F450276

General Info

Members Datasets Scaffolds Average Seq Length
469 287 465 132

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0044531|Ga0395905_0044531_2273_2722
Length 137
Sequence MALKDRITDDMKDAMRARAAARLSTIRLLLAAIKQREVDERKALTDADVVAIIDRMIKQRKDSIAQFDAGQRPDLADAERAELAILETYLPQRMSDAEIGAGGSGPALMGKVMAALKPQLAGRADMAQVSARVKARL

Samples

Sample ID Description Type Environment
1 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
2 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
3 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
193 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
266 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
281 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.07
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.76
Nodule 0.21
Rhizoplane 4.26
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1005518 3300000546 Bacteria 1379
2 JGI25165J46597_1001030 3300003214 Bacteria 18251
3 Ga0070658_10888916 3300005327 Bacteria 774
4 Ga0070676_10260923 3300005328 Bacteria 1160
5 Ga0070690_100033755 3300005330 Bacteria 3205
6 Ga0068869_100317678 3300005334 Bacteria 1262
7 Ga0070680_100024022 3300005336 Bacteria 4865
8 Ga0070682_100056349 3300005337 Bacteria 2471
9 Ga0070660_100737793 3300005339 Bacteria 827
10 Ga0070689_100172765 3300005340 Bacteria 1751
11 Ga0070689_100656800 3300005340 Bacteria 913
12 Ga0070687_100286100 3300005343 Bacteria 1040
13 Ga0070687_100301663 3300005343 Bacteria 1016
14 Ga0070692_10160177 3300005345 Bacteria 1289
15 Ga0070668_101142414 3300005347 Bacteria 704
16 Ga0070668_101788352 3300005347 Bacteria 565
17 Ga0070669_100260405 3300005353 Bacteria 1384
18 Ga0070675_100368048 3300005354 Bacteria 1277
19 Ga0070675_100599610 3300005354 Bacteria 999
20 Ga0070674_100057181 3300005356 Bacteria 2707
21 Ga0070674_100073544 3300005356 Bacteria 2423
22 Ga0070674_101340365 3300005356 Bacteria 639
23 Ga0070674_101900798 3300005356 Bacteria 541
24 Ga0070673_100816739 3300005364 Bacteria 861
25 Ga0070701_10034586 3300005438 Bacteria 2532
26 Ga0070711_100051970 3300005439 Bacteria 2818
27 Ga0070705_100011290 3300005440 Bacteria 4501
28 Ga0070700_100051444 3300005441 Bacteria 2564
29 Ga0070700_101165207 3300005441 Bacteria 642
30 Ga0070694_100056259 3300005444 Bacteria 2671
31 Ga0070663_100176371 3300005455 Bacteria 1655
32 Ga0070678_100324273 3300005456 Bacteria 1316
33 Ga0070678_100348420 3300005456 Bacteria 1273
34 Ga0070662_100756890 3300005457 Bacteria 824
35 Ga0068867_100001695 3300005459 Bacteria 15364
36 Ga0068867_100249172 3300005459 Bacteria 1444
37 Ga0068867_101331705 3300005459 Bacteria 664
38 Ga0068867_102037535 3300005459 Bacteria 543
39 Ga0070685_10311745 3300005466 Bacteria 1063
40 Ga0070679_100036124 3300005530 Bacteria 4903
41 Ga0068853_100486513 3300005539 Bacteria 1164
42 Ga0068853_100812230 3300005539 Bacteria 896
43 Ga0068853_101359973 3300005539 Bacteria 686
44 Ga0070672_100152671 3300005543 Bacteria 1911
45 Ga0070672_100570285 3300005543 Bacteria 984
46 Ga0070686_100056706 3300005544 Bacteria 2513
47 Ga0070686_101000778 3300005544 Bacteria 685
48 Ga0070695_100041922 3300005545 Bacteria 2903
49 Ga0070696_100000379 3300005546 Bacteria 27163
50 Ga0070696_100012855 3300005546 Bacteria 5619
51 Ga0070693_100311910 3300005547 Bacteria 1064
52 Ga0070693_100544857 3300005547 Bacteria 830
53 Ga0070665_100010309 3300005548 Bacteria 9455
54 Ga0070665_100060219 3300005548 Bacteria 3806
55 Ga0070665_100131117 3300005548 Bacteria 2509
56 Ga0070665_100225913 3300005548 Bacteria 1872
57 Ga0070704_101572431 3300005549 Bacteria 606
58 Ga0068855_100163952 3300005563 Bacteria 2521
59 Ga0070664_100380459 3300005564 Bacteria 1288
60 Ga0068857_100486836 3300005577 Bacteria 1156
61 Ga0068854_100486688 3300005578 Bacteria 1037
62 Ga0068854_101872772 3300005578 Bacteria 551
63 Ga0070702_100185945 3300005615 Bacteria 1363
64 Ga0068852_100009907 3300005616 Bacteria 7094
65 Ga0068852_100882306 3300005616 Bacteria 911
66 Ga0068859_100050338 3300005617 Bacteria 4185
67 Ga0068859_100237912 3300005617 Bacteria 1910
68 Ga0068859_100286751 3300005617 Bacteria 1739
69 Ga0068859_100571179 3300005617 Bacteria 1225
70 Ga0068859_100779426 3300005617 Bacteria 1044
71 Ga0068864_100205178 3300005618 Bacteria 1813
72 Ga0068866_10037278 3300005718 Bacteria 2387
73 Ga0068866_10148489 3300005718 Bacteria 1354
74 Ga0068861_100000582 3300005719 Bacteria 21639
75 Ga0068861_100002436 3300005719 Bacteria 12130
76 Ga0068861_101129306 3300005719 Bacteria 754
77 Ga0068863_100048521 3300005841 Bacteria 4026
78 Ga0068863_101166252 3300005841 Bacteria 776
79 Ga0068858_100165433 3300005842 Bacteria 2084
80 Ga0068858_100655028 3300005842 Bacteria 1020
81 Ga0068860_100001910 3300005843 Bacteria 22116
82 Ga0068860_100024966 3300005843 Bacteria 5770
83 Ga0068862_100003469 3300005844 Bacteria 13560
84 Ga0068862_100004043 3300005844 Bacteria 12431
85 Ga0075364_10061759 3300006051 Bacteria 2458
86 Ga0075364_10133615 3300006051 Bacteria 1666
87 Ga0075364_10225422 3300006051 Bacteria 1273
88 Ga0075367_10491958 3300006178 Bacteria 778
89 Ga0075369_10074691 3300006186 Bacteria 1496
90 Ga0075366_10015329 3300006195 Bacteria 4390
91 Ga0075366_10076116 3300006195 Bacteria 2002
92 Ga0075366_10133151 3300006195 Bacteria 1501
93 Ga0075366_10199343 3300006195 Bacteria 1217
94 Ga0097621_100007196 3300006237 Bacteria 7939
95 Ga0097621_100318118 3300006237 Bacteria 1378
96 Ga0097621_101825564 3300006237 Bacteria 580
97 Ga0075370_10011625 3300006353 Bacteria 4630
98 Ga0068871_100021745 3300006358 Bacteria 4936
99 Ga0068871_100391773 3300006358 Bacteria 1236
100 Ga0075428_100009589 3300006844 Bacteria 10750
101 Ga0075428_101673882 3300006844 Bacteria 664
102 Ga0075430_100042814 3300006846 Bacteria 3829
103 Ga0075434_100211297 3300006871 Bacteria 1960
104 Ga0075429_100001027 3300006880 Bacteria 22297
105 Ga0075429_100943244 3300006880 Bacteria 755
106 Ga0068865_100001694 3300006881 Bacteria 12918
107 Ga0068865_101202119 3300006881 Bacteria 671
108 Ga0097620_100050336 3300006931 Bacteria 4185
109 Ga0097620_100237917 3300006931 Bacteria 1910
110 Ga0097620_100571180 3300006931 Bacteria 1225
111 Ga0097620_100779417 3300006931 Bacteria 1044
112 Ga0099794_10024456 3300007265 Bacteria 2772
113 Ga0111539_10012497 3300009094 Bacteria 10641
114 Ga0105243_10020653 3300009148 Bacteria 4994
115 Ga0105243_12647501 3300009148 Bacteria 541
116 Ga0105241_11710582 3300009174 Bacteria 611
117 Ga0105242_11406720 3300009176 Bacteria 725
118 Ga0105248_11464868 3300009177 Bacteria 773
119 Ga0105237_11532494 3300009545 Bacteria 673
120 Ga0105238_10139100 3300009551 Bacteria 2405
121 Ga0099796_10204413 3300010159 Bacteria 803
