F450227

General Info

Members Datasets Scaffolds Average Seq Length
469 270 455 380

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10004458|Ga0105241_100044585
Length 414
Sequence MLARYRAALLGGRLRTLRYTHRAISPLDRRLFPMKITDIKTYALRSPLEVPFAFSQGWVRQRSATLVEVLTDEGVSGWGEAFAQGLEPPQIAVAAIESALKPLVLGADPLDTEVLWHRMYHQTRDYGRKGSVVSAISAVDIALWDIAGKVRGVPVHKLLGGAFRTKVQAYATGFYRISGQGEAKRLGEEAIRHYDAGFTAMKVKLGYGLQDDIAVMREIRRALGEREVTLMVDTNHAYGVADAIRLGRALEEYNLRWYEEPVVPEDLAGYREVRQALSMPIAGGENEHTLFGFRELLGQRCVDIAQPDLGSCGGLTACRHIIALAHSHGVQVNPHVWGSAIAQAASLQAIAAVPVAHHSVFAQEPIFEYDRSSHPFRQHLVKEPLEQASGWLDVPTKAGLGVEVDRAVLDKQRL

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
7 2842694124 Methylopila sp. R-72369 Isolate Unclassified
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
10 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
11 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
12 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
13 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
246 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
261 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.74
Nodule 1.07
Rhizoplane 1.07
Rhizosphere 83.8
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000018 3300003203 Bacteria 88860
2 JGI25404J52841_10000274 3300003659 Bacteria 6593
3 JGI25405J52794_10011943 3300003911 Bacteria 1666
4 Ga0070658_10002031 3300005327 Bacteria 16967
5 Ga0070658_10006314 3300005327 Bacteria 9600
6 Ga0070658_10020894 3300005327 Bacteria 5245
7 Ga0070690_100015202 3300005330 Bacteria 4586
8 Ga0070670_100183898 3300005331 Bacteria 1815
9 Ga0070670_100252705 3300005331 Bacteria 1536
10 Ga0070670_100307620 3300005331 Bacteria 1387
11 Ga0068869_100037746 3300005334 Bacteria 3436
12 Ga0070666_10030456 3300005335 Bacteria 3555
13 Ga0070666_10119170 3300005335 Bacteria 1829
14 Ga0070680_100000741 3300005336 Bacteria 22784
15 Ga0070680_100002836 3300005336 Bacteria 12877
16 Ga0070680_100106966 3300005336 Bacteria 2326
17 Ga0070680_100174224 3300005336 Bacteria 1811
18 Ga0068868_100079491 3300005338 Bacteria 2627
19 Ga0070660_100021944 3300005339 Bacteria 4715
20 Ga0070689_100032609 3300005340 Bacteria 3963
21 Ga0070689_100286224 3300005340 Bacteria 1368
22 Ga0070691_10072476 3300005341 Bacteria 1673
23 Ga0070687_100014048 3300005343 Bacteria 3587
24 Ga0070687_100090571 3300005343 Bacteria 1691
25 Ga0070668_100013784 3300005347 Bacteria 6038
26 Ga0070669_100010981 3300005353 Bacteria 6427
27 Ga0070675_100015642 3300005354 Bacteria 6004
28 Ga0070675_100165966 3300005354 Bacteria 1901
29 Ga0070675_100204224 3300005354 Bacteria 1716
30 Ga0070675_100207959 3300005354 Bacteria 1700
31 Ga0070674_100185769 3300005356 Bacteria 1595
32 Ga0070674_100238131 3300005356 Bacteria 1423
33 Ga0070673_100021862 3300005364 Bacteria 4648
34 Ga0070667_100025046 3300005367 Bacteria 4959
35 Ga0070667_100052922 3300005367 Bacteria 3426
36 Ga0070667_100224320 3300005367 Bacteria 1674
37 Ga0070714_100010379 3300005435 Bacteria 7362
38 Ga0070714_100036235 3300005435 Bacteria 4137
39 Ga0070714_100223679 3300005435 Bacteria 1731
40 Ga0070701_10017671 3300005438 Bacteria 3338
41 Ga0070705_100079320 3300005440 Bacteria 2010
42 Ga0070700_100006278 3300005441 Bacteria 6343
43 Ga0070700_100008016 3300005441 Bacteria 5739
44 Ga0070663_100155877 3300005455 Bacteria 1755
45 Ga0070681_10004167 3300005458 Bacteria 13682
46 Ga0070681_10021861 3300005458 Bacteria 6416
47 Ga0070681_10025434 3300005458 Bacteria 5954
48 Ga0068867_100007430 3300005459 Bacteria 7749
49 Ga0070698_100011079 3300005471 Bacteria 9580
50 Ga0070699_100083278 3300005518 Bacteria 2790
51 Ga0070679_100004458 3300005530 Bacteria 12932
52 Ga0070679_100014802 3300005530 Bacteria 7495
53 Ga0070679_100075444 3300005530 Bacteria 3361
54 Ga0070697_100101284 3300005536 Bacteria 2393
55 Ga0068853_100045367 3300005539 Bacteria 3764
56 Ga0068853_100049715 3300005539 Bacteria 3604
57 Ga0070672_100017628 3300005543 Bacteria 5144
58 Ga0070672_100018763 3300005543 Bacteria 5009
59 Ga0070672_100093670 3300005543 Bacteria 2427
60 Ga0070672_100129460 3300005543 Bacteria 2073
61 Ga0070686_100053831 3300005544 Bacteria 2572
62 Ga0070696_100026782 3300005546 Bacteria 3924
63 Ga0070696_100045164 3300005546 Bacteria 3053
64 Ga0070696_100071078 3300005546 Unclassified 2448
65 Ga0070665_100047856 3300005548 Bacteria 4292
66 Ga0070665_100049804 3300005548 Bacteria 4203
67 Ga0070665_100082773 3300005548 Bacteria 3214
68 Ga0070665_100270703 3300005548 Bacteria 1700
69 Ga0070704_100040948 3300005549 Bacteria 3194
70 Ga0068855_100048582 3300005563 Bacteria 5007
71 Ga0068855_100055032 3300005563 Bacteria 4674
72 Ga0068855_100056571 3300005563 Bacteria 4601
73 Ga0068855_100150310 3300005563 Bacteria 2648
74 Ga0068855_100159194 3300005563 Bacteria 2564
75 Ga0068855_100291946 3300005563 Bacteria 1807
76 Ga0068856_100112486 3300005614 Bacteria 2720
77 Ga0070702_100008684 3300005615 Bacteria 4933
78 Ga0068852_100079169 3300005616 Bacteria 2910
79 Ga0068859_100014834 3300005617 Bacteria 7824
80 Ga0068859_100172941 3300005617 Bacteria 2242
81 Ga0068859_100336482 3300005617 Bacteria 1604
82 Ga0068866_10033067 3300005718 Bacteria 2505
83 Ga0068861_100005130 3300005719 Bacteria 8829
84 Ga0068861_100263040 3300005719 Unclassified 1478
85 Ga0068870_10008353 3300005840 Bacteria 4656
86 Ga0068870_10073530 3300005840 Bacteria 1870
87 Ga0068863_100026280 3300005841 Bacteria 5554
88 Ga0068858_100010760 3300005842 Bacteria 8650
89 Ga0068860_100010602 3300005843 Bacteria 9102
90 Ga0068860_100011335 3300005843 Bacteria 8784
91 Ga0068860_100022669 3300005843 Bacteria 6070
92 Ga0068860_100236070 3300005843 Bacteria 1778
93 Ga0068862_100015480 3300005844 Bacteria 6333
94 Ga0068862_100016798 3300005844 Bacteria 6093
95 Ga0081455_10001072 3300005937 Bacteria 34412
96 Ga0081455_10041944 3300005937 Bacteria 4020
97 Ga0081540_1000453 3300005983 Bacteria 40674
98 Ga0081540_1002154 3300005983 Bacteria 16364
99 Ga0081540_1022633 3300005983 Bacteria 3707
100 Ga0081539_10000003 3300005985 Bacteria 594833
101 Ga0081539_10000394 3300005985 Bacteria 93943
102 Ga0081539_10000513 3300005985 Bacteria 80514
103 Ga0081539_10006162 3300005985 Bacteria 11669
104 Ga0075365_10087071 3300006038 Bacteria 2123
105 Ga0075365_10091518 3300006038 Bacteria 2073
106 Ga0075363_100002202 3300006048 Bacteria 7862
107 Ga0070712_100116241 3300006175 Bacteria 2006
108 Ga0075362_10001920 3300006177 Bacteria 6820
109 Ga0075367_10008139 3300006178 Bacteria 5415
110 Ga0075367_10036912 3300006178 Bacteria 2836
111 Ga0075369_10000902 3300006186 Bacteria 9831
112 Ga0075369_10030765 3300006186 Bacteria 2262
113 Ga0097621_100005194 3300006237 Bacteria 9146
