| 62 | 3300005466 | Ga0070685_10311745 | Ga0070685_103117452 | 124 |
| 63 | 3300005530 | Ga0070679_100036124 | Ga0070679_1000361244 | 124 |
| 64 | 3300005539 | Ga0068853_100486513 | Ga0068853_1004865131 | 124 |
| 65 | 3300005539 | Ga0068853_100812230 | Ga0068853_1008122301 | 124 |
| 66 | 3300005539 | Ga0068853_101359973 | Ga0068853_1013599732 | 124 |
| 67 | 3300005543 | Ga0070672_100152671 | Ga0070672_1001526711 | 124 |
| 68 | 3300005543 | Ga0070672_100570285 | Ga0070672_1005702852 | 124 |
| 69 | 3300005544 | Ga0070686_100056706 | Ga0070686_1000567063 | 124 |
| 70 | 3300005544 | Ga0070686_101000778 | Ga0070686_1010007781 | 124 |
| 71 | 3300005545 | Ga0070695_100041922 | Ga0070695_1000419224 | 124 |
| 72 | 3300005546 | Ga0070696_100012855 | Ga0070696_1000128554 | 124 |
| 73 | 3300005547 | Ga0070693_100311910 | Ga0070693_1003119102 | 124 |
| 74 | 3300005547 | Ga0070693_100544857 | Ga0070693_1005448572 | 124 |
| 75 | 3300005548 | Ga0070665_100010309 | Ga0070665_1000103093 | 124 |
| 76 | 3300005548 | Ga0070665_100060219 | Ga0070665_1000602193 | 124 |
| 77 | 3300005548 | Ga0070665_100131117 | Ga0070665_1001311172 | 124 |
| 78 | 3300005548 | Ga0070665_100225913 | Ga0070665_1002259133 | 124 |
| 79 | 3300005549 | Ga0070704_101572431 | Ga0070704_1015724311 | 124 |
| 80 | 3300005563 | Ga0068855_100163952 | Ga0068855_1001639522 | 124 |
| 81 | 3300005564 | Ga0070664_100380459 | Ga0070664_1003804593 | 124 |
| 82 | 3300005577 | Ga0068857_100486836 | Ga0068857_1004868362 | 124 |
| 83 | 3300005578 | Ga0068854_100486688 | Ga0068854_1004866882 | 124 |
| 84 | 3300005615 | Ga0070702_100185945 | Ga0070702_1001859452 | 124 |
| 85 | 3300005616 | Ga0068852_100009907 | Ga0068852_1000099073 | 124 |
| 86 | 3300005616 | Ga0068852_100882306 | Ga0068852_1008823062 | 124 |
| 87 | 3300005617 | Ga0068859_100050338 | Ga0068859_1000503385 | 124 |
| 88 | 3300005617 | Ga0068859_100237912 | Ga0068859_1002379123 | 124 |
| 89 | 3300005617 | Ga0068859_100286751 | Ga0068859_1002867511 | 124 |
| 90 | 3300005617 | Ga0068859_100571179 | Ga0068859_1005711793 | 124 |
| 91 | 3300005617 | Ga0068859_100779426 | Ga0068859_1007794262 | 124 |
| 92 | 3300005618 | Ga0068864_100205178 | Ga0068864_1002051783 | 124 |
| 93 | 3300005718 | Ga0068866_10037278 | Ga0068866_100372783 | 124 |
| 94 | 3300005718 | Ga0068866_10148489 | Ga0068866_101484892 | 124 |
| 95 | 3300005719 | Ga0068861_100000582 | Ga0068861_1000005824 | 124 |
| 96 | 3300005719 | Ga0068861_100002436 | Ga0068861_1000024365 | 124 |
| 97 | 3300005719 | Ga0068861_101129306 | Ga0068861_1011293061 | 124 |
| 98 | 3300005841 | Ga0068863_100048521 | Ga0068863_1000485216 | 124 |
| 99 | 3300005841 | Ga0068863_101166252 | Ga0068863_1011662522 | 124 |
| 100 | 3300005842 | Ga0068858_100165433 | Ga0068858_1001654333 | 124 |
| 101 | 3300005842 | Ga0068858_100655028 | Ga0068858_1006550282 | 124 |
| 102 | 3300005843 | Ga0068860_100001910 | Ga0068860_10000191015 | 124 |
| 103 | 3300005843 | Ga0068860_100024966 | Ga0068860_1000249662 | 124 |
| 104 | 3300005844 | Ga0068862_100003469 | Ga0068862_10000346911 | 124 |
| 105 | 3300005844 | Ga0068862_100004043 | Ga0068862_10000404314 | 124 |
| 106 | 3300006051 | Ga0075364_10061759 | Ga0075364_100617593 | 124 |
| 107 | 3300006051 | Ga0075364_10133615 | Ga0075364_101336152 | 124 |
| 108 | 3300006051 | Ga0075364_10225422 | Ga0075364_102254223 | 124 |
| 109 | 3300006178 | Ga0075367_10491958 | Ga0075367_104919581 | 124 |
| 110 | 3300006186 | Ga0075369_10074691 | Ga0075369_100746912 | 124 |
| 111 | 3300006195 | Ga0075366_10015329 | Ga0075366_100153293 | 124 |
| 112 | 3300006195 | Ga0075366_10076116 | Ga0075366_100761162 | 124 |
| 113 | 3300006195 | Ga0075366_10199343 | Ga0075366_101993431 | 124 |
| 114 | 3300006237 | Ga0097621_100007196 | Ga0097621_1000071966 | 124 |
| 115 | 3300006237 | Ga0097621_100318118 | Ga0097621_1003181183 | 124 |
| 116 | 3300006237 | Ga0097621_101825564 | Ga0097621_1018255641 | 124 |