122 Ga0157369_11660015 3300013105 Bacteria 649
123 Ga0157374_10025500 3300013296 Bacteria 5309
124 Ga0157378_10000558 3300013297 Bacteria 35454
125 Ga0157378_10527560 3300013297 Bacteria 1183
126 Ga0157378_10963415 3300013297 Bacteria 886
127 Ga0163162_10002211 3300013306 Bacteria 18267
128 Ga0163162_10517998 3300013306 Bacteria 1322
129 Ga0157375_10266536 3300013308 Bacteria 1874
130 Ga0157375_10291884 3300013308 Bacteria 1794
131 Ga0157375_11713847 3300013308 Bacteria 744
132 Ga0157380_10022686 3300014326 Bacteria 4731
133 Ga0157380_11103722 3300014326 Bacteria 832
134 Ga0182008_10119373 3300014497 Bacteria 1310
135 Ga0157379_10294207 3300014968 Bacteria 1479
136 Ga0157379_11241663 3300014968 Bacteria 718
137 Ga0157376_10247152 3300014969 Bacteria 1664
138 Ga0163161_10022683 3300017792 Bacteria 4421
139 Ga0163161_10437150 3300017792 Bacteria 1055
140 Ga0163161_10705556 3300017792 Bacteria 840
141 Ga0213873_10137084 3300021358 Bacteria 729
142 Ga0207427_103927 3300025231 Bacteria 2769
143 Ga0209759_1001704 3300025256 Bacteria 11392
144 Ga0209233_1000177 3300025261 Bacteria 141716
145 Ga0207666_1008614 3300025271 Bacteria 1365
146 Ga0207653_10157580 3300025885 Bacteria 839
147 Ga0207682_10134882 3300025893 Bacteria 1104
148 Ga0207692_10311791 3300025898 Bacteria 960
149 Ga0207692_10491713 3300025898 Bacteria 777
150 Ga0207642_10101490 3300025899 Bacteria 1445
151 Ga0207642_10291387 3300025899 Bacteria 943
152 Ga0207680_10631629 3300025903 Bacteria 766
153 Ga0207685_10146088 3300025905 Bacteria 1065
154 Ga0207685_10222998 3300025905 Bacteria 898
155 Ga0207699_10088549 3300025906 Bacteria 1938
156 Ga0207699_10581069 3300025906 Bacteria 815
157 Ga0207645_10222979 3300025907 Bacteria 1243
158 Ga0207643_10008880 3300025908 Bacteria 5395
159 Ga0207643_10614500 3300025908 Bacteria 700
160 Ga0207705_10794808 3300025909 Bacteria 734
161 Ga0207705_11005936 3300025909 Bacteria 644
162 Ga0207707_10067151 3300025912 Bacteria 3124
163 Ga0207693_10050535 3300025915 Bacteria 3265
164 Ga0207663_10489185 3300025916 Bacteria 954
165 Ga0207660_10146686 3300025917 Bacteria 1809
166 Ga0207662_10354785 3300025918 Bacteria 986
167 Ga0207657_10061961 3300025919 Bacteria 3204
168 Ga0207657_10899705 3300025919 Bacteria 682
169 Ga0207652_10002539 3300025921 Bacteria 15323
170 Ga0207681_10312833 3300025923 Bacteria 1246
171 Ga0207694_10176768 3300025924 Bacteria 1730
172 Ga0207659_10503147 3300025926 Bacteria 1026
173 Ga0207700_10104016 3300025928 Bacteria 2271
174 Ga0207700_11223431 3300025928 Bacteria 670
175 Ga0207664_10107550 3300025929 Bacteria 2314
176 Ga0207644_10385972 3300025931 Bacteria 1143
177 Ga0207690_10473107 3300025932 Bacteria 1010
178 Ga0207706_10693401 3300025933 Bacteria 870
179 Ga0207686_10263993 3300025934 Bacteria 1263
180 Ga0207709_10047935 3300025935 Bacteria 2601
181 Ga0207709_10180738 3300025935 Bacteria 1489
182 Ga0207670_10099386 3300025936 Bacteria 2075
183 Ga0207670_10255380 3300025936 Bacteria 1356
184 Ga0207669_10145601 3300025937 Bacteria 1651
185 Ga0207669_10226346 3300025937 Bacteria 1376
186 Ga0207669_10396791 3300025937 Bacteria 1079
187 Ga0207669_10764901 3300025937 Bacteria 799
188 Ga0207704_10016265 3300025938 Bacteria 3819
189 Ga0207704_10094487 3300025938 Bacteria 1974
190 Ga0207704_10457158 3300025938 Bacteria 1020
191 Ga0207704_10695977 3300025938 Bacteria 841
192 Ga0207665_10065735 3300025939 Bacteria 2466
193 Ga0207691_10486908 3300025940 Bacteria 1048
194 Ga0207711_10197786 3300025941 Bacteria 1834
195 Ga0207689_10056644 3300025942 Bacteria 3226
196 Ga0207689_10309195 3300025942 Bacteria 1311
197 Ga0207667_10053503 3300025949 Bacteria 4248
198 Ga0207651_10096953 3300025960 Bacteria 2176
199 Ga0207651_10393571 3300025960 Bacteria 1177
200 Ga0207651_10480144 3300025960 Bacteria 1071
201 Ga0207712_10045602 3300025961 Bacteria 3036
202 Ga0207668_10110057 3300025972 Bacteria 2065
203 Ga0207668_10646579 3300025972 Bacteria 925
204 Ga0207640_10398982 3300025981 Bacteria 1119
205 Ga0207658_10697793 3300025986 Bacteria 917
206 Ga0207658_11396921 3300025986 Bacteria 640
207 Ga0207677_11071491 3300026023 Bacteria 734
208 Ga0207677_11524379 3300026023 Bacteria 618
209 Ga0207703_10109980 3300026035 Bacteria 2350
210 Ga0207678_10146483 3300026067 Bacteria 2015
211 Ga0207678_10192484 3300026067 Bacteria 1743
212 Ga0207708_10053340 3300026075 Bacteria 3081
213 Ga0207708_10147530 3300026075 Bacteria 1849
214 Ga0207641_10039796 3300026088 Bacteria 3933
215 Ga0207641_10318287 3300026088 Bacteria 1475
216 Ga0207641_11439400 3300026088 Bacteria 690
217 Ga0207648_10002481 3300026089 Bacteria 19810
218 Ga0207648_11120321 3300026089 Bacteria 738
219 Ga0207676_10178351 3300026095 Bacteria 1858
220 Ga0207676_10874543 3300026095 Bacteria 880
221 Ga0207674_10192176 3300026116 Bacteria 1991
222 Ga0207675_100000738 3300026118 Bacteria 32437
223 Ga0207675_100009279 3300026118 Bacteria 9227
224 Ga0207675_100484854 3300026118 Bacteria 1229
225 Ga0207683_10192077 3300026121 Bacteria 1854
226 Ga0207683_10708977 3300026121 Bacteria 933
227 Ga0207698_10032433 3300026142 Bacteria 3784
228 Ga0209981_1021988 3300027378 Bacteria 913
229 Ga0209996_1007946 3300027395 Bacteria 1386
230 Ga0209995_1012200 3300027471 Bacteria 1401
231 Ga0209968_1002540 3300027526 Bacteria 2751
232 Ga0209999_1015476 3300027543 Bacteria 1388
233 Ga0209966_1000001 3300027695 Bacteria 139125
234 Ga0207428_10001508 3300027907 Bacteria 24337
235 Ga0207428_10543729 3300027907 Bacteria 840
236 Ga0268266_10105590 3300028379 Bacteria 2489
237 Ga0268266_10140992 3300028379 Bacteria 2163
238 Ga0268265_10005309 3300028380 Bacteria 8830
239 Ga0268265_10038468 3300028380 Bacteria 3519
240 Ga0268265_10252805 3300028380 Bacteria 1562
241 Ga0268264_10004254 3300028381 Bacteria 12219
242 Ga0268264_10566238 3300028381 Bacteria 1116
243 Ga0307515_10006495 3300028794 Bacteria 23397
244 Ga0307515_10229316 3300028794 Bacteria 1654
245 Ga0265762_1020541 3300030760 Bacteria 1215
246 Ga0265340_10100391 3300031247 Bacteria 1345
247 Ga0307513_10021824 3300031456 Bacteria 7548
248 Ga0307408_100098797 3300031548 Bacteria 2220
249 Ga0307405_10338506 3300031731 Bacteria 1156
250 Ga0307405_10917778 3300031731 Bacteria 742
251 Ga0307405_11046604 3300031731 Bacteria 699
252 Ga0307413_10089002 3300031824 Bacteria 2004
253 Ga0307413_10243880 3300031824 Bacteria 1328
254 Ga0307413_10275197 3300031824 Bacteria 1263
255 Ga0307413_11099302 3300031824 Bacteria 687
256 Ga0307410_10022166 3300031852 Bacteria 3920
257 Ga0307410_10033204 3300031852 Bacteria 3330
258 Ga0307410_10321200 3300031852 Bacteria 1228
259 Ga0307406_10062211 3300031901 Bacteria 2414
260 Ga0307406_10468007 3300031901 Bacteria 1015