114 Ga0068871_100016690 3300006358 Bacteria 5538
115 Ga0068871_100150897 3300006358 Bacteria 1982
116 Ga0075428_100011049 3300006844 Bacteria 10044
117 Ga0075428_100027100 3300006844 Bacteria 6345
118 Ga0075428_100027825 3300006844 Bacteria 6255
119 Ga0075430_100000290 3300006846 Bacteria 35396
120 Ga0075430_100064202 3300006846 Bacteria 3084
121 Ga0075430_100162765 3300006846 Bacteria 1857
122 Ga0075431_100004958 3300006847 Bacteria 13099
123 Ga0075429_100000007 3300006880 Bacteria 90776
124 Ga0075429_100128297 3300006880 Bacteria 2218
125 Ga0068865_100017333 3300006881 Bacteria 4631
126 Ga0068865_100018935 3300006881 Bacteria 4450
127 Ga0075436_100000304 3300006914 Bacteria 31495
128 Ga0075436_100030135 3300006914 Bacteria 3734
129 Ga0097620_100014834 3300006931 Bacteria 7824
130 Ga0097620_100172934 3300006931 Bacteria 2242
131 Ga0097620_100336484 3300006931 Bacteria 1604
132 Ga0105240_10005077 3300009093 Bacteria 19731
133 Ga0105240_10013278 3300009093 Bacteria 11324
134 Ga0105240_10015823 3300009093 Bacteria 10234
135 Ga0111539_10248592 3300009094 Bacteria 2071
136 Ga0111539_10282016 3300009094 Bacteria 1933
137 Ga0111539_10385981 3300009094 Bacteria 1631
138 Ga0105245_10005272 3300009098 Bacteria 11355
139 Ga0114129_10006414 3300009147 Bacteria 16679
140 Ga0105243_10000663 3300009148 Bacteria 34005
141 Ga0105243_10005946 3300009148 Bacteria 9452
142 Ga0105243_10027109 3300009148 Bacteria 4388
143 Ga0105241_10004458 3300009174 Bacteria 10357
144 Ga0105242_10081985 3300009176 Bacteria 2699
145 Ga0105248_10048206 3300009177 Bacteria 4778
146 Ga0105248_10388574 3300009177 Bacteria 1571
147 Ga0105237_10010778 3300009545 Bacteria 9702
148 Ga0105238_10033618 3300009551 Bacteria 5219
149 Ga0105238_10118906 3300009551 Bacteria 2623
150 Ga0105249_10008959 3300009553 Bacteria 8740
151 Ga0105249_10012978 3300009553 Bacteria 7354
152 Ga0105246_10122744 3300011119 Bacteria 1927
153 Ga0105246_10134179 3300011119 Bacteria 1853
154 Ga0105246_10333455 3300011119 Bacteria 1237
155 Ga0157369_10299381 3300013105 Bacteria 1673
156 Ga0157378_10041218 3300013297 Bacteria 4095
157 Ga0163162_10011462 3300013306 Bacteria 8646
158 Ga0157372_10083487 3300013307 Bacteria 3619
159 Ga0157372_10108476 3300013307 Bacteria 3177
160 Ga0157375_10005895 3300013308 Bacteria 10675
161 Ga0157375_10063544 3300013308 Bacteria 3673
162 Ga0157375_10241330 3300013308 Bacteria 1967
163 Ga0163163_10078524 3300014325 Bacteria 3298
164 Ga0157380_10001362 3300014326 Bacteria 15916
165 Ga0157380_10272995 3300014326 Bacteria 1542
166 Ga0157379_10102971 3300014968 Bacteria 2562
167 Ga0157376_10232371 3300014969 Bacteria 1714
168 Ga0157376_10407805 3300014969 Bacteria 1316
169 Ga0163161_10017062 3300017792 Bacteria 5078
170 Ga0163161_10096508 3300017792 Bacteria 2194
171 Ga0163161_10214786 3300017792 Bacteria 1487
172 Ga0213876_10008623 3300021384 Bacteria 5516
173 Ga0209025_1000198 3300025294 Bacteria 146276
174 Ga0209564_1000787 3300025295 Bacteria 43953
175 Ga0207426_1035941 3300025302 Bacteria 1578
176 Ga0207688_10068866 3300025901 Bacteria 2005
177 Ga0207680_10082835 3300025903 Bacteria 2020
178 Ga0207645_10002887 3300025907 Bacteria 13289
179 Ga0207645_10081980 3300025907 Bacteria 2068
180 Ga0207643_10034734 3300025908 Bacteria 2826
181 Ga0207643_10081100 3300025908 Bacteria 1880
182 Ga0207643_10081864 3300025908 Bacteria 1871
183 Ga0207705_10029261 3300025909 Bacteria 3927
184 Ga0207705_10032559 3300025909 Bacteria 3726
185 Ga0207705_10308535 3300025909 Bacteria 1214
186 Ga0207654_10003808 3300025911 Bacteria 7607
187 Ga0207707_10007388 3300025912 Bacteria 9570
188 Ga0207707_10029434 3300025912 Bacteria 4801
189 Ga0207707_10032866 3300025912 Bacteria 4541
190 Ga0207707_10167424 3300025912 Bacteria 1921
191 Ga0207695_10034056 3300025913 Bacteria 5546
192 Ga0207660_10011260 3300025917 Bacteria 5817
193 Ga0207660_10083005 3300025917 Bacteria 2359
194 Ga0207662_10082617 3300025918 Bacteria 1962
195 Ga0207657_10015839 3300025919 Bacteria 7285
196 Ga0207649_10022044 3300025920 Bacteria 3676
197 Ga0207649_10074621 3300025920 Bacteria 2177
198 Ga0207652_10017793 3300025921 Bacteria 5822
199 Ga0207652_10102803 3300025921 Bacteria 2526
200 Ga0207681_10001194 3300025923 Bacteria 16727
201 Ga0207681_10133877 3300025923 Bacteria 1836
202 Ga0207694_10085186 3300025924 Bacteria 2487
203 Ga0207650_10036594 3300025925 Bacteria 3572
204 Ga0207650_10041995 3300025925 Bacteria 3354
205 Ga0207650_10297452 3300025925 Bacteria 1317
206 Ga0207659_10018824 3300025926 Bacteria 4533
207 Ga0207659_10045381 3300025926 Bacteria 3098
208 Ga0207659_10091362 3300025926 Bacteria 2274
209 Ga0207659_10321461 3300025926 Bacteria 1277
210 Ga0207687_10026465 3300025927 Bacteria 3885
211 Ga0207687_10312297 3300025927 Bacteria 1270
212 Ga0207644_10150069 3300025931 Bacteria 1803
213 Ga0207706_10013819 3300025933 Bacteria 7325
214 Ga0207709_10010813 3300025935 Bacteria 5026
215 Ga0207709_10012200 3300025935 Bacteria 4735
216 Ga0207709_10081875 3300025935 Bacteria 2083
217 Ga0207670_10028494 3300025936 Bacteria 3546
218 Ga0207704_10000824 3300025938 Bacteria 13722
219 Ga0207691_10015700 3300025940 Bacteria 7199
220 Ga0207691_10084455 3300025940 Bacteria 2850
221 Ga0207691_10306459 3300025940 Bacteria 1364
222 Ga0207711_10018859 3300025941 Bacteria 5735
223 Ga0207711_10051378 3300025941 Bacteria 3530
224 Ga0207711_10076120 3300025941 Bacteria 2922
225 Ga0207711_10145916 3300025941 Bacteria 2132
226 Ga0207689_10000761 3300025942 Bacteria 30915
227 Ga0207689_10003878 3300025942 Bacteria 13627
228 Ga0207689_10005785 3300025942 Bacteria 10979
229 Ga0207689_10064305 3300025942 Bacteria 3019
230 Ga0207689_10099297 3300025942 Bacteria 2392
231 Ga0207679_10251401 3300025945 Bacteria 1503
232 Ga0207667_10031922 3300025949 Bacteria 5680
233 Ga0207667_10087810 3300025949 Bacteria 3217
234 Ga0207667_10113979 3300025949 Bacteria 2787
235 Ga0207651_10162480 3300025960 Bacteria 1752
236 Ga0207712_10067988 3300025961 Bacteria 2551
237 Ga0207668_10007338 3300025972 Bacteria 6552
238 Ga0207668_10010449 3300025972 Bacteria 5607
239 Ga0207668_10134223 3300025972 Bacteria 1894
240 Ga0207668_10136848 3300025972 Bacteria 1878
241 Ga0207658_10001408 3300025986 Bacteria 18738
242 Ga0207658_10041762 3300025986 Bacteria 3323
243 Ga0207658_10125045 3300025986 Bacteria 2057
244 Ga0207658_10190257 3300025986 Bacteria 1705
245 Ga0207677_10099096 3300026023 Bacteria 2139
246 Ga0207703_10049717 3300026035 Bacteria 3390
247 Ga0207703_10122259 3300026035 Bacteria 2236
248 Ga0207639_10008661 3300026041 Bacteria 6983
249 Ga0207639_10035118 3300026041 Bacteria 3708
250 Ga0207678_10053310 3300026067 Bacteria 3486
251 Ga0207678_10210451 3300026067 Bacteria 1663