| 117 | 3300006358 | Ga0068871_100021745 | Ga0068871_1000217454 | 124 |
| 118 | 3300006358 | Ga0068871_100391773 | Ga0068871_1003917732 | 124 |
| 119 | 3300006844 | Ga0075428_100009589 | Ga0075428_1000095892 | 124 |
| 120 | 3300006844 | Ga0075428_101673882 | Ga0075428_1016738822 | 124 |
| 121 | 3300006846 | Ga0075430_100042814 | Ga0075430_1000428143 | 124 |
| 122 | 3300006871 | Ga0075434_100211297 | Ga0075434_1002112973 | 124 |
| 123 | 3300006880 | Ga0075429_100001027 | Ga0075429_1000010272 | 124 |
| 124 | 3300006880 | Ga0075429_100943244 | Ga0075429_1009432441 | 124 |
| 125 | 3300006881 | Ga0068865_100001694 | Ga0068865_10000169412 | 124 |
| 126 | 3300006881 | Ga0068865_101202119 | Ga0068865_1012021192 | 124 |
| 127 | 3300006931 | Ga0097620_100050336 | Ga0097620_1000503365 | 124 |
| 128 | 3300006931 | Ga0097620_100237917 | Ga0097620_1002379173 | 124 |
| 129 | 3300006931 | Ga0097620_100571180 | Ga0097620_1005711803 | 124 |
| 130 | 3300006931 | Ga0097620_100779417 | Ga0097620_1007794172 | 124 |
| 131 | 3300009094 | Ga0111539_10012497 | Ga0111539_100124973 | 124 |
| 132 | 3300009148 | Ga0105243_10020653 | Ga0105243_100206538 | 124 |
| 133 | 3300009148 | Ga0105243_12647501 | Ga0105243_126475011 | 124 |
| 134 | 3300009174 | Ga0105241_11710582 | Ga0105241_117105821 | 124 |
| 135 | 3300009177 | Ga0105248_11464868 | Ga0105248_114648682 | 124 |
| 136 | 3300009551 | Ga0105238_10139100 | Ga0105238_101391003 | 124 |
| 137 | 3300013105 | Ga0157369_11660015 | Ga0157369_116600151 | 124 |
| 138 | 3300013296 | Ga0157374_10025500 | Ga0157374_100255002 | 124 |
| 139 | 3300013297 | Ga0157378_10000558 | Ga0157378_1000055816 | 124 |
| 140 | 3300013297 | Ga0157378_10527560 | Ga0157378_105275602 | 124 |
| 141 | 3300013306 | Ga0163162_10002211 | Ga0163162_100022115 | 124 |
| 142 | 3300013306 | Ga0163162_10517998 | Ga0163162_105179982 | 124 |
| 143 | 3300013308 | Ga0157375_10266536 | Ga0157375_102665362 | 124 |
| 144 | 3300013308 | Ga0157375_10291884 | Ga0157375_102918842 | 124 |
| 145 | 3300013308 | Ga0157375_11713847 | Ga0157375_117138472 | 124 |
| 146 | 3300014326 | Ga0157380_10022686 | Ga0157380_100226864 | 124 |
| 147 | 3300014326 | Ga0157380_11103722 | Ga0157380_111037222 | 124 |
| 148 | 3300014497 | Ga0182008_10119373 | Ga0182008_101193732 | 124 |
| 149 | 3300014968 | Ga0157379_10294207 | Ga0157379_102942072 | 124 |
| 150 | 3300014968 | Ga0157379_11241663 | Ga0157379_112416632 | 124 |
| 151 | 3300014969 | Ga0157376_10247152 | Ga0157376_102471522 | 124 |
| 152 | 3300017792 | Ga0163161_10022683 | Ga0163161_100226835 | 124 |
| 153 | 3300017792 | Ga0163161_10437150 | Ga0163161_104371502 | 124 |
| 154 | 3300017792 | Ga0163161_10705556 | Ga0163161_107055562 | 124 |
| 155 | 3300021358 | Ga0213873_10137084 | Ga0213873_101370842 | 124 |
| 156 | 3300025231 | Ga0207427_103927 | Ga0207427_1039271 | 124 |
| 157 | 3300025256 | Ga0209759_1001704 | Ga0209759_100170414 | 124 |
| 158 | 3300025261 | Ga0209233_1000177 | Ga0209233_1000177111 | 124 |
| 159 | 3300025271 | Ga0207666_1008614 | Ga0207666_10086143 | 124 |
| 160 | 3300025885 | Ga0207653_10157580 | Ga0207653_101575802 | 124 |
| 161 | 3300025898 | Ga0207692_10311791 | Ga0207692_103117912 | 124 |
| 162 | 3300025898 | Ga0207692_10491713 | Ga0207692_104917131 | 124 |
| 163 | 3300025899 | Ga0207642_10101490 | Ga0207642_101014903 | 124 |
| 164 | 3300025899 | Ga0207642_10291387 | Ga0207642_102913873 | 124 |
| 165 | 3300025903 | Ga0207680_10631629 | Ga0207680_106316292 | 124 |
| 166 | 3300025905 | Ga0207685_10146088 | Ga0207685_101460881 | 124 |
| 167 | 3300025905 | Ga0207685_10222998 | Ga0207685_102229982 | 124 |
| 168 | 3300025906 | Ga0207699_10088549 | Ga0207699_100885492 | 124 |
| 169 | 3300025906 | Ga0207699_10581069 | Ga0207699_105810692 | 124 |
| 170 | 3300025907 | Ga0207645_10222979 | Ga0207645_102229791 | 124 |
| 171 | 3300025908 | Ga0207643_10008880 | Ga0207643_100088802 | 124 |
| 172 | 3300025908 | Ga0207643_10614500 | Ga0207643_106145002 | 124 |