261 Ga0307407_10063025 3300031903 Bacteria 2173
262 Ga0307407_10531695 3300031903 Bacteria 866
263 Ga0307412_10313417 3300031911 Bacteria 1245
264 Ga0307412_10562745 3300031911 Bacteria 959
265 Ga0307409_100006954 3300031995 Bacteria 6719
266 Ga0307409_100016465 3300031995 Bacteria 4892
267 Ga0307409_100061135 3300031995 Bacteria 2942
268 Ga0307409_101255702 3300031995 Bacteria 765
269 Ga0307416_100183384 3300032002 Bacteria 1964
270 Ga0307416_100412445 3300032002 Bacteria 1392
271 Ga0307416_100657730 3300032002 Bacteria 1133
272 Ga0307416_102624539 3300032002 Bacteria 601
273 Ga0307414_10260166 3300032004 Bacteria 1448
274 Ga0307414_10576816 3300032004 Bacteria 1006
275 Ga0307411_10039548 3300032005 Bacteria 2984
276 Ga0307411_10106401 3300032005 Bacteria 1996
277 Ga0307411_10290339 3300032005 Bacteria 1306
278 Ga0307411_10401048 3300032005 Bacteria 1134
279 Ga0307415_100836804 3300032126 Bacteria 843
280 Ga0373932_0047877 3300035112 Bacteria 1258
281 Ga0373946_0151072 3300035171 Bacteria 1084
282 Ga0373924_0365736 3300035410 Bacteria 643
283 Ga0373927_0344136 3300035695 Bacteria 982
284 Ga0373947_0191067 3300035725 Bacteria 1336
285 Ga0373937_0170035 3300036401 Bacteria 2045
286 Ga0373925_0019888 3300037068 Bacteria 4884
287 Ga0373925_0084790 3300037068 Bacteria 2415
288 Ga0395899_0300017 3300037312 Bacteria 1087
289 Ga0395900_0000109 3300037418 Bacteria 146053
290 Ga0395900_0037275 3300037418 Bacteria 5014
291 Ga0395900_0235102 3300037418 Bacteria 1841
292 Ga0395898_0000868 3300037466 Bacteria 49428
293 Ga0395898_0059151 3300037466 Bacteria 3729
294 Ga0395905_0015072 3300037471 Bacteria 7363
295 Ga0395905_0044531 3300037471 Bacteria 4165
296 Ga0395905_0356852 3300037471 Bacteria 1354
297 Ga0395905_0486193 3300037471 Bacteria 1134
298 Ga0395901_0000034 3300038443 Bacteria 230365
299 Ga0395901_0388637 3300038443 Bacteria 1435
300 Ga0395901_1351599 3300038443 Bacteria 672
301 Ga0436365_0763559 3300039437 Bacteria 1218
302 Ga0436360_0708455 3300039438 Bacteria 1779
303 Ga0436363_1016859 3300039450 Bacteria 1061
304 Ga0436363_1263821 3300039450 Bacteria 939
305 Ga0439436_0114397 3300041404 Bacteria 754
306 Ga0439461_0078139 3300041410 Bacteria 777
307 Ga0439465_0150332 3300041413 Bacteria 831
308 Ga0451791_1757947 3300041451 Bacteria 528
309 Ga0451795_0350967 3300041456 Bacteria 576
310 Ga0451843_0525946 3300041509 Bacteria 1319
311 Ga0439432_119988 3300042006 Bacteria 779
312 Ga0439454_007975 3300042011 Bacteria 1341
313 Ga0439455_0020321 3300042012 Bacteria 1574
314 Ga0450921_038294 3300042123 Bacteria 507
315 Ga0450896_078199 3300042133 Bacteria 555
316 Ga0439458_0152469 3300042157 Bacteria 620
317 Ga0450893_0009449 3300042532 Bacteria 1593
318 Ga0451577_0001509 3300042876 Bacteria 30757
319 Ga0451577_0002068 3300042876 Bacteria 24786
320 Ga0451577_0029130 3300042876 Bacteria 4991
321 Ga0451577_0161635 3300042876 Bacteria 2017
322 Ga0466969_0000385 3300044656 Bacteria 24302
323 Ga0466969_0004246 3300044656 Bacteria 7619
324 Ga0466969_0058054 3300044656 Bacteria 1884
325 Ga0466969_0063985 3300044656 Bacteria 1781
326 Ga0466972_0081430 3300044658 Bacteria 1541
327 Ga0466965_0004790 3300044683 Bacteria 6034
328 Ga0466965_0011530 3300044683 Bacteria 4147
329 Ga0466965_0013111 3300044683 Bacteria 3907
330 Ga0466965_0127947 3300044683 Bacteria 1315
331 Ga0466966_0006769 3300044684 Bacteria 7588
332 Ga0466966_0008119 3300044684 Bacteria 6959
333 Ga0466966_0114503 3300044684 Bacteria 1660
334 Ga0466966_0501182 3300044684 Bacteria 730
335 Ga0466961_0016947 3300044693 Bacteria 4681
336 Ga0466961_0024171 3300044693 Bacteria 3907
337 Ga0466961_0034680 3300044693 Bacteria 3239
338 Ga0466963_0037912 3300044694 Bacteria 3150
339 Ga0466964_0004724 3300044706 Bacteria 5032
340 Ga0466964_0170101 3300044706 Bacteria 1025
341 Ga0453684_0034917 3300044712 Bacteria 6964
342 Ga0453684_0107132 3300044712 Bacteria 3404
343 Ga0466971_0049165 3300044719 Bacteria 1897
344 Ga0466971_0083046 3300044719 Bacteria 1462
345 Ga0466971_0460213 3300044719 Bacteria 624
346 Ga0466968_0055678 3300044735 Bacteria 1697
347 Ga0466968_0114921 3300044735 Bacteria 1213
348 Ga0466968_0133716 3300044735 Bacteria 1130
349 Ga0466970_0006015 3300044765 Bacteria 6049
350 Ga0466970_0031405 3300044765 Bacteria 2805
351 Ga0466970_0341655 3300044765 Bacteria 848
352 Ga0466957_0008708 3300044842 Bacteria 5780
353 Ga0466957_0033045 3300044842 Bacteria 3102
354 Ga0466957_0065983 3300044842 Bacteria 2230
355 Ga0466957_0134428 3300044842 Bacteria 1588
356 Ga0466959_0000371 3300045049 Bacteria 26505
357 Ga0466959_0019821 3300045049 Bacteria 4949
358 Ga0466959_0068137 3300045049 Bacteria 2579
359 Ga0466959_0230665 3300045049 Bacteria 1281
360 Ga0451576_0050384 3300045051 Bacteria 4367
361 Ga0451576_0165519 3300045051 Bacteria 2307
362 Ga0466958_0064403 3300045836 Bacteria 2235
363 Ga0466967_0029942 3300045976 Bacteria 4562
364 Ga0466967_0834771 3300045976 Bacteria 915
365 Ga0495603_0483499 3300046455 Bacteria 709
366 Ga0495591_057177 3300046458 Bacteria 1047
367 Ga0495638_0027785 3300046460 Bacteria 3659
368 Ga0495605_0002703 3300046474 Bacteria 10844
369 Ga0495584_0035996 3300046491 Bacteria 2501
370 Ga0495585_0100349 3300046492 Bacteria 1548
371 Ga0495596_0103798 3300046500 Bacteria 1104
372 Ga0495596_0156998 3300046500 Bacteria 884
373 Ga0495607_0063268 3300046501 Bacteria 2094
374 Ga0495616_0256712 3300046513 Bacteria 749
375 Ga0495620_0354730 3300046515 Bacteria 556
376 Ga0495644_0233840 3300046523 Bacteria 712
377 Ga0495668_0084078 3300046616 Bacteria 1745
378 Ga0495625_0047245 3300046660 Bacteria 3104
379 Ga0495647_0103716 3300046681 Bacteria 1180
380 Ga0495670_0063648 3300046691 Bacteria 1857
381 Ga0495589_0007503 3300046794 Bacteria 5715
382 Ga0495636_0067752 3300047318 Bacteria 1519
383 Ga0495677_0119164 3300047445 Bacteria 1006
384 Ga0495685_224418 3300047447 Bacteria 599
385 Ga0496100_0298902 3300048903 Bacteria 1204
386 Ga0496101_0066810 3300048904 Bacteria 2624
387 Ga0496102_0440243 3300048905 Bacteria 1223
388 Ga0496103_0238298 3300048906 Bacteria 1170
389 Ga0496104_0158503 3300048907 Bacteria 2171
390 Ga0496106_0089038 3300048909 Bacteria 2380
391 Ga0496106_0539501 3300048909 Bacteria 936
392 Ga0496107_0029263 3300048910 Bacteria 3918
393 Ga0496107_0180875 3300048910 Bacteria 1566
394 Ga0496108_0393542 3300048911 Bacteria 1210
395 Ga0496110_0055321 3300048913 Bacteria 3491
396 Ga0496110_0269288 3300048913 Bacteria 1551
397 Ga0496112_0345302 3300048915 Bacteria 1431
398 Ga0496112_1039726 3300048915 Bacteria 738
399 Ga0496114_0164802 3300048917 Bacteria 1929
400 Ga0496114_0305742 3300048917 Bacteria 1404