252 Ga0207708_10006823 3300026075 Bacteria 8442
253 Ga0207708_10036366 3300026075 Bacteria 3749
254 Ga0207708_10221858 3300026075 Bacteria 1515
255 Ga0207641_10003923 3300026088 Bacteria 13008
256 Ga0207641_10013014 3300026088 Bacteria 6823
257 Ga0207648_10000431 3300026089 Bacteria 46287
258 Ga0207648_10038923 3300026089 Bacteria 4183
259 Ga0207676_10076659 3300026095 Bacteria 2702
260 Ga0207675_100000403 3300026118 Bacteria 41503
261 Ga0207675_100003070 3300026118 Bacteria 16380
262 Ga0207675_100006922 3300026118 Bacteria 10729
263 Ga0207675_100246533 3300026118 Bacteria 1728
264 Ga0207675_100283752 3300026118 Bacteria 1609
265 Ga0207683_10053687 3300026121 Bacteria 3534
266 Ga0207683_10180485 3300026121 Bacteria 1914
267 Ga0207683_10223550 3300026121 Bacteria 1716
268 Ga0207683_10386379 3300026121 Bacteria 1287
269 Ga0207698_10015969 3300026142 Bacteria 5048
270 Ga0207698_10039540 3300026142 Bacteria 3496
271 Ga0209967_1001709 3300027364 Bacteria 2823
272 Ga0207428_10115030 3300027907 Bacteria 2067
273 Ga0268266_10017284 3300028379 Bacteria 6157
274 Ga0268266_10038411 3300028379 Bacteria 4076
275 Ga0268266_10056477 3300028379 Bacteria 3377
276 Ga0268266_10178713 3300028379 Bacteria 1931
277 Ga0268265_10008108 3300028380 Bacteria 7098
278 Ga0268265_10014558 3300028380 Bacteria 5361
279 Ga0268265_10190758 3300028380 Bacteria 1769
280 Ga0268265_10241278 3300028380 Bacteria 1595
281 Ga0268264_10032586 3300028381 Bacteria 4276
282 Ga0268264_10111516 3300028381 Unclassified 2396
283 Ga0268264_10230074 3300028381 Bacteria 1711
284 Ga0268264_10268159 3300028381 Bacteria 1594
285 Ga0268264_10403572 3300028381 Bacteria 1314
286 Ga0307515_10195062 3300028794 Bacteria 1921
287 Ga0265330_10032695 3300031235 Bacteria 2330
288 Ga0265340_10033336 3300031247 Bacteria 2564
289 Ga0307408_100007788 3300031548 Bacteria 7079
290 Ga0265342_10000608 3300031712 Bacteria 37799
291 Ga0307405_10089194 3300031731 Bacteria 2037
292 Ga0307405_10101126 3300031731 Bacteria 1933
293 Ga0307413_10001385 3300031824 Bacteria 9119
294 Ga0307406_10007116 3300031901 Bacteria 6193
295 Ga0307407_10005330 3300031903 Bacteria 5569
296 Ga0307409_100149178 3300031995 Bacteria 2027
297 Ga0307416_100020027 3300032002 Bacteria 4761
298 Ga0307414_10030529 3300032004 Bacteria 3522
299 Ga0307411_10003445 3300032005 Bacteria 7341
300 Ga0307415_100027006 3300032126 Bacteria 3630
301 Ga0307415_100030906 3300032126 Bacteria 3444
302 Ga0316583_10003931 3300032133 Bacteria 5279
303 Ga0373936_0049111 3300035113 Bacteria 1704
304 Ga0373936_0067611 3300035113 Bacteria 1469
305 Ga0373941_0045400 3300035115 Bacteria 1375
306 Ga0373960_0002432 3300035121 Bacteria 4184
307 Ga0316574_0062550 3300035398 Bacteria 2339
308 Ga0316574_0166506 3300035398 Bacteria 1420
309 Ga0395905_0029678 3300037471 Bacteria 5154
310 Ga0395905_0248028 3300037471 Bacteria 1663
311 Ga0436365_0137793 3300039437 Bacteria 11084
312 Ga0436360_1256644 3300039438 Bacteria 8298
313 Ga0436363_1540084 3300039450 Bacteria 3639
314 Ga0436362_0351219 3300039453 Bacteria 2397
315 Ga0439441_002147 3300042001 Bacteria 2731
316 Ga0439460_0012075 3300042461 Bacteria 2235
317 Ga0453684_0201954 3300044712 Bacteria 2317
318 Ga0466968_0007627 3300044735 Bacteria 4121
319 Ga0466959_0180599 3300045049 Bacteria 1476
320 Ga0451576_0001414 3300045051 Bacteria 41151
321 Ga0451576_0343560 3300045051 Bacteria 1563
322 Ga0451576_0391232 3300045051 Bacteria 1457
323 Ga0495638_0004912 3300046460 Bacteria 10048
324 Ga0495650_0024442 3300046471 Bacteria 2853
325 Ga0495607_0054704 3300046501 Bacteria 2299
326 Ga0495610_0031468 3300046512 Bacteria 2768
327 Ga0495620_0028293 3300046515 Bacteria 2609
328 Ga0495631_0008412 3300046518 Bacteria 5201
329 Ga0495631_0105114 3300046518 Bacteria 1215
330 Ga0495654_0018359 3300046530 Bacteria 3666
331 Ga0495621_0060019 3300046539 Bacteria 1379
332 Ga0495622_0010614 3300046557 Bacteria 4249
333 Ga0495670_0012923 3300046691 Bacteria 4104
334 Ga0495672_0082562 3300047320 Bacteria 1787
335 Ga0495686_0028440 3300047472 Bacteria 3641
336 Ga0495593_0102166 3300047673 Bacteria 1470
337 Ga0496108_0352619 3300048911 Bacteria 1284
338 Ga0496111_0081190 3300048914 Bacteria 2367
339 Ga0496112_0036065 3300048915 Bacteria 4821
340 Ga0496113_0047701 3300048916 Bacteria 3184
341 Ga0496116_0007139 3300048919 Bacteria 9992
342 Ga0496119_0022978 3300048922 Bacteria 4441
343 Ga0496119_0035825 3300048922 Bacteria 3246
344 Ga0496121_0000458 3300048924 Bacteria 80207
345 Ga0496121_0003608 3300048924 Bacteria 21852
346 Ga0496121_0042666 3300048924 Bacteria 3941
347 Ga0496122_0013886 3300048925 Bacteria 7837
348 Ga0496123_0010227 3300048926 Bacteria 8323
349 Ga0496125_0004370 3300048928 Bacteria 16372
350 Ga0496125_0034452 3300048928 Bacteria 4463
351 Ga0496125_0049815 3300048928 Bacteria 3475
352 Ga0496126_0013480 3300048929 Bacteria 8307
353 Ga0496126_0126254 3300048929 Bacteria 2214
354 Ga0496126_0134162 3300048929 Bacteria 2137
355 Ga0501034_0000997 3300049571 Bacteria 40545
356 Ga0501034_0028775 3300049571 Bacteria 5653
357 Ga0501036_0042208 3300049572 Bacteria 3862
358 Ga0501036_0121327 3300049572 Bacteria 2207
359 Ga0501036_0289574 3300049572 Bacteria 1370
360 Ga0501038_0116606 3300049574 Bacteria 2207
361 Ga0501038_0143656 3300049574 Bacteria 1950
362 Ga0501039_0010471 3300049575 Bacteria 7066
363 Ga0501039_0123244 3300049575 Bacteria 2032
364 Ga0501040_0021547 3300049576 Bacteria 4306
365 Ga0501040_0054893 3300049576 Bacteria 2732
366 Ga0501040_0110357 3300049576 Bacteria 1923
367 Ga0501040_0216805 3300049576 Bacteria 1361
368 Ga0501041_0002717 3300049577 Bacteria 10092
369 Ga0501042_0006296 3300049578 Bacteria 7699
370 Ga0501042_0068803 3300049578 Bacteria 2532
371 Ga0501043_0080168 3300049579 Bacteria 2565
372 Ga0501046_0084133 3300049580 Bacteria 2454
373 Ga0501047_0031188 3300049581 Bacteria 5141
374 Ga0501048_0051869 3300049582 Bacteria 2919
375 Ga0501048_0076796 3300049582 Bacteria 2357
376 Ga0501068_0006002 3300049584 Bacteria 6671
377 Ga0501068_0060591 3300049584 Bacteria 2298
378 Ga0501071_0018430 3300049587 Bacteria 4832
379 Ga0501071_0049968 3300049587 Bacteria 3011
380 Ga0501071_0129706 3300049587 Bacteria 1872
381 Ga0501072_0009515 3300049588 Bacteria 7391
382 Ga0501072_0047461 3300049588 Bacteria 3381
383 Ga0501072_0086369 3300049588 Bacteria 2489
384 Ga0501074_0023610 3300049590 Bacteria 4470
385 Ga0501074_0045299 3300049590 Bacteria 3183
386 Ga0501074_0056869 3300049590 Bacteria 2819
387 Ga0501075_0011570 3300049591 Bacteria 6247
388 Ga0501075_0046908 3300049591 Bacteria 3246
389 Ga0501075_0070362 3300049591 Bacteria 2644
390 Ga0501076_0013139 3300049592 Bacteria 6199
391 Ga0501079_0123084 3300049741 Bacteria 2017