| 173 | 3300025909 | Ga0207705_10794808 | Ga0207705_107948082 | 124 |
| 174 | 3300025909 | Ga0207705_11005936 | Ga0207705_110059362 | 124 |
| 175 | 3300025912 | Ga0207707_10067151 | Ga0207707_100671512 | 124 |
| 176 | 3300025915 | Ga0207693_10050535 | Ga0207693_100505353 | 124 |
| 177 | 3300025916 | Ga0207663_10489185 | Ga0207663_104891852 | 124 |
| 178 | 3300025917 | Ga0207660_10146686 | Ga0207660_101466864 | 124 |
| 179 | 3300025918 | Ga0207662_10354785 | Ga0207662_103547852 | 124 |
| 180 | 3300025919 | Ga0207657_10061961 | Ga0207657_100619615 | 124 |
| 181 | 3300025919 | Ga0207657_10899705 | Ga0207657_108997052 | 124 |
| 182 | 3300025921 | Ga0207652_10002539 | Ga0207652_1000253912 | 124 |
| 183 | 3300025923 | Ga0207681_10312833 | Ga0207681_103128332 | 124 |
| 184 | 3300025924 | Ga0207694_10176768 | Ga0207694_101767681 | 124 |
| 185 | 3300025926 | Ga0207659_10503147 | Ga0207659_105031472 | 124 |
| 186 | 3300025928 | Ga0207700_10104016 | Ga0207700_101040162 | 124 |
| 187 | 3300025928 | Ga0207700_11223431 | Ga0207700_112234312 | 124 |
| 188 | 3300025929 | Ga0207664_10107550 | Ga0207664_101075502 | 124 |
| 189 | 3300025931 | Ga0207644_10385972 | Ga0207644_103859722 | 124 |
| 190 | 3300025932 | Ga0207690_10473107 | Ga0207690_104731071 | 124 |
| 191 | 3300025933 | Ga0207706_10693401 | Ga0207706_106934012 | 124 |
| 192 | 3300025934 | Ga0207686_10263993 | Ga0207686_102639932 | 124 |
| 193 | 3300025935 | Ga0207709_10047935 | Ga0207709_100479352 | 124 |
| 194 | 3300025935 | Ga0207709_10180738 | Ga0207709_101807382 | 124 |
| 195 | 3300025936 | Ga0207670_10099386 | Ga0207670_100993861 | 124 |
| 196 | 3300025936 | Ga0207670_10255380 | Ga0207670_102553803 | 124 |
| 197 | 3300025937 | Ga0207669_10145601 | Ga0207669_101456013 | 124 |
| 198 | 3300025937 | Ga0207669_10226346 | Ga0207669_102263463 | 124 |
| 199 | 3300025937 | Ga0207669_10396791 | Ga0207669_103967912 | 124 |
| 200 | 3300025937 | Ga0207669_10764901 | Ga0207669_107649011 | 124 |
| 201 | 3300025938 | Ga0207704_10016265 | Ga0207704_100162652 | 124 |
| 202 | 3300025938 | Ga0207704_10094487 | Ga0207704_100944873 | 124 |
| 203 | 3300025938 | Ga0207704_10457158 | Ga0207704_104571582 | 124 |
| 204 | 3300025938 | Ga0207704_10695977 | Ga0207704_106959771 | 124 |
| 205 | 3300025939 | Ga0207665_10065735 | Ga0207665_100657352 | 124 |
| 206 | 3300025940 | Ga0207691_10486908 | Ga0207691_104869082 | 124 |
| 207 | 3300025941 | Ga0207711_10197786 | Ga0207711_101977863 | 124 |
| 208 | 3300025942 | Ga0207689_10056644 | Ga0207689_100566443 | 124 |
| 209 | 3300025942 | Ga0207689_10309195 | Ga0207689_103091953 | 124 |
| 210 | 3300025949 | Ga0207667_10053503 | Ga0207667_100535032 | 124 |
| 211 | 3300025960 | Ga0207651_10096953 | Ga0207651_100969531 | 124 |
| 212 | 3300025960 | Ga0207651_10393571 | Ga0207651_103935711 | 124 |
| 213 | 3300025961 | Ga0207712_10045602 | Ga0207712_100456022 | 124 |
| 214 | 3300025972 | Ga0207668_10110057 | Ga0207668_101100571 | 124 |
| 215 | 3300025972 | Ga0207668_10646579 | Ga0207668_106465792 | 124 |
| 216 | 3300025981 | Ga0207640_10398982 | Ga0207640_103989823 | 124 |
| 217 | 3300025986 | Ga0207658_10697793 | Ga0207658_106977931 | 124 |
| 218 | 3300025986 | Ga0207658_11396921 | Ga0207658_113969211 | 124 |
| 219 | 3300026023 | Ga0207677_11071491 | Ga0207677_110714912 | 124 |
| 220 | 3300026023 | Ga0207677_11524379 | Ga0207677_115243792 | 124 |
| 221 | 3300026035 | Ga0207703_10109980 | Ga0207703_101099804 | 124 |
| 222 | 3300026067 | Ga0207678_10146483 | Ga0207678_101464832 | 124 |
| 223 | 3300026067 | Ga0207678_10192484 | Ga0207678_101924843 | 124 |
| 224 | 3300026075 | Ga0207708_10053340 | Ga0207708_100533402 | 124 |
| 225 | 3300026075 | Ga0207708_10147530 | Ga0207708_101475304 | 124 |
| 226 | 3300026088 | Ga0207641_10039796 | Ga0207641_100397966 | 124 |
| 227 | 3300026088 | Ga0207641_10318287 | Ga0207641_103182873 | 124 |
| 228 | 3300026088 | Ga0207641_11439400 | Ga0207641_114394002 | 124 |