401 Ga0496114_1227508 3300048917 Bacteria 636
402 Ga0496115_0659536 3300048918 Bacteria 826
403 Ga0496121_0005472 3300048924 Bacteria 16262
404 Ga0496123_0161144 3300048926 Bacteria 1196
405 Ga0496125_0008779 3300048928 Bacteria 10512
406 Ga0501308_000354 3300049128 Bacteria 2888
407 Ga0501304_008706 3300049160 Bacteria 859
408 Ga0501312_022972 3300049528 Bacteria 937
409 Ga0501034_0000782 3300049571 Bacteria 47617
410 Ga0501036_0012821 3300049572 Bacteria 6956
411 Ga0501037_0001742 3300049573 Bacteria 15796
412 Ga0501038_0019217 3300049574 Bacteria 6161
413 Ga0501038_0829491 3300049574 Bacteria 686
414 Ga0501039_0818607 3300049575 Bacteria 726
415 Ga0501040_0569152 3300049576 Bacteria 818
416 Ga0501040_0990743 3300049576 Bacteria 609
417 Ga0501043_0010954 3300049579 Bacteria 7104
418 Ga0501043_0417886 3300049579 Bacteria 1011
419 Ga0501046_0191879 3300049580 Bacteria 1523
420 Ga0501046_0471045 3300049580 Bacteria 902
421 Ga0501047_0003501 3300049581 Bacteria 14834
422 Ga0501047_0270217 3300049581 Bacteria 1546
423 Ga0501048_0327676 3300049582 Bacteria 1091
424 Ga0501068_0498287 3300049584 Bacteria 790
425 Ga0501070_1356794 3300049586 Bacteria 541
426 Ga0501071_0051711 3300049587 Bacteria 2962
427 Ga0501073_0011794 3300049589 Bacteria 6379
428 Ga0501074_0018945 3300049590 Bacteria 5000
429 Ga0501074_0707138 3300049590 Bacteria 711
430 Ga0501222_003042 3300049662 Bacteria 2305
431 Ga0501248_003193 3300049678 Bacteria 1168
432 Ga0501080_0001498 3300049742 Bacteria 19702
433 Ga0501080_0011561 3300049742 Bacteria 8084
434 Ga0501083_0028970 3300049744 Bacteria 3813
435 Ga0501035_0031986 3300049822 Bacteria 4791
436 Ga0501035_0734891 3300049822 Bacteria 793
437 Ga0501044_0027547 3300049823 Bacteria 6004
438 Ga0501044_0070992 3300049823 Bacteria 3542
439 Ga0501044_0562340 3300049823 Bacteria 1037
440 nmdc:mga03683_391187_c1 3300050489 Bacteria 663
441 nmdc:mga00v17_10262_c1 3300050491 Bacteria 5107
442 nmdc:mga0k408_130108_c1 3300050493 Bacteria 1494
443 nmdc:mga0k408_184286_c1 3300050493 Bacteria 1245
444 nmdc:mga0k408_23053_c1 3300050493 Bacteria 3509
445 nmdc:mga0k408_36032_c1 3300050493 Bacteria 2838
446 nmdc:mga0k408_567323_c1 3300050493 Bacteria 670
447 nmdc:mga0k408_71133_c1 3300050493 Bacteria 2030
448 nmdc:mga0k408_96536_c1 3300050493 Bacteria 1740
449 nmdc:mga06z11_190279_c1 3300050494 Bacteria 1187
450 nmdc:mga07m45_4922_c1 3300050496 Bacteria 6581
451 nmdc:mga09592_3159_c1 3300050508 Bacteria 13376
452 nmdc:mga09592_85620_c1 3300050508 Bacteria 2688
453 nmdc:mga08y16_1378_c1 3300050511 Bacteria 24279
454 nmdc:mga08y16_928350_c1 3300050511 Bacteria 855
455 nmdc:mga0n895_108750_c1 3300050512 Bacteria 2787
456 nmdc:mga0sz30_17214_c1 3300050516 Bacteria 2880
457 Ga0500573_0085281 3300053140 Bacteria 1791
458 Ga0500611_118544 3300053727 Bacteria 703
459 Ga0501084_1310832 3300054114 Bacteria 607
460 Ga0587070_080667 3300059491 Bacteria 713
461 Ga0501082_0035136 3300060353 Bacteria 4320
462 Ga0466962_0038021 3300061719 Bacteria 2305
463 Ga0466962_0052241 3300061719 Bacteria 1953
464 Ga0466962_0248603 3300061719 Bacteria 873
465 Ga0530510_0326330 3300061734 Bacteria 1151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100000379 Ga0070696_10000037911 110
2 3300006195 Ga0075366_10133151 Ga0075366_101331512 114
3 3300006353 Ga0075370_10011625 Ga0075370_100116254 114
4 3300030760 Ga0265762_1020541 Ga0265762_10205412 114
5 3300050489 nmdc:mga03683_391187_c1 nmdc:mga03683_391187_c1_176_625 114
6 3300050493 nmdc:mga0k408_130108_c1 nmdc:mga0k408_130108_c1_542_991 114
7 3300050496 nmdc:mga07m45_4922_c1 nmdc:mga07m45_4922_c1_4161_4610 114
8 3300037471 Ga0395905_0044531 Ga0395905_0044531_2273_2722 115
9 iso_pu_bacteria 2526164713 2527079590 120
10 iso_pu_bacteria 2834641062 2834644818 120
11 iso_pu_bacteria 2939631187 2939632925 120
12 iso_pu_bacteria 8003400568 8003401828 120
13 3300009176 Ga0105242_11406720 Ga0105242_114067202 122
14 3300010159 Ga0099796_10204413 Ga0099796_102044132 122
15 3300046515 Ga0495620_0354730 Ga0495620_0354730_35_481 122
16 3300005364 Ga0070673_100816739 Ga0070673_1008167391 123
17 3300005578 Ga0068854_101872772 Ga0068854_1018727721 123
18 3300007265 Ga0099794_10024456 Ga0099794_100244564 123
19 3300013297 Ga0157378_10963415 Ga0157378_109634152 123
20 3300025893 Ga0207682_10134882 Ga0207682_101348823 123
21 3300025960 Ga0207651_10480144 Ga0207651_104801443 123
22 3300044712 Ga0453684_0034917 Ga0453684_0034917_780_1223 123
23 3300045051 Ga0451576_0165519 Ga0451576_0165519_280_723 123
24 3300046455 Ga0495603_0483499 Ga0495603_0483499_82_528 123
25 3300046500 Ga0495596_0156998 Ga0495596_0156998_366_812 123
26 3300003214 JGI25165J46597_1001030 JGI25165J46597_100103014 124
27 3300005327 Ga0070658_10888916 Ga0070658_108889161 124
28 3300005328 Ga0070676_10260923 Ga0070676_102609232 124
29 3300005330 Ga0070690_100033755 Ga0070690_1000337554 124
30 3300005334 Ga0068869_100317678 Ga0068869_1003176783 124
31 3300005336 Ga0070680_100024022 Ga0070680_1000240224 124
32 3300005337 Ga0070682_100056349 Ga0070682_1000563493 124
33 3300005339 Ga0070660_100737793 Ga0070660_1007377931 124
34 3300005340 Ga0070689_100172765 Ga0070689_1001727651 124
35 3300005340 Ga0070689_100656800 Ga0070689_1006568002 124
36 3300005343 Ga0070687_100286100 Ga0070687_1002861002 124
37 3300005343 Ga0070687_100301663 Ga0070687_1003016632 124
38 3300005345 Ga0070692_10160177 Ga0070692_101601772 124
39 3300005347 Ga0070668_101142414 Ga0070668_1011424141 124
40 3300005347 Ga0070668_101788352 Ga0070668_1017883521 124
41 3300005353 Ga0070669_100260405 Ga0070669_1002604052 124
42 3300005354 Ga0070675_100368048 Ga0070675_1003680482 124
43 3300005354 Ga0070675_100599610 Ga0070675_1005996101 124
44 3300005356 Ga0070674_100057181 Ga0070674_1000571812 124
45 3300005356 Ga0070674_100073544 Ga0070674_1000735442 124
46 3300005356 Ga0070674_101340365 Ga0070674_1013403651 124
47 3300005356 Ga0070674_101900798 Ga0070674_1019007981 124
48 3300005438 Ga0070701_10034586 Ga0070701_100345863 124
49 3300005439 Ga0070711_100051970 Ga0070711_1000519703 124
50 3300005440 Ga0070705_100011290 Ga0070705_1000112905 124
51 3300005441 Ga0070700_100051444 Ga0070700_1000514444 124
52 3300005441 Ga0070700_101165207 Ga0070700_1011652071 124
53 3300005444 Ga0070694_100056259 Ga0070694_1000562594 124
54 3300005455 Ga0070663_100176371 Ga0070663_1001763712 124
55 3300005456 Ga0070678_100324273 Ga0070678_1003242732 124
56 3300005456 Ga0070678_100348420 Ga0070678_1003484203 124
57 3300005457 Ga0070662_100756890 Ga0070662_1007568902 124
58 3300005459 Ga0068867_100001695 Ga0068867_1000016955 124
59 3300005459 Ga0068867_100249172 Ga0068867_1002491722 124