392 Ga0501079_0245914 3300049741 Bacteria 1398
393 Ga0501080_0016792 3300049742 Bacteria 6761
394 Ga0501080_0049571 3300049742 Bacteria 3908
395 Ga0501080_0091912 3300049742 Bacteria 2819
396 Ga0501081_0018669 3300049743 Bacteria 4609
397 Ga0501081_0039909 3300049743 Bacteria 3214
398 Ga0501083_0060277 3300049744 Bacteria 2535
399 Ga0501083_0063748 3300049744 Bacteria 2458
400 Ga0501035_0190219 3300049822 Bacteria 1765
401 Ga0501044_0303055 3300049823 Bacteria 1526
402 Ga0501045_0000802 3300049824 Bacteria 20271
403 Ga0501045_0010581 3300049824 Bacteria 6462
404 Ga0501045_0104643 3300049824 Bacteria 2097
405 Ga0501045_0238086 3300049824 Bacteria 1355
406 nmdc:mga03683_2451_c1 3300050489 Bacteria 5764
407 nmdc:mga03n38_5494_c1 3300050490 Bacteria 4321
408 nmdc:mga00v17_52565_c1 3300050491 Bacteria 2479
409 nmdc:mga06z11_9585_c1 3300050494 Bacteria 4086
410 nmdc:mga05p37_90911_c1 3300050507 Bacteria 3762
411 nmdc:mga09592_720_c1 3300050508 Bacteria 25430
412 nmdc:mga09592_72760_c1 3300050508 Bacteria 2920
413 nmdc:mga0qj67_27098_c1 3300050509 Bacteria 4439
414 nmdc:mga0qj67_585_c1 3300050509 Bacteria 24826
415 nmdc:mga06r32_422783_c1 3300050510 Bacteria 1314
416 nmdc:mga06r32_48725_c1 3300050510 Bacteria 4051
417 nmdc:mga06r32_940_c1 3300050510 Bacteria 25928
418 nmdc:mga08y16_139822_c1 3300050511 Bacteria 2517
419 nmdc:mga08y16_174963_c1 3300050511 Bacteria 2229
420 nmdc:mga08x19_112279_c1 3300050514 Bacteria 1819
421 nmdc:mga08x19_50481_c1 3300050514 Bacteria 2670
422 nmdc:mga0sz30_14888_c1 3300050516 Bacteria 3068
423 Ga0500643_008789 3300053087 Bacteria 3927
424 Ga0500581_016047 3300053089 Bacteria 3746
425 Ga0500647_0028073 3300053091 Bacteria 2662
426 Ga0500651_0074055 3300053093 Bacteria 2116
427 Ga0500566_0015937 3300053094 Bacteria 4414
428 Ga0500641_0002121 3300053096 Bacteria 7027
429 Ga0500641_0022398 3300053096 Bacteria 2419
430 Ga0500556_0000004 3300053104 Bacteria 666287
431 Ga0500592_000711 3300053116 Bacteria 5468
432 Ga0500595_000306 3300053119 Bacteria 32239
433 Ga0500642_0000073 3300053130 Bacteria 54975
434 Ga0500652_000486 3300053131 Bacteria 14037
435 Ga0500559_0001381 3300053136 Bacteria 13833
436 Ga0500568_0010145 3300053139 Bacteria 4430
437 Ga0500589_039535 3300053147 Bacteria 2202
438 Ga0500616_0000014 3300053153 Bacteria 637918
439 Ga0500616_0000725 3300053153 Bacteria 38124
440 Ga0500622_0004235 3300053156 Bacteria 9132
441 Ga0500634_0099735 3300053161 Bacteria 1456
442 Ga0500638_000300 3300053162 Bacteria 11097
443 Ga0500636_0000394 3300053177 Bacteria 24039
444 Ga0500637_0023334 3300053178 Bacteria 3382
445 Ga0500645_009773 3300053730 Bacteria 3209
446 Ga0500552_000082 3300053733 Bacteria 7660
447 Ga0501084_0029861 3300054114 Bacteria 4559
448 Ga0501084_0101637 3300054114 Bacteria 2414
449 Ga0501084_0137422 3300054114 Bacteria 2057
450 Ga0500661_000509 3300055283 Bacteria 7241
451 Ga0501082_0006899 3300060353 Bacteria 9826
452 Ga0501082_0077573 3300060353 Bacteria 2865
453 Ga0501082_0291078 3300060353 Bacteria 1422
454 Ga0530510_0000189 3300061734 Bacteria 37823
455 Ga0530510_0001760 3300061734 Bacteria 14750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0104643 Ga0501045_0104643_671_1786 343
2 3300035115 Ga0373941_0045400 Ga0373941_0045400_293_1363 349
3 3300006844 Ga0075428_100027825 Ga0075428_1000278253 354
4 3300005843 Ga0068860_100011335 Ga0068860_1000113353 361
5 3300006358 Ga0068871_100150897 Ga0068871_1001508972 361
6 3300014968 Ga0157379_10102971 Ga0157379_101029712 361
7 3300025972 Ga0207668_10136848 Ga0207668_101368482 361
8 3300026088 Ga0207641_10013014 Ga0207641_100130142 361
9 3300006846 Ga0075430_100064202 Ga0075430_1000642021 369
10 3300006846 Ga0075430_100162765 Ga0075430_1001627651 369
11 3300006880 Ga0075429_100128297 Ga0075429_1001282972 369
12 3300050509 nmdc:mga0qj67_27098_c1 nmdc:mga0qj67_27098_c1_2206_3351 369
13 3300050510 nmdc:mga06r32_422783_c1 nmdc:mga06r32_422783_c1_143_1288 369
14 3300027364 Ga0209967_1001709 Ga0209967_10017092 370
15 3300025945 Ga0207679_10251401 Ga0207679_102514011 371
16 3300005435 Ga0070714_100223679 Ga0070714_1002236791 373
17 3300006846 Ga0075430_100000290 Ga0075430_10000029034 373
18 3300031731 Ga0307405_10089194 Ga0307405_100891942 373
19 3300050509 nmdc:mga0qj67_585_c1 nmdc:mga0qj67_585_c1_2093_3235 373
20 3300005336 Ga0070680_100106966 Ga0070680_1001069662 374
21 3300005340 Ga0070689_100286224 Ga0070689_1002862241 374
22 3300005356 Ga0070674_100238131 Ga0070674_1002381312 374
23 3300005364 Ga0070673_100021862 Ga0070673_1000218623 374
24 3300005440 Ga0070705_100079320 Ga0070705_1000793202 374
25 3300005441 Ga0070700_100008016 Ga0070700_1000080163 374
26 3300005458 Ga0070681_10021861 Ga0070681_100218615 374
27 3300005459 Ga0068867_100007430 Ga0068867_1000074305 374
28 3300005536 Ga0070697_100101284 Ga0070697_1001012842 374
29 3300005543 Ga0070672_100129460 Ga0070672_1001294602 374
30 3300005546 Ga0070696_100026782 Ga0070696_1000267823 374
31 3300005546 Ga0070696_100045164 Ga0070696_1000451642 374
32 3300005549 Ga0070704_100040948 Ga0070704_1000409483 374
33 3300005617 Ga0068859_100336482 Ga0068859_1003364822 374
34 3300005719 Ga0068861_100005130 Ga0068861_1000051304 374
35 3300005985 Ga0081539_10000513 Ga0081539_1000051315 374
36 3300006844 Ga0075428_100011049 Ga0075428_1000110497 374
37 3300006881 Ga0068865_100018935 Ga0068865_1000189354 374
38 3300006914 Ga0075436_100000304 Ga0075436_10000030410 374
39 3300006914 Ga0075436_100030135 Ga0075436_1000301353 374
40 3300006931 Ga0097620_100336484 Ga0097620_1003364842 374
41 3300009094 Ga0111539_10248592 Ga0111539_102485922 374
42 3300009148 Ga0105243_10027109 Ga0105243_100271092 374
43 3300009553 Ga0105249_10012978 Ga0105249_100129784 374
44 3300014326 Ga0157380_10272995 Ga0157380_102729951 374
45 3300017792 Ga0163161_10096508 Ga0163161_100965082 374
46 3300025908 Ga0207643_10034734 Ga0207643_100347343 374
47 3300025912 Ga0207707_10029434 Ga0207707_100294342 374
48 3300025935 Ga0207709_10012200 Ga0207709_100122002 374
49 3300025938 Ga0207704_10000824 Ga0207704_1000082415 374
50 3300025942 Ga0207689_10064305 Ga0207689_100643052 374
51 3300025960 Ga0207651_10162480 Ga0207651_101624802 374
52 3300025961 Ga0207712_10067988 Ga0207712_100679882 374
53 3300025972 Ga0207668_10134223 Ga0207668_101342232 374
54 3300026075 Ga0207708_10036366 Ga0207708_100363664 374
55 3300026089 Ga0207648_10000431 Ga0207648_1000043122 374
56 3300026118 Ga0207675_100006922 Ga0207675_10000692214 374
57 3300027907 Ga0207428_10115030 Ga0207428_101150302 374
58 3300028380 Ga0268265_10008108 Ga0268265_100081084 374
59 3300028380 Ga0268265_10014558 Ga0268265_100145585 374