| 229 | 3300026089 | Ga0207648_10002481 | Ga0207648_100024814 | 124 |
| 230 | 3300026089 | Ga0207648_11120321 | Ga0207648_111203211 | 124 |
| 231 | 3300026095 | Ga0207676_10178351 | Ga0207676_101783513 | 124 |
| 232 | 3300026095 | Ga0207676_10874543 | Ga0207676_108745432 | 124 |
| 233 | 3300026116 | Ga0207674_10192176 | Ga0207674_101921763 | 124 |
| 234 | 3300026118 | Ga0207675_100000738 | Ga0207675_10000073823 | 124 |
| 235 | 3300026118 | Ga0207675_100009279 | Ga0207675_1000092794 | 124 |
| 236 | 3300026118 | Ga0207675_100484854 | Ga0207675_1004848542 | 124 |
| 237 | 3300026121 | Ga0207683_10192077 | Ga0207683_101920773 | 124 |
| 238 | 3300026121 | Ga0207683_10708977 | Ga0207683_107089773 | 124 |
| 239 | 3300026142 | Ga0207698_10032433 | Ga0207698_100324332 | 124 |
| 240 | 3300027378 | Ga0209981_1021988 | Ga0209981_10219881 | 124 |
| 241 | 3300027395 | Ga0209996_1007946 | Ga0209996_10079463 | 124 |
| 242 | 3300027471 | Ga0209995_1012200 | Ga0209995_10122003 | 124 |
| 243 | 3300027526 | Ga0209968_1002540 | Ga0209968_10025404 | 124 |
| 244 | 3300027543 | Ga0209999_1015476 | Ga0209999_10154763 | 124 |
| 245 | 3300027695 | Ga0209966_1000001 | Ga0209966_100000155 | 124 |
| 246 | 3300027907 | Ga0207428_10001508 | Ga0207428_1000150824 | 124 |
| 247 | 3300027907 | Ga0207428_10543729 | Ga0207428_105437293 | 124 |
| 248 | 3300028379 | Ga0268266_10105590 | Ga0268266_101055902 | 124 |
| 249 | 3300028379 | Ga0268266_10140992 | Ga0268266_101409923 | 124 |
| 250 | 3300028380 | Ga0268265_10005309 | Ga0268265_100053097 | 124 |
| 251 | 3300028380 | Ga0268265_10038468 | Ga0268265_100384684 | 124 |
| 252 | 3300028380 | Ga0268265_10252805 | Ga0268265_102528053 | 124 |
| 253 | 3300028381 | Ga0268264_10004254 | Ga0268264_1000425411 | 124 |
| 254 | 3300028381 | Ga0268264_10566238 | Ga0268264_105662382 | 124 |
| 255 | 3300028794 | Ga0307515_10006495 | Ga0307515_1000649511 | 124 |
| 256 | 3300028794 | Ga0307515_10229316 | Ga0307515_102293161 | 124 |
| 257 | 3300031247 | Ga0265340_10100391 | Ga0265340_101003912 | 124 |
| 258 | 3300031456 | Ga0307513_10021824 | Ga0307513_100218244 | 124 |
| 259 | 3300031548 | Ga0307408_100098797 | Ga0307408_1000987973 | 124 |
| 260 | 3300031731 | Ga0307405_10338506 | Ga0307405_103385062 | 124 |
| 261 | 3300031731 | Ga0307405_11046604 | Ga0307405_110466042 | 124 |
| 262 | 3300031824 | Ga0307413_10089002 | Ga0307413_100890022 | 124 |
| 263 | 3300031824 | Ga0307413_10243880 | Ga0307413_102438802 | 124 |
| 264 | 3300031824 | Ga0307413_10275197 | Ga0307413_102751972 | 124 |
| 265 | 3300031824 | Ga0307413_11099302 | Ga0307413_110993022 | 124 |
| 266 | 3300031852 | Ga0307410_10022166 | Ga0307410_100221664 | 124 |
| 267 | 3300031852 | Ga0307410_10033204 | Ga0307410_100332042 | 124 |
| 268 | 3300031852 | Ga0307410_10321200 | Ga0307410_103212003 | 124 |
| 269 | 3300031901 | Ga0307406_10062211 | Ga0307406_100622114 | 124 |
| 270 | 3300031901 | Ga0307406_10468007 | Ga0307406_104680072 | 124 |
| 271 | 3300031903 | Ga0307407_10063025 | Ga0307407_100630253 | 124 |
| 272 | 3300031903 | Ga0307407_10531695 | Ga0307407_105316951 | 124 |
| 273 | 3300031911 | Ga0307412_10313417 | Ga0307412_103134172 | 124 |
| 274 | 3300031911 | Ga0307412_10562745 | Ga0307412_105627452 | 124 |
| 275 | 3300031995 | Ga0307409_100006954 | Ga0307409_1000069543 | 124 |
| 276 | 3300031995 | Ga0307409_100016465 | Ga0307409_1000164656 | 124 |
| 277 | 3300031995 | Ga0307409_100061135 | Ga0307409_1000611352 | 124 |
| 278 | 3300031995 | Ga0307409_101255702 | Ga0307409_1012557022 | 124 |
| 279 | 3300032002 | Ga0307416_100183384 | Ga0307416_1001833842 | 124 |
| 280 | 3300032002 | Ga0307416_100412445 | Ga0307416_1004124453 | 124 |
| 281 | 3300032002 | Ga0307416_100657730 | Ga0307416_1006577302 | 124 |
| 282 | 3300032002 | Ga0307416_102624539 | Ga0307416_1026245391 | 124 |
| 283 | 3300032004 | Ga0307414_10260166 | Ga0307414_102601663 | 124 |
| 284 | 3300032004 | Ga0307414_10576816 | Ga0307414_105768162 | 124 |