60 3300005459 Ga0068867_101331705 Ga0068867_1013317051 124
61 3300005459 Ga0068867_102037535 Ga0068867_1020375351 124
62 3300005466 Ga0070685_10311745 Ga0070685_103117452 124
63 3300005530 Ga0070679_100036124 Ga0070679_1000361244 124
64 3300005539 Ga0068853_100486513 Ga0068853_1004865131 124
65 3300005539 Ga0068853_100812230 Ga0068853_1008122301 124
66 3300005539 Ga0068853_101359973 Ga0068853_1013599732 124
67 3300005543 Ga0070672_100152671 Ga0070672_1001526711 124
68 3300005543 Ga0070672_100570285 Ga0070672_1005702852 124
69 3300005544 Ga0070686_100056706 Ga0070686_1000567063 124
70 3300005544 Ga0070686_101000778 Ga0070686_1010007781 124
71 3300005545 Ga0070695_100041922 Ga0070695_1000419224 124
72 3300005546 Ga0070696_100012855 Ga0070696_1000128554 124
73 3300005547 Ga0070693_100311910 Ga0070693_1003119102 124
74 3300005547 Ga0070693_100544857 Ga0070693_1005448572 124
75 3300005548 Ga0070665_100010309 Ga0070665_1000103093 124
76 3300005548 Ga0070665_100060219 Ga0070665_1000602193 124
77 3300005548 Ga0070665_100131117 Ga0070665_1001311172 124
78 3300005548 Ga0070665_100225913 Ga0070665_1002259133 124
79 3300005549 Ga0070704_101572431 Ga0070704_1015724311 124
80 3300005563 Ga0068855_100163952 Ga0068855_1001639522 124
81 3300005564 Ga0070664_100380459 Ga0070664_1003804593 124
82 3300005577 Ga0068857_100486836 Ga0068857_1004868362 124
83 3300005578 Ga0068854_100486688 Ga0068854_1004866882 124
84 3300005615 Ga0070702_100185945 Ga0070702_1001859452 124
85 3300005616 Ga0068852_100009907 Ga0068852_1000099073 124
86 3300005616 Ga0068852_100882306 Ga0068852_1008823062 124
87 3300005617 Ga0068859_100050338 Ga0068859_1000503385 124
88 3300005617 Ga0068859_100237912 Ga0068859_1002379123 124
89 3300005617 Ga0068859_100286751 Ga0068859_1002867511 124
90 3300005617 Ga0068859_100571179 Ga0068859_1005711793 124
91 3300005617 Ga0068859_100779426 Ga0068859_1007794262 124
92 3300005618 Ga0068864_100205178 Ga0068864_1002051783 124
93 3300005718 Ga0068866_10037278 Ga0068866_100372783 124
94 3300005718 Ga0068866_10148489 Ga0068866_101484892 124
95 3300005719 Ga0068861_100000582 Ga0068861_1000005824 124
96 3300005719 Ga0068861_100002436 Ga0068861_1000024365 124
97 3300005719 Ga0068861_101129306 Ga0068861_1011293061 124
98 3300005841 Ga0068863_100048521 Ga0068863_1000485216 124
99 3300005841 Ga0068863_101166252 Ga0068863_1011662522 124
100 3300005842 Ga0068858_100165433 Ga0068858_1001654333 124
101 3300005842 Ga0068858_100655028 Ga0068858_1006550282 124
102 3300005843 Ga0068860_100001910 Ga0068860_10000191015 124
103 3300005843 Ga0068860_100024966 Ga0068860_1000249662 124
104 3300005844 Ga0068862_100003469 Ga0068862_10000346911 124
105 3300005844 Ga0068862_100004043 Ga0068862_10000404314 124
106 3300006051 Ga0075364_10061759 Ga0075364_100617593 124
107 3300006051 Ga0075364_10133615 Ga0075364_101336152 124
108 3300006051 Ga0075364_10225422 Ga0075364_102254223 124
109 3300006178 Ga0075367_10491958 Ga0075367_104919581 124
110 3300006186 Ga0075369_10074691 Ga0075369_100746912 124
111 3300006195 Ga0075366_10015329 Ga0075366_100153293 124
112 3300006195 Ga0075366_10076116 Ga0075366_100761162 124
113 3300006195 Ga0075366_10199343 Ga0075366_101993431 124
114 3300006237 Ga0097621_100007196 Ga0097621_1000071966 124
115 3300006237 Ga0097621_100318118 Ga0097621_1003181183 124
116 3300006237 Ga0097621_101825564 Ga0097621_1018255641 124
117 3300006358 Ga0068871_100021745 Ga0068871_1000217454 124
118 3300006358 Ga0068871_100391773 Ga0068871_1003917732 124
119 3300006844 Ga0075428_100009589 Ga0075428_1000095892 124
120 3300006844 Ga0075428_101673882 Ga0075428_1016738822 124
121 3300006846 Ga0075430_100042814 Ga0075430_1000428143 124
122 3300006871 Ga0075434_100211297 Ga0075434_1002112973 124
123 3300006880 Ga0075429_100001027 Ga0075429_1000010272 124
124 3300006880 Ga0075429_100943244 Ga0075429_1009432441 124
125 3300006881 Ga0068865_100001694 Ga0068865_10000169412 124
126 3300006881 Ga0068865_101202119 Ga0068865_1012021192 124
127 3300006931 Ga0097620_100050336 Ga0097620_1000503365 124
128 3300006931 Ga0097620_100237917 Ga0097620_1002379173 124
129 3300006931 Ga0097620_100571180 Ga0097620_1005711803 124
130 3300006931 Ga0097620_100779417 Ga0097620_1007794172 124
131 3300009094 Ga0111539_10012497 Ga0111539_100124973 124
132 3300009148 Ga0105243_10020653 Ga0105243_100206538 124
133 3300009148 Ga0105243_12647501 Ga0105243_126475011 124
134 3300009174 Ga0105241_11710582 Ga0105241_117105821 124
135 3300009177 Ga0105248_11464868 Ga0105248_114648682 124
136 3300009551 Ga0105238_10139100 Ga0105238_101391003 124
137 3300013105 Ga0157369_11660015 Ga0157369_116600151 124
138 3300013296 Ga0157374_10025500 Ga0157374_100255002 124
139 3300013297 Ga0157378_10000558 Ga0157378_1000055816 124
140 3300013297 Ga0157378_10527560 Ga0157378_105275602 124
141 3300013306 Ga0163162_10002211 Ga0163162_100022115 124
142 3300013306 Ga0163162_10517998 Ga0163162_105179982 124
143 3300013308 Ga0157375_10266536 Ga0157375_102665362 124
144 3300013308 Ga0157375_10291884 Ga0157375_102918842 124
145 3300013308 Ga0157375_11713847 Ga0157375_117138472 124
146 3300014326 Ga0157380_10022686 Ga0157380_100226864 124
147 3300014326 Ga0157380_11103722 Ga0157380_111037222 124
148 3300014497 Ga0182008_10119373 Ga0182008_101193732 124
149 3300014968 Ga0157379_10294207 Ga0157379_102942072 124
150 3300014968 Ga0157379_11241663 Ga0157379_112416632 124
151 3300014969 Ga0157376_10247152 Ga0157376_102471522 124
152 3300017792 Ga0163161_10022683 Ga0163161_100226835 124
153 3300017792 Ga0163161_10437150 Ga0163161_104371502 124
154 3300017792 Ga0163161_10705556 Ga0163161_107055562 124
155 3300021358 Ga0213873_10137084 Ga0213873_101370842 124
156 3300025231 Ga0207427_103927 Ga0207427_1039271 124
157 3300025256 Ga0209759_1001704 Ga0209759_100170414 124
158 3300025261 Ga0209233_1000177 Ga0209233_1000177111 124
159 3300025271 Ga0207666_1008614 Ga0207666_10086143 124
160 3300025885 Ga0207653_10157580 Ga0207653_101575802 124
161 3300025898 Ga0207692_10311791 Ga0207692_103117912 124
162 3300025898 Ga0207692_10491713 Ga0207692_104917131 124
163 3300025899 Ga0207642_10101490 Ga0207642_101014903 124
164 3300025899 Ga0207642_10291387 Ga0207642_102913873 124
165 3300025903 Ga0207680_10631629 Ga0207680_106316292 124
166 3300025905 Ga0207685_10146088 Ga0207685_101460881 124
167 3300025905 Ga0207685_10222998 Ga0207685_102229982 124
168 3300025906 Ga0207699_10088549 Ga0207699_100885492 124
169 3300025906 Ga0207699_10581069 Ga0207699_105810692 124
170 3300025907 Ga0207645_10222979 Ga0207645_102229791 124
171 3300025908 Ga0207643_10008880 Ga0207643_100088802 124
172 3300025908 Ga0207643_10614500 Ga0207643_106145002 124