60 3300035121 Ga0373960_0002432 Ga0373960_0002432_2421_3605 374
61 3300042001 Ga0439441_002147 Ga0439441_002147_1292_2437 374
62 3300042461 Ga0439460_0012075 Ga0439460_0012075_409_1554 374
63 3300045051 Ga0451576_0391232 Ga0451576_0391232_161_1306 374
64 3300046539 Ga0495621_0060019 Ga0495621_0060019_30_1175 374
65 3300049572 Ga0501036_0121327 Ga0501036_0121327_285_1430 374
66 3300049572 Ga0501036_0289574 Ga0501036_0289574_168_1313 374
67 3300049574 Ga0501038_0116606 Ga0501038_0116606_672_1817 374
68 3300049574 Ga0501038_0143656 Ga0501038_0143656_38_1183 374
69 3300049576 Ga0501040_0021547 Ga0501040_0021547_184_1329 374
70 3300049576 Ga0501040_0054893 Ga0501040_0054893_858_2003 374
71 3300049576 Ga0501040_0110357 Ga0501040_0110357_230_1375 374
72 3300049578 Ga0501042_0068803 Ga0501042_0068803_899_2044 374
73 3300049582 Ga0501048_0076796 Ga0501048_0076796_641_1786 374
74 3300049587 Ga0501071_0129706 Ga0501071_0129706_367_1512 374
75 3300049588 Ga0501072_0086369 Ga0501072_0086369_248_1393 374
76 3300049590 Ga0501074_0045299 Ga0501074_0045299_1927_3072 374
77 3300049591 Ga0501075_0046908 Ga0501075_0046908_247_1392 374
78 3300049742 Ga0501080_0049571 Ga0501080_0049571_600_1745 374
79 3300049743 Ga0501081_0018669 Ga0501081_0018669_2465_3610 374
80 3300049824 Ga0501045_0010581 Ga0501045_0010581_4487_5632 374
81 3300049824 Ga0501045_0238086 Ga0501045_0238086_114_1259 374
82 3300050508 nmdc:mga09592_72760_c1 nmdc:mga09592_72760_c1_1115_2260 374
83 3300050510 nmdc:mga06r32_48725_c1 nmdc:mga06r32_48725_c1_1516_2661 374
84 3300050511 nmdc:mga08y16_139822_c1 nmdc:mga08y16_139822_c1_312_1457 374
85 3300050511 nmdc:mga08y16_174963_c1 nmdc:mga08y16_174963_c1_591_1736 374
86 3300050514 nmdc:mga08x19_112279_c1 nmdc:mga08x19_112279_c1_112_1257 374
87 3300050514 nmdc:mga08x19_50481_c1 nmdc:mga08x19_50481_c1_661_1806 374
88 3300054114 Ga0501084_0137422 Ga0501084_0137422_366_1511 374
89 3300060353 Ga0501082_0077573 Ga0501082_0077573_1405_2550 374
90 3300061734 Ga0530510_0001760 Ga0530510_0001760_12247_13392 374
91 iso_pu_bacteria 2513237098 2513671392 375
92 iso_pu_bacteria 2522572158 2523104944 375
93 iso_pu_bacteria 2524023210 2524463929 375
94 iso_pu_bacteria 2602042107 2603859477 375
95 iso_pu_bacteria 2721755755 2723846023 375
96 iso_pu_bacteria 2874604998 2874612349 375
97 iso_pu_bacteria 2885383462 2885384586 375
98 iso_pu_bacteria 2893066018 2893070559 375
99 iso_pu_bacteria 2903768456 2903769578 375
100 iso_pu_bacteria 2919073203 2919076519 375
101 iso_pu_bacteria 2922361189 2922362731 375
102 3300005327 Ga0070658_10006314 Ga0070658_100063149 376
103 3300005330 Ga0070690_100015202 Ga0070690_1000152024 376
104 3300005334 Ga0068869_100037746 Ga0068869_1000377462 376
105 3300005335 Ga0070666_10119170 Ga0070666_101191701 376
106 3300005336 Ga0070680_100002836 Ga0070680_1000028368 376
107 3300005336 Ga0070680_100174224 Ga0070680_1001742242 376
108 3300005339 Ga0070660_100021944 Ga0070660_1000219443 376
109 3300005340 Ga0070689_100032609 Ga0070689_1000326092 376
110 3300005341 Ga0070691_10072476 Ga0070691_100724762 376
111 3300005343 Ga0070687_100014048 Ga0070687_1000140484 376
112 3300005354 Ga0070675_100207959 Ga0070675_1002079591 376
113 3300005435 Ga0070714_100036235 Ga0070714_1000362353 376
114 3300005438 Ga0070701_10017671 Ga0070701_100176713 376
115 3300005441 Ga0070700_100006278 Ga0070700_1000062782 376
116 3300005455 Ga0070663_100155877 Ga0070663_1001558771 376
117 3300005458 Ga0070681_10025434 Ga0070681_100254343 376
118 3300005471 Ga0070698_100011079 Ga0070698_10001107910 376
119 3300005530 Ga0070679_100075444 Ga0070679_1000754442 376
120 3300005539 Ga0068853_100045367 Ga0068853_1000453673 376
121 3300005539 Ga0068853_100049715 Ga0068853_1000497152 376
122 3300005546 Ga0070696_100071078 Ga0070696_1000710782 376
123 3300005548 Ga0070665_100047856 Ga0070665_1000478565 376
124 3300005563 Ga0068855_100055032 Ga0068855_1000550324 376
125 3300005563 Ga0068855_100159194 Ga0068855_1001591943 376
126 3300005563 Ga0068855_100291946 Ga0068855_1002919461 376
127 3300005615 Ga0070702_100008684 Ga0070702_1000086844 376
128 3300005617 Ga0068859_100014834 Ga0068859_1000148345 376
129 3300005718 Ga0068866_10033067 Ga0068866_100330672 376
130 3300005719 Ga0068861_100263040 Ga0068861_1002630401 376
131 3300005840 Ga0068870_10008353 Ga0068870_100083535 376
132 3300005842 Ga0068858_100010760 Ga0068858_1000107609 376
133 3300005843 Ga0068860_100022669 Ga0068860_1000226692 376
134 3300005843 Ga0068860_100236070 Ga0068860_1002360702 376
135 3300005844 Ga0068862_100015480 Ga0068862_1000154806 376
136 3300005844 Ga0068862_100016798 Ga0068862_1000167988 376
137 3300006175 Ga0070712_100116241 Ga0070712_1001162412 376
138 3300006237 Ga0097621_100005194 Ga0097621_1000051943 376
139 3300006358 Ga0068871_100016690 Ga0068871_1000166907 376
140 3300006844 Ga0075428_100027100 Ga0075428_1000271008 376
141 3300006847 Ga0075431_100004958 Ga0075431_10000495813 376
142 3300006880 Ga0075429_100000007 Ga0075429_10000000720 376
143 3300006881 Ga0068865_100017333 Ga0068865_1000173334 376
144 3300006931 Ga0097620_100014834 Ga0097620_1000148345 376
145 3300009093 Ga0105240_10015823 Ga0105240_100158234 376
146 3300009094 Ga0111539_10385981 Ga0111539_103859812 376
147 3300009098 Ga0105245_10005272 Ga0105245_100052725 376
148 3300009147 Ga0114129_10006414 Ga0114129_100064148 376
149 3300009148 Ga0105243_10000663 Ga0105243_1000066333 376
150 3300009174 Ga0105241_10004458 Ga0105241_100044585 376
151 3300009176 Ga0105242_10081985 Ga0105242_100819853 376
152 3300009545 Ga0105237_10010778 Ga0105237_1001077810 376
153 3300009553 Ga0105249_10008959 Ga0105249_100089594 376
154 3300011119 Ga0105246_10134179 Ga0105246_101341792 376
155 3300013105 Ga0157369_10299381 Ga0157369_102993812 376
156 3300013297 Ga0157378_10041218 Ga0157378_100412182 376
157 3300013307 Ga0157372_10083487 Ga0157372_100834873 376
158 3300013308 Ga0157375_10241330 Ga0157375_102413303 376
159 3300014325 Ga0163163_10078524 Ga0163163_100785242 376
160 3300014326 Ga0157380_10001362 Ga0157380_100013623 376
161 3300014969 Ga0157376_10232371 Ga0157376_102323712 376
162 3300017792 Ga0163161_10214786 Ga0163161_102147861 376
163 3300025909 Ga0207705_10029261 Ga0207705_100292613 376
164 3300025911 Ga0207654_10003808 Ga0207654_100038087 376
165 3300025912 Ga0207707_10032866 Ga0207707_100328662 376
166 3300025912 Ga0207707_10167424 Ga0207707_101674242 376
167 3300025917 Ga0207660_10011260 Ga0207660_100112605 376
168 3300025917 Ga0207660_10083005 Ga0207660_100830051 376
169 3300025918 Ga0207662_10082617 Ga0207662_100826172 376
170 3300025919 Ga0207657_10015839 Ga0207657_100158393 376
171 3300025920 Ga0207649_10022044 Ga0207649_100220443 376