| 285 | 3300032005 | Ga0307411_10039548 | Ga0307411_100395482 | 124 |
| 286 | 3300032005 | Ga0307411_10106401 | Ga0307411_101064013 | 124 |
| 287 | 3300032005 | Ga0307411_10290339 | Ga0307411_102903392 | 124 |
| 288 | 3300032005 | Ga0307411_10401048 | Ga0307411_104010482 | 124 |
| 289 | 3300032126 | Ga0307415_100836804 | Ga0307415_1008368042 | 124 |
| 290 | 3300035112 | Ga0373932_0047877 | Ga0373932_0047877_777_1223 | 124 |
| 291 | 3300035171 | Ga0373946_0151072 | Ga0373946_0151072_565_1011 | 124 |
| 292 | 3300035410 | Ga0373924_0365736 | Ga0373924_0365736_78_539 | 124 |
| 293 | 3300035695 | Ga0373927_0344136 | Ga0373927_0344136_265_726 | 124 |
| 294 | 3300035725 | Ga0373947_0191067 | Ga0373947_0191067_744_1205 | 124 |
| 295 | 3300036401 | Ga0373937_0170035 | Ga0373937_0170035_1115_1561 | 124 |
| 296 | 3300037068 | Ga0373925_0019888 | Ga0373925_0019888_1348_1809 | 124 |
| 297 | 3300037068 | Ga0373925_0084790 | Ga0373925_0084790_794_1240 | 124 |
| 298 | 3300037312 | Ga0395899_0300017 | Ga0395899_0300017_240_683 | 124 |
| 299 | 3300037418 | Ga0395900_0000109 | Ga0395900_0000109_107472_107918 | 124 |
| 300 | 3300037418 | Ga0395900_0037275 | Ga0395900_0037275_303_749 | 124 |
| 301 | 3300037418 | Ga0395900_0235102 | Ga0395900_0235102_913_1356 | 124 |
| 302 | 3300037466 | Ga0395898_0000868 | Ga0395898_0000868_16615_17061 | 124 |
| 303 | 3300037466 | Ga0395898_0059151 | Ga0395898_0059151_2521_2967 | 124 |
| 304 | 3300037471 | Ga0395905_0015072 | Ga0395905_0015072_5175_5618 | 124 |
| 305 | 3300037471 | Ga0395905_0356852 | Ga0395905_0356852_620_1066 | 124 |
| 306 | 3300037471 | Ga0395905_0486193 | Ga0395905_0486193_304_750 | 124 |
| 307 | 3300038443 | Ga0395901_0000034 | Ga0395901_0000034_25780_26226 | 124 |
| 308 | 3300038443 | Ga0395901_0388637 | Ga0395901_0388637_934_1377 | 124 |
| 309 | 3300038443 | Ga0395901_1351599 | Ga0395901_1351599_52_498 | 124 |
| 310 | 3300039437 | Ga0436365_0763559 | Ga0436365_0763559_145_591 | 124 |
| 311 | 3300039438 | Ga0436360_0708455 | Ga0436360_0708455_872_1315 | 124 |
| 312 | 3300039450 | Ga0436363_1016859 | Ga0436363_1016859_415_864 | 124 |
| 313 | 3300039450 | Ga0436363_1263821 | Ga0436363_1263821_467_913 | 124 |
| 314 | 3300041404 | Ga0439436_0114397 | Ga0439436_0114397_149_595 | 124 |
| 315 | 3300041410 | Ga0439461_0078139 | Ga0439461_0078139_263_709 | 124 |
| 316 | 3300041413 | Ga0439465_0150332 | Ga0439465_0150332_262_708 | 124 |
| 317 | 3300041451 | Ga0451791_1757947 | Ga0451791_1757947_60_506 | 124 |
| 318 | 3300041456 | Ga0451795_0350967 | Ga0451795_0350967_108_554 | 124 |
| 319 | 3300041509 | Ga0451843_0525946 | Ga0451843_0525946_13_459 | 124 |
| 320 | 3300042006 | Ga0439432_119988 | Ga0439432_119988_178_624 | 124 |
| 321 | 3300042011 | Ga0439454_007975 | Ga0439454_007975_726_1172 | 124 |
| 322 | 3300042012 | Ga0439455_0020321 | Ga0439455_0020321_461_907 | 124 |
| 323 | 3300042123 | Ga0450921_038294 | Ga0450921_038294_15_464 | 124 |
| 324 | 3300042133 | Ga0450896_078199 | Ga0450896_078199_10_456 | 124 |
| 325 | 3300042157 | Ga0439458_0152469 | Ga0439458_0152469_93_539 | 124 |
| 326 | 3300042532 | Ga0450893_0009449 | Ga0450893_0009449_22_468 | 124 |
| 327 | 3300042876 | Ga0451577_0001509 | Ga0451577_0001509_16047_16493 | 124 |
| 328 | 3300042876 | Ga0451577_0002068 | Ga0451577_0002068_8251_8706 | 124 |
| 329 | 3300042876 | Ga0451577_0161635 | Ga0451577_0161635_1538_1987 | 124 |
| 330 | 3300044656 | Ga0466969_0000385 | Ga0466969_0000385_23539_23985 | 124 |
| 331 | 3300044656 | Ga0466969_0004246 | Ga0466969_0004246_4687_5133 | 124 |
| 332 | 3300044656 | Ga0466969_0058054 | Ga0466969_0058054_360_806 | 124 |
| 333 | 3300044656 | Ga0466969_0063985 | Ga0466969_0063985_1236_1682 | 124 |
| 334 | 3300044658 | Ga0466972_0081430 | Ga0466972_0081430_91_537 | 124 |
| 335 | 3300044683 | Ga0466965_0011530 | Ga0466965_0011530_3375_3821 | 124 |
| 336 | 3300044683 | Ga0466965_0013111 | Ga0466965_0013111_65_511 | 124 |