173 3300025909 Ga0207705_10794808 Ga0207705_107948082 124
174 3300025909 Ga0207705_11005936 Ga0207705_110059362 124
175 3300025912 Ga0207707_10067151 Ga0207707_100671512 124
176 3300025915 Ga0207693_10050535 Ga0207693_100505353 124
177 3300025916 Ga0207663_10489185 Ga0207663_104891852 124
178 3300025917 Ga0207660_10146686 Ga0207660_101466864 124
179 3300025918 Ga0207662_10354785 Ga0207662_103547852 124
180 3300025919 Ga0207657_10061961 Ga0207657_100619615 124
181 3300025919 Ga0207657_10899705 Ga0207657_108997052 124
182 3300025921 Ga0207652_10002539 Ga0207652_1000253912 124
183 3300025923 Ga0207681_10312833 Ga0207681_103128332 124
184 3300025924 Ga0207694_10176768 Ga0207694_101767681 124
185 3300025926 Ga0207659_10503147 Ga0207659_105031472 124
186 3300025928 Ga0207700_10104016 Ga0207700_101040162 124
187 3300025928 Ga0207700_11223431 Ga0207700_112234312 124
188 3300025929 Ga0207664_10107550 Ga0207664_101075502 124
189 3300025931 Ga0207644_10385972 Ga0207644_103859722 124
190 3300025932 Ga0207690_10473107 Ga0207690_104731071 124
191 3300025933 Ga0207706_10693401 Ga0207706_106934012 124
192 3300025934 Ga0207686_10263993 Ga0207686_102639932 124
193 3300025935 Ga0207709_10047935 Ga0207709_100479352 124
194 3300025935 Ga0207709_10180738 Ga0207709_101807382 124
195 3300025936 Ga0207670_10099386 Ga0207670_100993861 124
196 3300025936 Ga0207670_10255380 Ga0207670_102553803 124
197 3300025937 Ga0207669_10145601 Ga0207669_101456013 124
198 3300025937 Ga0207669_10226346 Ga0207669_102263463 124
199 3300025937 Ga0207669_10396791 Ga0207669_103967912 124
200 3300025937 Ga0207669_10764901 Ga0207669_107649011 124
201 3300025938 Ga0207704_10016265 Ga0207704_100162652 124
202 3300025938 Ga0207704_10094487 Ga0207704_100944873 124
203 3300025938 Ga0207704_10457158 Ga0207704_104571582 124
204 3300025938 Ga0207704_10695977 Ga0207704_106959771 124
205 3300025939 Ga0207665_10065735 Ga0207665_100657352 124
206 3300025940 Ga0207691_10486908 Ga0207691_104869082 124
207 3300025941 Ga0207711_10197786 Ga0207711_101977863 124
208 3300025942 Ga0207689_10056644 Ga0207689_100566443 124
209 3300025942 Ga0207689_10309195 Ga0207689_103091953 124
210 3300025949 Ga0207667_10053503 Ga0207667_100535032 124
211 3300025960 Ga0207651_10096953 Ga0207651_100969531 124
212 3300025960 Ga0207651_10393571 Ga0207651_103935711 124
213 3300025961 Ga0207712_10045602 Ga0207712_100456022 124
214 3300025972 Ga0207668_10110057 Ga0207668_101100571 124
215 3300025972 Ga0207668_10646579 Ga0207668_106465792 124
216 3300025981 Ga0207640_10398982 Ga0207640_103989823 124
217 3300025986 Ga0207658_10697793 Ga0207658_106977931 124
218 3300025986 Ga0207658_11396921 Ga0207658_113969211 124
219 3300026023 Ga0207677_11071491 Ga0207677_110714912 124
220 3300026023 Ga0207677_11524379 Ga0207677_115243792 124
221 3300026035 Ga0207703_10109980 Ga0207703_101099804 124
222 3300026067 Ga0207678_10146483 Ga0207678_101464832 124
223 3300026067 Ga0207678_10192484 Ga0207678_101924843 124
224 3300026075 Ga0207708_10053340 Ga0207708_100533402 124
225 3300026075 Ga0207708_10147530 Ga0207708_101475304 124
226 3300026088 Ga0207641_10039796 Ga0207641_100397966 124
227 3300026088 Ga0207641_10318287 Ga0207641_103182873 124
228 3300026088 Ga0207641_11439400 Ga0207641_114394002 124
229 3300026089 Ga0207648_10002481 Ga0207648_100024814 124
230 3300026089 Ga0207648_11120321 Ga0207648_111203211 124
231 3300026095 Ga0207676_10178351 Ga0207676_101783513 124
232 3300026095 Ga0207676_10874543 Ga0207676_108745432 124
233 3300026116 Ga0207674_10192176 Ga0207674_101921763 124
234 3300026118 Ga0207675_100000738 Ga0207675_10000073823 124
235 3300026118 Ga0207675_100009279 Ga0207675_1000092794 124
236 3300026118 Ga0207675_100484854 Ga0207675_1004848542 124
237 3300026121 Ga0207683_10192077 Ga0207683_101920773 124
238 3300026121 Ga0207683_10708977 Ga0207683_107089773 124
239 3300026142 Ga0207698_10032433 Ga0207698_100324332 124
240 3300027378 Ga0209981_1021988 Ga0209981_10219881 124
241 3300027395 Ga0209996_1007946 Ga0209996_10079463 124
242 3300027471 Ga0209995_1012200 Ga0209995_10122003 124
243 3300027526 Ga0209968_1002540 Ga0209968_10025404 124
244 3300027543 Ga0209999_1015476 Ga0209999_10154763 124
245 3300027695 Ga0209966_1000001 Ga0209966_100000155 124
246 3300027907 Ga0207428_10001508 Ga0207428_1000150824 124
247 3300027907 Ga0207428_10543729 Ga0207428_105437293 124
248 3300028379 Ga0268266_10105590 Ga0268266_101055902 124
249 3300028379 Ga0268266_10140992 Ga0268266_101409923 124
250 3300028380 Ga0268265_10005309 Ga0268265_100053097 124
251 3300028380 Ga0268265_10038468 Ga0268265_100384684 124
252 3300028380 Ga0268265_10252805 Ga0268265_102528053 124
253 3300028381 Ga0268264_10004254 Ga0268264_1000425411 124
254 3300028381 Ga0268264_10566238 Ga0268264_105662382 124
255 3300028794 Ga0307515_10006495 Ga0307515_1000649511 124
256 3300028794 Ga0307515_10229316 Ga0307515_102293161 124
257 3300031247 Ga0265340_10100391 Ga0265340_101003912 124
258 3300031456 Ga0307513_10021824 Ga0307513_100218244 124
259 3300031548 Ga0307408_100098797 Ga0307408_1000987973 124
260 3300031731 Ga0307405_10338506 Ga0307405_103385062 124
261 3300031731 Ga0307405_11046604 Ga0307405_110466042 124
262 3300031824 Ga0307413_10089002 Ga0307413_100890022 124
263 3300031824 Ga0307413_10243880 Ga0307413_102438802 124
264 3300031824 Ga0307413_10275197 Ga0307413_102751972 124
265 3300031824 Ga0307413_11099302 Ga0307413_110993022 124
266 3300031852 Ga0307410_10022166 Ga0307410_100221664 124
267 3300031852 Ga0307410_10033204 Ga0307410_100332042 124
268 3300031852 Ga0307410_10321200 Ga0307410_103212003 124
269 3300031901 Ga0307406_10062211 Ga0307406_100622114 124
270 3300031901 Ga0307406_10468007 Ga0307406_104680072 124
271 3300031903 Ga0307407_10063025 Ga0307407_100630253 124
272 3300031903 Ga0307407_10531695 Ga0307407_105316951 124
273 3300031911 Ga0307412_10313417 Ga0307412_103134172 124
274 3300031911 Ga0307412_10562745 Ga0307412_105627452 124
275 3300031995 Ga0307409_100006954 Ga0307409_1000069543 124
276 3300031995 Ga0307409_100016465 Ga0307409_1000164656 124
277 3300031995 Ga0307409_100061135 Ga0307409_1000611352 124
278 3300031995 Ga0307409_101255702 Ga0307409_1012557022 124
279 3300032002 Ga0307416_100183384 Ga0307416_1001833842 124
280 3300032002 Ga0307416_100412445 Ga0307416_1004124453 124
281 3300032002 Ga0307416_100657730 Ga0307416_1006577302 124
282 3300032002 Ga0307416_102624539 Ga0307416_1026245391 124
283 3300032004 Ga0307414_10260166 Ga0307414_102601663 124
284 3300032004 Ga0307414_10576816 Ga0307414_105768162 124
285 3300032005 Ga0307411_10039548 Ga0307411_100395482 124
286 3300032005 Ga0307411_10106401 Ga0307411_101064013 124