172 3300025921 Ga0207652_10017793 Ga0207652_100177934 376
173 3300025921 Ga0207652_10102803 Ga0207652_101028032 376
174 3300025925 Ga0207650_10036594 Ga0207650_100365943 376
175 3300025927 Ga0207687_10026465 Ga0207687_100264656 376
176 3300025935 Ga0207709_10010813 Ga0207709_100108136 376
177 3300025936 Ga0207670_10028494 Ga0207670_100284943 376
178 3300025941 Ga0207711_10018859 Ga0207711_100188592 376
179 3300025941 Ga0207711_10051378 Ga0207711_100513785 376
180 3300025942 Ga0207689_10000761 Ga0207689_1000076126 376
181 3300025942 Ga0207689_10003878 Ga0207689_100038785 376
182 3300025949 Ga0207667_10031922 Ga0207667_100319224 376
183 3300025949 Ga0207667_10113979 Ga0207667_101139794 376
184 3300026035 Ga0207703_10049717 Ga0207703_100497172 376
185 3300026035 Ga0207703_10122259 Ga0207703_101222591 376
186 3300026041 Ga0207639_10008661 Ga0207639_100086613 376
187 3300026041 Ga0207639_10035118 Ga0207639_100351183 376
188 3300026075 Ga0207708_10006823 Ga0207708_100068238 376
189 3300026089 Ga0207648_10038923 Ga0207648_100389235 376
190 3300026118 Ga0207675_100000403 Ga0207675_10000040336 376
191 3300026118 Ga0207675_100246533 Ga0207675_1002465332 376
192 3300026118 Ga0207675_100283752 Ga0207675_1002837522 376
193 3300026142 Ga0207698_10039540 Ga0207698_100395402 376
194 3300028379 Ga0268266_10178713 Ga0268266_101787132 376
195 3300028380 Ga0268265_10190758 Ga0268265_101907582 376
196 3300028381 Ga0268264_10111516 Ga0268264_101115163 376
197 3300028381 Ga0268264_10268159 Ga0268264_102681592 376
198 3300031235 Ga0265330_10032695 Ga0265330_100326951 376
199 3300031247 Ga0265340_10033336 Ga0265340_100333362 376
200 3300031712 Ga0265342_10000608 Ga0265342_1000060832 376
201 3300035398 Ga0316574_0062550 Ga0316574_0062550_958_2115 376
202 3300045051 Ga0451576_0001414 Ga0451576_0001414_16147_17292 376
203 3300045051 Ga0451576_0343560 Ga0451576_0343560_77_1222 376
204 3300048915 Ga0496112_0036065 Ga0496112_0036065_3432_4577 376
205 3300048916 Ga0496113_0047701 Ga0496113_0047701_505_1650 376
206 3300049571 Ga0501034_0000997 Ga0501034_0000997_4594_5739 376
207 3300049572 Ga0501036_0042208 Ga0501036_0042208_934_2079 376
208 3300049575 Ga0501039_0010471 Ga0501039_0010471_842_1987 376
209 3300049575 Ga0501039_0123244 Ga0501039_0123244_689_1834 376
210 3300049576 Ga0501040_0216805 Ga0501040_0216805_135_1310 376
211 3300049577 Ga0501041_0002717 Ga0501041_0002717_6768_7913 376
212 3300049578 Ga0501042_0006296 Ga0501042_0006296_2579_3724 376
213 3300049580 Ga0501046_0084133 Ga0501046_0084133_1173_2318 376
214 3300049581 Ga0501047_0031188 Ga0501047_0031188_1118_2263 376
215 3300049582 Ga0501048_0051869 Ga0501048_0051869_1437_2582 376
216 3300049584 Ga0501068_0006002 Ga0501068_0006002_1100_2245 376
217 3300049584 Ga0501068_0060591 Ga0501068_0060591_416_1561 376
218 3300049587 Ga0501071_0018430 Ga0501071_0018430_2576_3721 376
219 3300049587 Ga0501071_0049968 Ga0501071_0049968_1417_2562 376
220 3300049588 Ga0501072_0009515 Ga0501072_0009515_687_1832 376
221 3300049588 Ga0501072_0047461 Ga0501072_0047461_761_1906 376
222 3300049590 Ga0501074_0023610 Ga0501074_0023610_132_1277 376
223 3300049590 Ga0501074_0056869 Ga0501074_0056869_206_1351 376
224 3300049591 Ga0501075_0011570 Ga0501075_0011570_2700_3845 376
225 3300049591 Ga0501075_0070362 Ga0501075_0070362_478_1623 376
226 3300049592 Ga0501076_0013139 Ga0501076_0013139_1915_3060 376
227 3300049741 Ga0501079_0123084 Ga0501079_0123084_252_1397 376
228 3300049741 Ga0501079_0245914 Ga0501079_0245914_17_1162 376
229 3300049742 Ga0501080_0016792 Ga0501080_0016792_1032_2177 376
230 3300049742 Ga0501080_0091912 Ga0501080_0091912_576_1721 376
231 3300049743 Ga0501081_0039909 Ga0501081_0039909_465_1610 376
232 3300049744 Ga0501083_0060277 Ga0501083_0060277_392_1537 376
233 3300049744 Ga0501083_0063748 Ga0501083_0063748_545_1690 376
234 3300049822 Ga0501035_0190219 Ga0501035_0190219_200_1345 376
235 3300049823 Ga0501044_0303055 Ga0501044_0303055_222_1367 376
236 3300049824 Ga0501045_0000802 Ga0501045_0000802_4506_5651 376
237 3300050507 nmdc:mga05p37_90911_c1 nmdc:mga05p37_90911_c1_584_1729 376
238 3300050508 nmdc:mga09592_720_c1 nmdc:mga09592_720_c1_20524_21669 376
239 3300050510 nmdc:mga06r32_940_c1 nmdc:mga06r32_940_c1_21628_22773 376
240 3300054114 Ga0501084_0029861 Ga0501084_0029861_494_1639 376
241 3300054114 Ga0501084_0101637 Ga0501084_0101637_241_1386 376
242 3300060353 Ga0501082_0006899 Ga0501082_0006899_1314_2459 376
243 3300061734 Ga0530510_0000189 Ga0530510_0000189_11986_13131 376
244 iso_pu_bacteria 2828305725 2828307375 376
245 iso_pu_bacteria 2842694124 2842695675 376
246 iso_pu_bacteria 8055225921 8055227743 376
247 3300005327 Ga0070658_10020894 Ga0070658_100208942 377
248 3300005331 Ga0070670_100252705 Ga0070670_1002527051 377
249 3300005331 Ga0070670_100307620 Ga0070670_1003076201 377
250 3300005347 Ga0070668_100013784 Ga0070668_1000137843 377
251 3300005354 Ga0070675_100015642 Ga0070675_1000156424 377
252 3300005367 Ga0070667_100052922 Ga0070667_1000529222 377
253 3300005367 Ga0070667_100224320 Ga0070667_1002243202 377
254 3300005518 Ga0070699_100083278 Ga0070699_1000832783 377
255 3300005543 Ga0070672_100017628 Ga0070672_1000176285 377
256 3300005543 Ga0070672_100018763 Ga0070672_1000187634 377
257 3300005543 Ga0070672_100093670 Ga0070672_1000936703 377
258 3300005563 Ga0068855_100048582 Ga0068855_1000485822 377
259 3300005614 Ga0068856_100112486 Ga0068856_1001124863 377
260 3300005616 Ga0068852_100079169 Ga0068852_1000791691 377
261 3300005840 Ga0068870_10073530 Ga0068870_100735302 377
262 3300009094 Ga0111539_10282016 Ga0111539_102820162 377
263 3300009551 Ga0105238_10118906 Ga0105238_101189063 377
264 3300013307 Ga0157372_10108476 Ga0157372_101084762 377
265 3300013308 Ga0157375_10063544 Ga0157375_100635443 377
266 3300014969 Ga0157376_10407805 Ga0157376_104078051 377
267 3300025907 Ga0207645_10081980 Ga0207645_100819802 377
268 3300025908 Ga0207643_10081864 Ga0207643_100818642 377
269 3300025909 Ga0207705_10032559 Ga0207705_100325592 377
270 3300025923 Ga0207681_10133877 Ga0207681_101338772 377
271 3300025924 Ga0207694_10085186 Ga0207694_100851863 377
272 3300025925 Ga0207650_10041995 Ga0207650_100419953 377
273 3300025925 Ga0207650_10297452 Ga0207650_102974521 377
274 3300025926 Ga0207659_10018824 Ga0207659_100188242 377
275 3300025931 Ga0207644_10150069 Ga0207644_101500691 377
276 3300025940 Ga0207691_10015700 Ga0207691_100157004 377
277 3300025940 Ga0207691_10306459 Ga0207691_103064592 377
278 3300025949 Ga0207667_10087810 Ga0207667_100878102 377
279 3300025972 Ga0207668_10010449 Ga0207668_100104494 377
280 3300025986 Ga0207658_10041762 Ga0207658_100417623 377