| 337 | 3300044683 | Ga0466965_0127947 | Ga0466965_0127947_429_875 | 124 |
| 338 | 3300044684 | Ga0466966_0006769 | Ga0466966_0006769_6828_7274 | 124 |
| 339 | 3300044684 | Ga0466966_0114503 | Ga0466966_0114503_166_612 | 124 |
| 340 | 3300044684 | Ga0466966_0501182 | Ga0466966_0501182_243_689 | 124 |
| 341 | 3300044693 | Ga0466961_0016947 | Ga0466961_0016947_1011_1457 | 124 |
| 342 | 3300044693 | Ga0466961_0034680 | Ga0466961_0034680_2466_2912 | 124 |
| 343 | 3300044694 | Ga0466963_0037912 | Ga0466963_0037912_2067_2513 | 124 |
| 344 | 3300044706 | Ga0466964_0004724 | Ga0466964_0004724_3800_4246 | 124 |
| 345 | 3300044719 | Ga0466971_0049165 | Ga0466971_0049165_1009_1455 | 124 |
| 346 | 3300044719 | Ga0466971_0083046 | Ga0466971_0083046_166_612 | 124 |
| 347 | 3300044735 | Ga0466968_0055678 | Ga0466968_0055678_1120_1581 | 124 |
| 348 | 3300044735 | Ga0466968_0114921 | Ga0466968_0114921_663_1109 | 124 |
| 349 | 3300044765 | Ga0466970_0006015 | Ga0466970_0006015_2558_3004 | 124 |
| 350 | 3300044765 | Ga0466970_0031405 | Ga0466970_0031405_59_505 | 124 |
| 351 | 3300044765 | Ga0466970_0341655 | Ga0466970_0341655_210_656 | 124 |
| 352 | 3300044842 | Ga0466957_0008708 | Ga0466957_0008708_4944_5390 | 124 |
| 353 | 3300044842 | Ga0466957_0033045 | Ga0466957_0033045_1115_1561 | 124 |
| 354 | 3300044842 | Ga0466957_0134428 | Ga0466957_0134428_678_1124 | 124 |
| 355 | 3300045049 | Ga0466959_0000371 | Ga0466959_0000371_16629_17075 | 124 |
| 356 | 3300045049 | Ga0466959_0019821 | Ga0466959_0019821_3634_4080 | 124 |
| 357 | 3300045049 | Ga0466959_0068137 | Ga0466959_0068137_1017_1463 | 124 |
| 358 | 3300045976 | Ga0466967_0029942 | Ga0466967_0029942_985_1431 | 124 |
| 359 | 3300046458 | Ga0495591_057177 | Ga0495591_057177_445_891 | 124 |
| 360 | 3300046460 | Ga0495638_0027785 | Ga0495638_0027785_435_881 | 124 |
| 361 | 3300046474 | Ga0495605_0002703 | Ga0495605_0002703_799_1245 | 124 |
| 362 | 3300046491 | Ga0495584_0035996 | Ga0495584_0035996_1661_2107 | 124 |
| 363 | 3300046492 | Ga0495585_0100349 | Ga0495585_0100349_37_483 | 124 |
| 364 | 3300046500 | Ga0495596_0103798 | Ga0495596_0103798_148_594 | 124 |
| 365 | 3300046501 | Ga0495607_0063268 | Ga0495607_0063268_348_794 | 124 |
| 366 | 3300046513 | Ga0495616_0256712 | Ga0495616_0256712_226_672 | 124 |
| 367 | 3300046523 | Ga0495644_0233840 | Ga0495644_0233840_105_551 | 124 |
| 368 | 3300046616 | Ga0495668_0084078 | Ga0495668_0084078_693_1142 | 124 |
| 369 | 3300046660 | Ga0495625_0047245 | Ga0495625_0047245_141_587 | 124 |
| 370 | 3300046681 | Ga0495647_0103716 | Ga0495647_0103716_163_624 | 124 |
| 371 | 3300046691 | Ga0495670_0063648 | Ga0495670_0063648_437_883 | 124 |
| 372 | 3300046794 | Ga0495589_0007503 | Ga0495589_0007503_1864_2310 | 124 |
| 373 | 3300047318 | Ga0495636_0067752 | Ga0495636_0067752_355_804 | 124 |
| 374 | 3300047445 | Ga0495677_0119164 | Ga0495677_0119164_463_909 | 124 |
| 375 | 3300047447 | Ga0495685_224418 | Ga0495685_224418_52_501 | 124 |
| 376 | 3300048903 | Ga0496100_0298902 | Ga0496100_0298902_95_538 | 124 |
| 377 | 3300048904 | Ga0496101_0066810 | Ga0496101_0066810_1165_1611 | 124 |
| 378 | 3300048905 | Ga0496102_0440243 | Ga0496102_0440243_10_456 | 124 |
| 379 | 3300048906 | Ga0496103_0238298 | Ga0496103_0238298_672_1118 | 124 |
| 380 | 3300048907 | Ga0496104_0158503 | Ga0496104_0158503_1351_1797 | 124 |
| 381 | 3300048909 | Ga0496106_0089038 | Ga0496106_0089038_1238_1684 | 124 |
| 382 | 3300048909 | Ga0496106_0539501 | Ga0496106_0539501_86_529 | 124 |
| 383 | 3300048910 | Ga0496107_0029263 | Ga0496107_0029263_1901_2347 | 124 |
| 384 | 3300048910 | Ga0496107_0180875 | Ga0496107_0180875_1002_1445 | 124 |
| 385 | 3300048911 | Ga0496108_0393542 | Ga0496108_0393542_470_913 | 124 |
| 386 | 3300048913 | Ga0496110_0055321 | Ga0496110_0055321_1631_2077 | 124 |
| 387 | 3300048913 | Ga0496110_0269288 | Ga0496110_0269288_684_1133 | 124 |