287 3300032005 Ga0307411_10290339 Ga0307411_102903392 124
288 3300032005 Ga0307411_10401048 Ga0307411_104010482 124
289 3300032126 Ga0307415_100836804 Ga0307415_1008368042 124
290 3300035112 Ga0373932_0047877 Ga0373932_0047877_777_1223 124
291 3300035171 Ga0373946_0151072 Ga0373946_0151072_565_1011 124
292 3300035410 Ga0373924_0365736 Ga0373924_0365736_78_539 124
293 3300035695 Ga0373927_0344136 Ga0373927_0344136_265_726 124
294 3300035725 Ga0373947_0191067 Ga0373947_0191067_744_1205 124
295 3300036401 Ga0373937_0170035 Ga0373937_0170035_1115_1561 124
296 3300037068 Ga0373925_0019888 Ga0373925_0019888_1348_1809 124
297 3300037068 Ga0373925_0084790 Ga0373925_0084790_794_1240 124
298 3300037312 Ga0395899_0300017 Ga0395899_0300017_240_683 124
299 3300037418 Ga0395900_0000109 Ga0395900_0000109_107472_107918 124
300 3300037418 Ga0395900_0037275 Ga0395900_0037275_303_749 124
301 3300037418 Ga0395900_0235102 Ga0395900_0235102_913_1356 124
302 3300037466 Ga0395898_0000868 Ga0395898_0000868_16615_17061 124
303 3300037466 Ga0395898_0059151 Ga0395898_0059151_2521_2967 124
304 3300037471 Ga0395905_0015072 Ga0395905_0015072_5175_5618 124
305 3300037471 Ga0395905_0356852 Ga0395905_0356852_620_1066 124
306 3300037471 Ga0395905_0486193 Ga0395905_0486193_304_750 124
307 3300038443 Ga0395901_0000034 Ga0395901_0000034_25780_26226 124
308 3300038443 Ga0395901_0388637 Ga0395901_0388637_934_1377 124
309 3300038443 Ga0395901_1351599 Ga0395901_1351599_52_498 124
310 3300039437 Ga0436365_0763559 Ga0436365_0763559_145_591 124
311 3300039438 Ga0436360_0708455 Ga0436360_0708455_872_1315 124
312 3300039450 Ga0436363_1016859 Ga0436363_1016859_415_864 124
313 3300039450 Ga0436363_1263821 Ga0436363_1263821_467_913 124
314 3300041404 Ga0439436_0114397 Ga0439436_0114397_149_595 124
315 3300041410 Ga0439461_0078139 Ga0439461_0078139_263_709 124
316 3300041413 Ga0439465_0150332 Ga0439465_0150332_262_708 124
317 3300041451 Ga0451791_1757947 Ga0451791_1757947_60_506 124
318 3300041456 Ga0451795_0350967 Ga0451795_0350967_108_554 124
319 3300041509 Ga0451843_0525946 Ga0451843_0525946_13_459 124
320 3300042006 Ga0439432_119988 Ga0439432_119988_178_624 124
321 3300042011 Ga0439454_007975 Ga0439454_007975_726_1172 124
322 3300042012 Ga0439455_0020321 Ga0439455_0020321_461_907 124
323 3300042123 Ga0450921_038294 Ga0450921_038294_15_464 124
324 3300042133 Ga0450896_078199 Ga0450896_078199_10_456 124
325 3300042157 Ga0439458_0152469 Ga0439458_0152469_93_539 124
326 3300042532 Ga0450893_0009449 Ga0450893_0009449_22_468 124
327 3300042876 Ga0451577_0001509 Ga0451577_0001509_16047_16493 124
328 3300042876 Ga0451577_0002068 Ga0451577_0002068_8251_8706 124
329 3300042876 Ga0451577_0161635 Ga0451577_0161635_1538_1987 124
330 3300044656 Ga0466969_0000385 Ga0466969_0000385_23539_23985 124
331 3300044656 Ga0466969_0004246 Ga0466969_0004246_4687_5133 124
332 3300044656 Ga0466969_0058054 Ga0466969_0058054_360_806 124
333 3300044656 Ga0466969_0063985 Ga0466969_0063985_1236_1682 124
334 3300044658 Ga0466972_0081430 Ga0466972_0081430_91_537 124
335 3300044683 Ga0466965_0011530 Ga0466965_0011530_3375_3821 124
336 3300044683 Ga0466965_0013111 Ga0466965_0013111_65_511 124
337 3300044683 Ga0466965_0127947 Ga0466965_0127947_429_875 124
338 3300044684 Ga0466966_0006769 Ga0466966_0006769_6828_7274 124
339 3300044684 Ga0466966_0114503 Ga0466966_0114503_166_612 124
340 3300044684 Ga0466966_0501182 Ga0466966_0501182_243_689 124
341 3300044693 Ga0466961_0016947 Ga0466961_0016947_1011_1457 124
342 3300044693 Ga0466961_0034680 Ga0466961_0034680_2466_2912 124
343 3300044694 Ga0466963_0037912 Ga0466963_0037912_2067_2513 124
344 3300044706 Ga0466964_0004724 Ga0466964_0004724_3800_4246 124
345 3300044719 Ga0466971_0049165 Ga0466971_0049165_1009_1455 124
346 3300044719 Ga0466971_0083046 Ga0466971_0083046_166_612 124
347 3300044735 Ga0466968_0055678 Ga0466968_0055678_1120_1581 124
348 3300044735 Ga0466968_0114921 Ga0466968_0114921_663_1109 124
349 3300044765 Ga0466970_0006015 Ga0466970_0006015_2558_3004 124
350 3300044765 Ga0466970_0031405 Ga0466970_0031405_59_505 124
351 3300044765 Ga0466970_0341655 Ga0466970_0341655_210_656 124
352 3300044842 Ga0466957_0008708 Ga0466957_0008708_4944_5390 124
353 3300044842 Ga0466957_0033045 Ga0466957_0033045_1115_1561 124
354 3300044842 Ga0466957_0134428 Ga0466957_0134428_678_1124 124
355 3300045049 Ga0466959_0000371 Ga0466959_0000371_16629_17075 124
356 3300045049 Ga0466959_0019821 Ga0466959_0019821_3634_4080 124
357 3300045049 Ga0466959_0068137 Ga0466959_0068137_1017_1463 124
358 3300045976 Ga0466967_0029942 Ga0466967_0029942_985_1431 124
359 3300046458 Ga0495591_057177 Ga0495591_057177_445_891 124
360 3300046460 Ga0495638_0027785 Ga0495638_0027785_435_881 124
361 3300046474 Ga0495605_0002703 Ga0495605_0002703_799_1245 124
362 3300046491 Ga0495584_0035996 Ga0495584_0035996_1661_2107 124
363 3300046492 Ga0495585_0100349 Ga0495585_0100349_37_483 124
364 3300046500 Ga0495596_0103798 Ga0495596_0103798_148_594 124
365 3300046501 Ga0495607_0063268 Ga0495607_0063268_348_794 124
366 3300046513 Ga0495616_0256712 Ga0495616_0256712_226_672 124
367 3300046523 Ga0495644_0233840 Ga0495644_0233840_105_551 124
368 3300046616 Ga0495668_0084078 Ga0495668_0084078_693_1142 124
369 3300046660 Ga0495625_0047245 Ga0495625_0047245_141_587 124
370 3300046681 Ga0495647_0103716 Ga0495647_0103716_163_624 124
371 3300046691 Ga0495670_0063648 Ga0495670_0063648_437_883 124
372 3300046794 Ga0495589_0007503 Ga0495589_0007503_1864_2310 124
373 3300047318 Ga0495636_0067752 Ga0495636_0067752_355_804 124
374 3300047445 Ga0495677_0119164 Ga0495677_0119164_463_909 124
375 3300047447 Ga0495685_224418 Ga0495685_224418_52_501 124
376 3300048903 Ga0496100_0298902 Ga0496100_0298902_95_538 124
377 3300048904 Ga0496101_0066810 Ga0496101_0066810_1165_1611 124
378 3300048905 Ga0496102_0440243 Ga0496102_0440243_10_456 124
379 3300048906 Ga0496103_0238298 Ga0496103_0238298_672_1118 124
380 3300048907 Ga0496104_0158503 Ga0496104_0158503_1351_1797 124
381 3300048909 Ga0496106_0089038 Ga0496106_0089038_1238_1684 124
382 3300048909 Ga0496106_0539501 Ga0496106_0539501_86_529 124
383 3300048910 Ga0496107_0029263 Ga0496107_0029263_1901_2347 124
384 3300048910 Ga0496107_0180875 Ga0496107_0180875_1002_1445 124
385 3300048911 Ga0496108_0393542 Ga0496108_0393542_470_913 124
386 3300048913 Ga0496110_0055321 Ga0496110_0055321_1631_2077 124
387 3300048913 Ga0496110_0269288 Ga0496110_0269288_684_1133 124
388 3300048915 Ga0496112_0345302 Ga0496112_0345302_168_611 124
389 3300048915 Ga0496112_1039726 Ga0496112_1039726_38_421 124
390 3300048917 Ga0496114_0164802 Ga0496114_0164802_1102_1548 124