281 3300025986 Ga0207658_10190257 Ga0207658_101902572 377
282 3300026067 Ga0207678_10210451 Ga0207678_102104512 377
283 3300026095 Ga0207676_10076659 Ga0207676_100766591 377
284 3300026142 Ga0207698_10015969 Ga0207698_100159693 377
285 3300028381 Ga0268264_10230074 Ga0268264_102300742 377
286 3300028381 Ga0268264_10403572 Ga0268264_104035722 377
287 3300031548 Ga0307408_100007788 Ga0307408_1000077884 377
288 3300031731 Ga0307405_10101126 Ga0307405_101011261 377
289 3300031824 Ga0307413_10001385 Ga0307413_100013856 377
290 3300031901 Ga0307406_10007116 Ga0307406_100071164 377
291 3300031903 Ga0307407_10005330 Ga0307407_100053302 377
292 3300031995 Ga0307409_100149178 Ga0307409_1001491782 377
293 3300032002 Ga0307416_100020027 Ga0307416_1000200273 377
294 3300032004 Ga0307414_10030529 Ga0307414_100305292 377
295 3300032005 Ga0307411_10003445 Ga0307411_100034456 377
296 3300032126 Ga0307415_100027006 Ga0307415_1000270062 377
297 3300032133 Ga0316583_10003931 Ga0316583_100039313 377
298 3300035113 Ga0373936_0067611 Ga0373936_0067611_62_1195 377
299 3300035398 Ga0316574_0166506 Ga0316574_0166506_235_1383 377
300 3300044712 Ga0453684_0201954 Ga0453684_0201954_101_1255 377
301 3300060353 Ga0501082_0291078 Ga0501082_0291078_155_1306 377
302 3300003203 JGI25406J46586_10000018 JGI25406J46586_1000001852 379
303 3300003659 JGI25404J52841_10000274 JGI25404J52841_100002742 379
304 3300003911 JGI25405J52794_10011943 JGI25405J52794_100119431 379
305 3300005327 Ga0070658_10002031 Ga0070658_100020316 379
306 3300005331 Ga0070670_100183898 Ga0070670_1001838982 379
307 3300005335 Ga0070666_10030456 Ga0070666_100304564 379
308 3300005336 Ga0070680_100000741 Ga0070680_10000074122 379
309 3300005338 Ga0068868_100079491 Ga0068868_1000794912 379
310 3300005343 Ga0070687_100090571 Ga0070687_1000905712 379
311 3300005353 Ga0070669_100010981 Ga0070669_1000109814 379
312 3300005354 Ga0070675_100165966 Ga0070675_1001659662 379
313 3300005354 Ga0070675_100204224 Ga0070675_1002042241 379
314 3300005356 Ga0070674_100185769 Ga0070674_1001857691 379
315 3300005367 Ga0070667_100025046 Ga0070667_1000250463 379
316 3300005435 Ga0070714_100010379 Ga0070714_1000103796 379
317 3300005458 Ga0070681_10004167 Ga0070681_100041672 379
318 3300005530 Ga0070679_100004458 Ga0070679_1000044582 379
319 3300005530 Ga0070679_100014802 Ga0070679_1000148021 379
320 3300005544 Ga0070686_100053831 Ga0070686_1000538312 379
321 3300005548 Ga0070665_100049804 Ga0070665_1000498043 379
322 3300005548 Ga0070665_100082773 Ga0070665_1000827732 379
323 3300005548 Ga0070665_100270703 Ga0070665_1002707032 379
324 3300005563 Ga0068855_100056571 Ga0068855_1000565715 379
325 3300005563 Ga0068855_100150310 Ga0068855_1001503102 379
326 3300005617 Ga0068859_100172941 Ga0068859_1001729412 379
327 3300005841 Ga0068863_100026280 Ga0068863_1000262805 379
328 3300005843 Ga0068860_100010602 Ga0068860_10001060213 379
329 3300005937 Ga0081455_10001072 Ga0081455_1000107215 379
330 3300005937 Ga0081455_10041944 Ga0081455_100419442 379
331 3300005983 Ga0081540_1000453 Ga0081540_100045314 379
332 3300005983 Ga0081540_1002154 Ga0081540_100215411 379
333 3300005983 Ga0081540_1022633 Ga0081540_10226332 379
334 3300005985 Ga0081539_10000003 Ga0081539_10000003349 379
335 3300005985 Ga0081539_10000394 Ga0081539_1000039461 379
336 3300005985 Ga0081539_10006162 Ga0081539_100061629 379
337 3300006038 Ga0075365_10087071 Ga0075365_100870712 379
338 3300006038 Ga0075365_10091518 Ga0075365_100915182 379
339 3300006048 Ga0075363_100002202 Ga0075363_1000022024 379
340 3300006177 Ga0075362_10001920 Ga0075362_100019205 379
341 3300006178 Ga0075367_10008139 Ga0075367_100081392 379
342 3300006178 Ga0075367_10036912 Ga0075367_100369123 379
343 3300006186 Ga0075369_10000902 Ga0075369_100009026 379
344 3300006186 Ga0075369_10030765 Ga0075369_100307651 379
345 3300006931 Ga0097620_100172934 Ga0097620_1001729342 379
346 3300009093 Ga0105240_10005077 Ga0105240_100050772 379
347 3300009093 Ga0105240_10013278 Ga0105240_100132785 379
348 3300009148 Ga0105243_10005946 Ga0105243_100059463 379
349 3300009177 Ga0105248_10048206 Ga0105248_100482065 379
350 3300009177 Ga0105248_10388574 Ga0105248_103885742 379
351 3300009551 Ga0105238_10033618 Ga0105238_100336184 379
352 3300011119 Ga0105246_10122744 Ga0105246_101227442 379
353 3300011119 Ga0105246_10333455 Ga0105246_103334551 379
354 3300013306 Ga0163162_10011462 Ga0163162_100114625 379
355 3300013308 Ga0157375_10005895 Ga0157375_100058953 379
356 3300017792 Ga0163161_10017062 Ga0163161_100170625 379
357 3300021384 Ga0213876_10008623 Ga0213876_100086233 379
358 3300025294 Ga0209025_1000198 Ga0209025_1000198103 379
359 3300025295 Ga0209564_1000787 Ga0209564_10007874 379
360 3300025302 Ga0207426_1035941 Ga0207426_10359411 379
361 3300025901 Ga0207688_10068866 Ga0207688_100688662 379
362 3300025903 Ga0207680_10082835 Ga0207680_100828352 379
363 3300025907 Ga0207645_10002887 Ga0207645_1000288713 379
364 3300025908 Ga0207643_10081100 Ga0207643_100811002 379
365 3300025909 Ga0207705_10308535 Ga0207705_103085351 379
366 3300025912 Ga0207707_10007388 Ga0207707_100073883 379
367 3300025913 Ga0207695_10034056 Ga0207695_100340562 379
368 3300025920 Ga0207649_10074621 Ga0207649_100746212 379
369 3300025923 Ga0207681_10001194 Ga0207681_100011944 379
370 3300025926 Ga0207659_10045381 Ga0207659_100453811 379
371 3300025926 Ga0207659_10091362 Ga0207659_100913621 379
372 3300025926 Ga0207659_10321461 Ga0207659_103214611 379
373 3300025927 Ga0207687_10312297 Ga0207687_103122971 379
374 3300025933 Ga0207706_10013819 Ga0207706_100138193 379
375 3300025935 Ga0207709_10081875 Ga0207709_100818752 379
376 3300025940 Ga0207691_10084455 Ga0207691_100844552 379
377 3300025941 Ga0207711_10076120 Ga0207711_100761202 379
378 3300025941 Ga0207711_10145916 Ga0207711_101459162 379
379 3300025942 Ga0207689_10005785 Ga0207689_100057856 379
380 3300025942 Ga0207689_10099297 Ga0207689_100992972 379
381 3300025972 Ga0207668_10007338 Ga0207668_100073384 379
382 3300025986 Ga0207658_10001408 Ga0207658_100014085 379
383 3300025986 Ga0207658_10125045 Ga0207658_101250452 379
384 3300026023 Ga0207677_10099096 Ga0207677_100990962 379
385 3300026067 Ga0207678_10053310 Ga0207678_100533102 379
386 3300026075 Ga0207708_10221858 Ga0207708_102218581 379
387 3300026088 Ga0207641_10003923 Ga0207641_100039234 379
388 3300026118 Ga0207675_100003070 Ga0207675_10000307015 379
389 3300026121 Ga0207683_10053687 Ga0207683_100536874 379
390 3300026121 Ga0207683_10180485 Ga0207683_101804852 379
391 3300026121 Ga0207683_10223550 Ga0207683_102235502 379
392 3300026121 Ga0207683_10386379 Ga0207683_103863792 379
393 3300028379 Ga0268266_10017284 Ga0268266_100172844 379