| 388 | 3300048915 | Ga0496112_0345302 | Ga0496112_0345302_168_611 | 124 |
| 389 | 3300048915 | Ga0496112_1039726 | Ga0496112_1039726_38_421 | 124 |
| 390 | 3300048917 | Ga0496114_0164802 | Ga0496114_0164802_1102_1548 | 124 |
| 391 | 3300048917 | Ga0496114_0305742 | Ga0496114_0305742_181_627 | 124 |
| 392 | 3300048917 | Ga0496114_1227508 | Ga0496114_1227508_158_604 | 124 |
| 393 | 3300048918 | Ga0496115_0659536 | Ga0496115_0659536_172_615 | 124 |
| 394 | 3300048926 | Ga0496123_0161144 | Ga0496123_0161144_701_1150 | 124 |
| 395 | 3300049128 | Ga0501308_000354 | Ga0501308_000354_1829_2275 | 124 |
| 396 | 3300049160 | Ga0501304_008706 | Ga0501304_008706_98_544 | 124 |
| 397 | 3300049528 | Ga0501312_022972 | Ga0501312_022972_134_580 | 124 |
| 398 | 3300049574 | Ga0501038_0829491 | Ga0501038_0829491_169_615 | 124 |
| 399 | 3300049575 | Ga0501039_0818607 | Ga0501039_0818607_182_628 | 124 |
| 400 | 3300049576 | Ga0501040_0569152 | Ga0501040_0569152_237_683 | 124 |
| 401 | 3300049576 | Ga0501040_0990743 | Ga0501040_0990743_146_592 | 124 |
| 402 | 3300049579 | Ga0501043_0417886 | Ga0501043_0417886_438_884 | 124 |
| 403 | 3300049580 | Ga0501046_0191879 | Ga0501046_0191879_702_1148 | 124 |
| 404 | 3300049581 | Ga0501047_0270217 | Ga0501047_0270217_719_1165 | 124 |
| 405 | 3300049587 | Ga0501071_0051711 | Ga0501071_0051711_973_1419 | 124 |
| 406 | 3300049590 | Ga0501074_0707138 | Ga0501074_0707138_118_564 | 124 |
| 407 | 3300049662 | Ga0501222_003042 | Ga0501222_003042_688_1134 | 124 |
| 408 | 3300049678 | Ga0501248_003193 | Ga0501248_003193_346_792 | 124 |
| 409 | 3300049742 | Ga0501080_0011561 | Ga0501080_0011561_4348_4794 | 124 |
| 410 | 3300049822 | Ga0501035_0734891 | Ga0501035_0734891_93_539 | 124 |
| 411 | 3300049823 | Ga0501044_0070992 | Ga0501044_0070992_2858_3304 | 124 |
| 412 | 3300049823 | Ga0501044_0562340 | Ga0501044_0562340_229_675 | 124 |
| 413 | 3300050491 | nmdc:mga00v17_10262_c1 | nmdc:mga00v17_10262_c1_2840_3289 | 124 |
| 414 | 3300050493 | nmdc:mga0k408_184286_c1 | nmdc:mga0k408_184286_c1_686_1132 | 124 |
| 415 | 3300050493 | nmdc:mga0k408_23053_c1 | nmdc:mga0k408_23053_c1_1426_1875 | 124 |
| 416 | 3300050493 | nmdc:mga0k408_36032_c1 | nmdc:mga0k408_36032_c1_327_773 | 124 |
| 417 | 3300050493 | nmdc:mga0k408_567323_c1 | nmdc:mga0k408_567323_c1_104_550 | 124 |
| 418 | 3300050493 | nmdc:mga0k408_71133_c1 | nmdc:mga0k408_71133_c1_938_1384 | 124 |
| 419 | 3300050493 | nmdc:mga0k408_96536_c1 | nmdc:mga0k408_96536_c1_519_965 | 124 |
| 420 | 3300050494 | nmdc:mga06z11_190279_c1 | nmdc:mga06z11_190279_c1_569_1015 | 124 |
| 421 | 3300050508 | nmdc:mga09592_3159_c1 | nmdc:mga09592_3159_c1_12750_13196 | 124 |
| 422 | 3300050508 | nmdc:mga09592_85620_c1 | nmdc:mga09592_85620_c1_2082_2528 | 124 |
| 423 | 3300050511 | nmdc:mga08y16_1378_c1 | nmdc:mga08y16_1378_c1_3197_3643 | 124 |
| 424 | 3300050511 | nmdc:mga08y16_928350_c1 | nmdc:mga08y16_928350_c1_350_796 | 124 |
| 425 | 3300050512 | nmdc:mga0n895_108750_c1 | nmdc:mga0n895_108750_c1_1766_2215 | 124 |
| 426 | 3300050516 | nmdc:mga0sz30_17214_c1 | nmdc:mga0sz30_17214_c1_961_1410 | 124 |
| 427 | 3300053140 | Ga0500573_0085281 | Ga0500573_0085281_791_1243 | 124 |
| 428 | 3300053727 | Ga0500611_118544 | Ga0500611_118544_69_515 | 124 |
| 429 | 3300054114 | Ga0501084_1310832 | Ga0501084_1310832_58_504 | 124 |
| 430 | 3300059491 | Ga0587070_080667 | Ga0587070_080667_126_572 | 124 |
| 431 | 3300061719 | Ga0466962_0038021 | Ga0466962_0038021_1001_1447 | 124 |
| 432 | 3300061719 | Ga0466962_0248603 | Ga0466962_0248603_166_612 | 124 |
| 433 | 3300061734 | Ga0530510_0326330 | Ga0530510_0326330_93_539 | 124 |
| 434 | 3300000546 | LJNas_1005518 | LJNas_10055182 | 125 |
| 435 | 3300009545 | Ga0105237_11532494 | Ga0105237_115324942 | 125 |
| 436 | 3300031731 | Ga0307405_10917778 | Ga0307405_109177781 | 125 |
| 437 | 3300042876 | Ga0451577_0029130 | Ga0451577_0029130_433_882 | 125 |
| 438 | 3300044683 | Ga0466965_0004790 | Ga0466965_0004790_4410_4859 | 125 |