391 3300048917 Ga0496114_0305742 Ga0496114_0305742_181_627 124
392 3300048917 Ga0496114_1227508 Ga0496114_1227508_158_604 124
393 3300048918 Ga0496115_0659536 Ga0496115_0659536_172_615 124
394 3300048926 Ga0496123_0161144 Ga0496123_0161144_701_1150 124
395 3300049128 Ga0501308_000354 Ga0501308_000354_1829_2275 124
396 3300049160 Ga0501304_008706 Ga0501304_008706_98_544 124
397 3300049528 Ga0501312_022972 Ga0501312_022972_134_580 124
398 3300049574 Ga0501038_0829491 Ga0501038_0829491_169_615 124
399 3300049575 Ga0501039_0818607 Ga0501039_0818607_182_628 124
400 3300049576 Ga0501040_0569152 Ga0501040_0569152_237_683 124
401 3300049576 Ga0501040_0990743 Ga0501040_0990743_146_592 124
402 3300049579 Ga0501043_0417886 Ga0501043_0417886_438_884 124
403 3300049580 Ga0501046_0191879 Ga0501046_0191879_702_1148 124
404 3300049581 Ga0501047_0270217 Ga0501047_0270217_719_1165 124
405 3300049587 Ga0501071_0051711 Ga0501071_0051711_973_1419 124
406 3300049590 Ga0501074_0707138 Ga0501074_0707138_118_564 124
407 3300049662 Ga0501222_003042 Ga0501222_003042_688_1134 124
408 3300049678 Ga0501248_003193 Ga0501248_003193_346_792 124
409 3300049742 Ga0501080_0011561 Ga0501080_0011561_4348_4794 124
410 3300049822 Ga0501035_0734891 Ga0501035_0734891_93_539 124
411 3300049823 Ga0501044_0070992 Ga0501044_0070992_2858_3304 124
412 3300049823 Ga0501044_0562340 Ga0501044_0562340_229_675 124
413 3300050491 nmdc:mga00v17_10262_c1 nmdc:mga00v17_10262_c1_2840_3289 124
414 3300050493 nmdc:mga0k408_184286_c1 nmdc:mga0k408_184286_c1_686_1132 124
415 3300050493 nmdc:mga0k408_23053_c1 nmdc:mga0k408_23053_c1_1426_1875 124
416 3300050493 nmdc:mga0k408_36032_c1 nmdc:mga0k408_36032_c1_327_773 124
417 3300050493 nmdc:mga0k408_567323_c1 nmdc:mga0k408_567323_c1_104_550 124
418 3300050493 nmdc:mga0k408_71133_c1 nmdc:mga0k408_71133_c1_938_1384 124
419 3300050493 nmdc:mga0k408_96536_c1 nmdc:mga0k408_96536_c1_519_965 124
420 3300050494 nmdc:mga06z11_190279_c1 nmdc:mga06z11_190279_c1_569_1015 124
421 3300050508 nmdc:mga09592_3159_c1 nmdc:mga09592_3159_c1_12750_13196 124
422 3300050508 nmdc:mga09592_85620_c1 nmdc:mga09592_85620_c1_2082_2528 124
423 3300050511 nmdc:mga08y16_1378_c1 nmdc:mga08y16_1378_c1_3197_3643 124
424 3300050511 nmdc:mga08y16_928350_c1 nmdc:mga08y16_928350_c1_350_796 124
425 3300050512 nmdc:mga0n895_108750_c1 nmdc:mga0n895_108750_c1_1766_2215 124
426 3300050516 nmdc:mga0sz30_17214_c1 nmdc:mga0sz30_17214_c1_961_1410 124
427 3300053140 Ga0500573_0085281 Ga0500573_0085281_791_1243 124
428 3300053727 Ga0500611_118544 Ga0500611_118544_69_515 124
429 3300054114 Ga0501084_1310832 Ga0501084_1310832_58_504 124
430 3300059491 Ga0587070_080667 Ga0587070_080667_126_572 124
431 3300061719 Ga0466962_0038021 Ga0466962_0038021_1001_1447 124
432 3300061719 Ga0466962_0248603 Ga0466962_0248603_166_612 124
433 3300061734 Ga0530510_0326330 Ga0530510_0326330_93_539 124
434 3300000546 LJNas_1005518 LJNas_10055182 125
435 3300009545 Ga0105237_11532494 Ga0105237_115324942 125
436 3300031731 Ga0307405_10917778 Ga0307405_109177781 125
437 3300042876 Ga0451577_0029130 Ga0451577_0029130_433_882 125
438 3300044683 Ga0466965_0004790 Ga0466965_0004790_4410_4859 125
439 3300044684 Ga0466966_0008119 Ga0466966_0008119_423_872 125
440 3300044693 Ga0466961_0024171 Ga0466961_0024171_1946_2395 125
441 3300044706 Ga0466964_0170101 Ga0466964_0170101_237_686 125
442 3300044712 Ga0453684_0107132 Ga0453684_0107132_656_1105 125
443 3300044719 Ga0466971_0460213 Ga0466971_0460213_75_524 125
444 3300044735 Ga0466968_0133716 Ga0466968_0133716_361_810 125
445 3300044842 Ga0466957_0065983 Ga0466957_0065983_561_1010 125
446 3300045049 Ga0466959_0230665 Ga0466959_0230665_103_552 125
447 3300045051 Ga0451576_0050384 Ga0451576_0050384_3033_3482 125
448 3300045836 Ga0466958_0064403 Ga0466958_0064403_1376_1825 125
449 3300045976 Ga0466967_0834771 Ga0466967_0834771_77_526 125
450 3300048924 Ga0496121_0005472 Ga0496121_0005472_7846_8304 125
451 3300048928 Ga0496125_0008779 Ga0496125_0008779_2090_2548 125
452 3300049571 Ga0501034_0000782 Ga0501034_0000782_1423_1875 125
453 3300049572 Ga0501036_0012821 Ga0501036_0012821_4029_4481 125
454 3300049573 Ga0501037_0001742 Ga0501037_0001742_9543_9995 125
455 3300049574 Ga0501038_0019217 Ga0501038_0019217_11_463 125
456 3300049579 Ga0501043_0010954 Ga0501043_0010954_237_689 125
457 3300049580 Ga0501046_0471045 Ga0501046_0471045_386_838 125
458 3300049581 Ga0501047_0003501 Ga0501047_0003501_13531_13983 125
459 3300049582 Ga0501048_0327676 Ga0501048_0327676_42_494 125
460 3300049584 Ga0501068_0498287 Ga0501068_0498287_14_466 125
461 3300049586 Ga0501070_1356794 Ga0501070_1356794_34_486 125
462 3300049589 Ga0501073_0011794 Ga0501073_0011794_4210_4662 125
463 3300049590 Ga0501074_0018945 Ga0501074_0018945_3885_4337 125
464 3300049742 Ga0501080_0001498 Ga0501080_0001498_13790_14242 125
465 3300049744 Ga0501083_0028970 Ga0501083_0028970_3007_3459 125
466 3300049822 Ga0501035_0031986 Ga0501035_0031986_54_506 125
467 3300049823 Ga0501044_0027547 Ga0501044_0027547_3963_4415 125
468 3300060353 Ga0501082_0035136 Ga0501082_0035136_3693_4145 125
469 3300061719 Ga0466962_0052241 Ga0466962_0052241_101_550 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

4

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1moj-assembly1.cif.gz_A crystal structure of an archaeal dps-homologue from halobacterium salinarum 0.8263 48 98
3v1c-assembly1.cif.gz_A crystal structure of de novo designed mid1-zinc 0.8205 54 95
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7684 3 124
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7478 3 124
3v1c-assembly1.cif.gz_A crystal structure of de novo designed mid1-zinc 0.7424 54 95
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9754 4 91 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9599 4 91 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9508 3 91 1.10.1510.10
1bgfA00 Mainly Alpha;Orthogonal Bundle;Transcription Factor, Stat-4;STAT transcription factor, N-terminal domain 0.9489 53 89 1.10.532.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9391 4 91 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7X7B134-F1-model_v4 GatB/YqeY domain-containing protein 0.9957 3 86 GO:0016884
AF-A0A7C5PW84-F1-model_v4 GatB/YqeY domain-containing protein 0.9942 4 96 GO:0016884
AF-A0A382G0K5-F1-model_v4 GatB/YqeY domain-containing protein 0.9916 3 93 GO:0016884
AF-A0A7X8DSJ1-F1-model_v4 GatB/YqeY domain-containing protein 0.9905 1 92 GO:0016884
AF-A0A3D1V535-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9878 3 91 GO:0016740
GO:0016884

Feature Viewer

pLDDT pTM Quality
92.28 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map