394 3300028379 Ga0268266_10038411 Ga0268266_100384112 379
395 3300028379 Ga0268266_10056477 Ga0268266_100564772 379
396 3300028380 Ga0268265_10241278 Ga0268265_102412782 379
397 3300028381 Ga0268264_10032586 Ga0268264_100325865 379
398 3300028794 Ga0307515_10195062 Ga0307515_101950622 379
399 3300032126 Ga0307415_100030906 Ga0307415_1000309064 379
400 3300035113 Ga0373936_0049111 Ga0373936_0049111_437_1576 379
401 3300037471 Ga0395905_0029678 Ga0395905_0029678_358_1500 379
402 3300037471 Ga0395905_0248028 Ga0395905_0248028_18_1163 379
403 3300039437 Ga0436365_0137793 Ga0436365_0137793_8353_9492 379
404 3300039438 Ga0436360_1256644 Ga0436360_1256644_2009_3151 379
405 3300039450 Ga0436363_1540084 Ga0436363_1540084_1381_2523 379
406 3300039453 Ga0436362_0351219 Ga0436362_0351219_247_1389 379
407 3300044735 Ga0466968_0007627 Ga0466968_0007627_1038_2189 379
408 3300045049 Ga0466959_0180599 Ga0466959_0180599_188_1336 379
409 3300046460 Ga0495638_0004912 Ga0495638_0004912_5564_6703 379
410 3300046471 Ga0495650_0024442 Ga0495650_0024442_354_1493 379
411 3300046501 Ga0495607_0054704 Ga0495607_0054704_314_1453 379
412 3300046512 Ga0495610_0031468 Ga0495610_0031468_1557_2696 379
413 3300046515 Ga0495620_0028293 Ga0495620_0028293_1211_2350 379
414 3300046518 Ga0495631_0008412 Ga0495631_0008412_519_1658 379
415 3300046518 Ga0495631_0105114 Ga0495631_0105114_13_1152 379
416 3300046530 Ga0495654_0018359 Ga0495654_0018359_745_1884 379
417 3300046557 Ga0495622_0010614 Ga0495622_0010614_429_1568 379
418 3300046691 Ga0495670_0012923 Ga0495670_0012923_1357_2496 379
419 3300047320 Ga0495672_0082562 Ga0495672_0082562_244_1383 379
420 3300047472 Ga0495686_0028440 Ga0495686_0028440_898_2037 379
421 3300047673 Ga0495593_0102166 Ga0495593_0102166_284_1423 379
422 3300048911 Ga0496108_0352619 Ga0496108_0352619_12_1151 379
423 3300048914 Ga0496111_0081190 Ga0496111_0081190_175_1314 379
424 3300048919 Ga0496116_0007139 Ga0496116_0007139_5908_7047 379
425 3300048922 Ga0496119_0022978 Ga0496119_0022978_2226_3368 379
426 3300048922 Ga0496119_0035825 Ga0496119_0035825_680_1819 379
427 3300048924 Ga0496121_0000458 Ga0496121_0000458_6483_7628 379
428 3300048924 Ga0496121_0003608 Ga0496121_0003608_13258_14400 379
429 3300048924 Ga0496121_0042666 Ga0496121_0042666_608_1747 379
430 3300048925 Ga0496122_0013886 Ga0496122_0013886_2470_3609 379
431 3300048926 Ga0496123_0010227 Ga0496123_0010227_2285_3424 379
432 3300048928 Ga0496125_0004370 Ga0496125_0004370_14649_15788 379
433 3300048928 Ga0496125_0034452 Ga0496125_0034452_1052_2194 379
434 3300048928 Ga0496125_0049815 Ga0496125_0049815_394_1536 379
435 3300048929 Ga0496126_0013480 Ga0496126_0013480_2440_3579 379
436 3300048929 Ga0496126_0126254 Ga0496126_0126254_585_1727 379
437 3300048929 Ga0496126_0134162 Ga0496126_0134162_261_1400 379
438 3300049571 Ga0501034_0028775 Ga0501034_0028775_683_1825 379
439 3300049579 Ga0501043_0080168 Ga0501043_0080168_25_1164 379
440 3300050489 nmdc:mga03683_2451_c1 nmdc:mga03683_2451_c1_2261_3400 379
441 3300050490 nmdc:mga03n38_5494_c1 nmdc:mga03n38_5494_c1_2203_3342 379
442 3300050491 nmdc:mga00v17_52565_c1 nmdc:mga00v17_52565_c1_458_1597 379
443 3300050494 nmdc:mga06z11_9585_c1 nmdc:mga06z11_9585_c1_598_1737 379
444 3300050516 nmdc:mga0sz30_14888_c1 nmdc:mga0sz30_14888_c1_925_2064 379
445 3300053087 Ga0500643_008789 Ga0500643_008789_196_1335 379
446 3300053089 Ga0500581_016047 Ga0500581_016047_1081_2220 379
447 3300053091 Ga0500647_0028073 Ga0500647_0028073_122_1261 379
448 3300053093 Ga0500651_0074055 Ga0500651_0074055_850_1989 379
449 3300053094 Ga0500566_0015937 Ga0500566_0015937_650_1789 379
450 3300053096 Ga0500641_0002121 Ga0500641_0002121_3344_4483 379
451 3300053096 Ga0500641_0022398 Ga0500641_0022398_602_1741 379
452 3300053104 Ga0500556_0000004 Ga0500556_0000004_485639_486778 379
453 3300053116 Ga0500592_000711 Ga0500592_000711_1705_2961 379
454 3300053119 Ga0500595_000306 Ga0500595_000306_2071_3210 379
455 3300053130 Ga0500642_0000073 Ga0500642_0000073_11362_12501 379
456 3300053131 Ga0500652_000486 Ga0500652_000486_7998_9137 379
457 3300053136 Ga0500559_0001381 Ga0500559_0001381_2982_4121 379
458 3300053139 Ga0500568_0010145 Ga0500568_0010145_289_1428 379
459 3300053147 Ga0500589_039535 Ga0500589_039535_621_1760 379
460 3300053153 Ga0500616_0000014 Ga0500616_0000014_459847_460986 379
461 3300053153 Ga0500616_0000725 Ga0500616_0000725_18617_19756 379
462 3300053156 Ga0500622_0004235 Ga0500622_0004235_5325_6464 379
463 3300053161 Ga0500634_0099735 Ga0500634_0099735_302_1441 379
464 3300053162 Ga0500638_000300 Ga0500638_000300_4728_5867 379
465 3300053177 Ga0500636_0000394 Ga0500636_0000394_20345_21484 379
466 3300053178 Ga0500637_0023334 Ga0500637_0023334_2196_3335 379
467 3300053730 Ga0500645_009773 Ga0500645_009773_323_1462 379
468 3300053733 Ga0500552_000082 Ga0500552_000082_1664_2803 379
469 3300055283 Ga0500661_000509 Ga0500661_000509_4770_5909 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

185

408

0.92

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

36

160

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5olc-assembly1.cif.gz_F crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans 0.9743 1 379
5olc-assembly1.cif.gz_F crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans 0.9716 1 379
4hpn-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops 0.9637 1 379
4hpn-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops 0.9562 1 379
4ggb-assembly1.cif.gz_A crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, disordered loops 0.9537 1 372
ID Description Score Start End Superfamily
5olcA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9802 1 116 3.30.390.10
5olcA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.971 1 116 3.30.390.10
5olcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9641 118 379 3.20.20.120
4ggbA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9628 118 372 3.20.20.120
5olcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9565 118 379 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2E9I3P2-F1-model_v4 Rhamnonate dehydratase 0.9868 1 379 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A8TWH6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme-like protein 0.9772 60 379 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A7Y5Q8H6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9728 1 128 GO:0003824
GO:0009063
AF-F0Z002-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9712 1 379 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-G9PV64-F1-model_v4 deleted 0.9707 1 379

Feature Viewer

pLDDT pTM Quality
93.46 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map