| 439 | 3300044684 | Ga0466966_0008119 | Ga0466966_0008119_423_872 | 125 |
| 440 | 3300044693 | Ga0466961_0024171 | Ga0466961_0024171_1946_2395 | 125 |
| 441 | 3300044706 | Ga0466964_0170101 | Ga0466964_0170101_237_686 | 125 |
| 442 | 3300044712 | Ga0453684_0107132 | Ga0453684_0107132_656_1105 | 125 |
| 443 | 3300044719 | Ga0466971_0460213 | Ga0466971_0460213_75_524 | 125 |
| 444 | 3300044735 | Ga0466968_0133716 | Ga0466968_0133716_361_810 | 125 |
| 445 | 3300044842 | Ga0466957_0065983 | Ga0466957_0065983_561_1010 | 125 |
| 446 | 3300045049 | Ga0466959_0230665 | Ga0466959_0230665_103_552 | 125 |
| 447 | 3300045051 | Ga0451576_0050384 | Ga0451576_0050384_3033_3482 | 125 |
| 448 | 3300045836 | Ga0466958_0064403 | Ga0466958_0064403_1376_1825 | 125 |
| 449 | 3300045976 | Ga0466967_0834771 | Ga0466967_0834771_77_526 | 125 |
| 450 | 3300048924 | Ga0496121_0005472 | Ga0496121_0005472_7846_8304 | 125 |
| 451 | 3300048928 | Ga0496125_0008779 | Ga0496125_0008779_2090_2548 | 125 |
| 452 | 3300049571 | Ga0501034_0000782 | Ga0501034_0000782_1423_1875 | 125 |
| 453 | 3300049572 | Ga0501036_0012821 | Ga0501036_0012821_4029_4481 | 125 |
| 454 | 3300049573 | Ga0501037_0001742 | Ga0501037_0001742_9543_9995 | 125 |
| 455 | 3300049574 | Ga0501038_0019217 | Ga0501038_0019217_11_463 | 125 |
| 456 | 3300049579 | Ga0501043_0010954 | Ga0501043_0010954_237_689 | 125 |
| 457 | 3300049580 | Ga0501046_0471045 | Ga0501046_0471045_386_838 | 125 |
| 458 | 3300049581 | Ga0501047_0003501 | Ga0501047_0003501_13531_13983 | 125 |
| 459 | 3300049582 | Ga0501048_0327676 | Ga0501048_0327676_42_494 | 125 |
| 460 | 3300049584 | Ga0501068_0498287 | Ga0501068_0498287_14_466 | 125 |
| 461 | 3300049586 | Ga0501070_1356794 | Ga0501070_1356794_34_486 | 125 |
| 462 | 3300049589 | Ga0501073_0011794 | Ga0501073_0011794_4210_4662 | 125 |
| 463 | 3300049590 | Ga0501074_0018945 | Ga0501074_0018945_3885_4337 | 125 |
| 464 | 3300049742 | Ga0501080_0001498 | Ga0501080_0001498_13790_14242 | 125 |
| 465 | 3300049744 | Ga0501083_0028970 | Ga0501083_0028970_3007_3459 | 125 |
| 466 | 3300049822 | Ga0501035_0031986 | Ga0501035_0031986_54_506 | 125 |
| 467 | 3300049823 | Ga0501044_0027547 | Ga0501044_0027547_3963_4415 | 125 |
| 468 | 3300060353 | Ga0501082_0035136 | Ga0501082_0035136_3693_4145 | 125 |
| 469 | 3300061719 | Ga0466962_0052241 | Ga0466962_0052241_101_550 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1moj-assembly1.cif.gz_A | crystal structure of an archaeal dps-homologue from halobacterium salinarum | 0.8263 | 48 | 98 |
| 3v1c-assembly1.cif.gz_A | crystal structure of de novo designed mid1-zinc | 0.8205 | 54 | 95 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.7684 | 3 | 124 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.7478 | 3 | 124 |
| 3v1c-assembly1.cif.gz_A | crystal structure of de novo designed mid1-zinc | 0.7424 | 54 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9754 | 4 | 91 | 1.10.1510.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9599 | 4 | 91 | 1.10.1510.10 |
| 1ng6A01 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9508 | 3 | 91 | 1.10.1510.10 |
| 1bgfA00 | Mainly Alpha;Orthogonal Bundle;Transcription Factor, Stat-4;STAT transcription factor, N-terminal domain | 0.9489 | 53 | 89 | 1.10.532.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9391 | 4 | 91 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7B134-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9957 | 3 | 86 |
GO:0016884
|
| AF-A0A7C5PW84-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9942 | 4 | 96 |
GO:0016884
|
| AF-A0A382G0K5-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9916 | 3 | 93 |
GO:0016884
|
| AF-A0A7X8DSJ1-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9905 | 1 | 92 |
GO:0016884
|
| AF-A0A3D1V535-F1-model_v4 | Glutamyl-tRNA amidotransferase | 0.9878 | 3 | 91 |
GO:0016740
GO:0016884 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar