F450165

General Info

Members Datasets Scaffolds Average Seq Length
469 290 469 94

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10045491|rootH2_100454915
Length 109
Sequence VSAEPQEGQSPVYRRRLIGRVASDKMDKTVVVEVVRFKRDAVYKKYVRVRKRYHAHDEKNEYKTGDRVEIIEHRPLSRQKRWAVTRLIARPATELVGGHVEAAQKAAEP

Samples

Sample ID Description Type Environment
1 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
213 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
244 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
245 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
246 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
247 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
265 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
266 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
267 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
268 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
269 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
270 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
271 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.27
Metatranscriptomes 11.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 5.33
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 6.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006769J43182_104289 3300002863 Bacteria 1186
2 Ga0006769J43182_106300 3300002863 Bacteria 758
3 Ga0006761J43178_107109 3300002865 Bacteria 508
4 Ga0006763J43179_108456 3300002870 Bacteria 665
5 Ga0006762J43184_109605 3300002872 Unclassified 610
6 Ga0006765J45826_111039 3300003161 Bacteria 1101
7 Ga0006759J45824_1027396 3300003163 Bacteria 1543
8 Ga0006759J45824_1029961 3300003163 Bacteria 6330
9 Ga0006759J45824_1037748 3300003163 Bacteria 1087
10 Ga0006759J45824_1039453 3300003163 Bacteria 2123
11 Ga0006758J48902_1009221 3300003300 Bacteria 1961
12 Ga0006758J48902_1009222 3300003300 Bacteria 1430
13 Ga0006758J48902_1009598 3300003300 Bacteria 4274
14 Ga0006758J48902_1012886 3300003300 Bacteria 2834
15 Ga0006758J48902_1021124 3300003300 Bacteria 508
16 Ga0006770J48903_1016726 3300003305 Bacteria 2195
17 rootH2_10045491 3300003320 Bacteria 3605
18 rootH1_10015553 3300003323 Bacteria 3043
19 rootH1_10015554 3300003323 Bacteria 1679
20 Ga0032354_1050569 3300003693 Bacteria 911
21 Ga0032354_1123461 3300003693 Bacteria 549
22 Ga0006766_120163 3300003717 Bacteria 664
23 Ga0058859_11363661 3300004798 Bacteria 639
24 Ga0058859_11666696 3300004798 Bacteria 530
25 Ga0058859_11793010 3300004798 Bacteria 1259
26 Ga0058860_11423517 3300004801 Bacteria 555
27 Ga0058860_12230108 3300004801 Bacteria 926
28 Ga0065717_1013978 3300005276 Bacteria 546
29 Ga0065707_11084460 3300005295 Bacteria 519
30 Ga0070676_10018293 3300005328 Bacteria 3881
31 Ga0070683_100241547 3300005329 Bacteria 1718
32 Ga0070683_100803732 3300005329 Bacteria 902
33 Ga0070683_102191005 3300005329 Bacteria 530
34 Ga0070690_100558134 3300005330 Bacteria 864
35 Ga0070690_100664315 3300005330 Bacteria 797
36 Ga0070670_100337869 3300005331 Bacteria 1322
37 Ga0070677_10024571 3300005333 Bacteria 2242
38 Ga0070677_10081789 3300005333 Bacteria 1383
39 Ga0068869_100050185 3300005334 Bacteria 3023
40 Ga0068869_101184256 3300005334 Bacteria 671
41 Ga0070680_100354549 3300005336 Bacteria 1248
42 Ga0070682_100000787 3300005337 Bacteria 18636
43 Ga0070682_100016985 3300005337 Bacteria 4237
44 Ga0070682_100139853 3300005337 Bacteria 1649
45 Ga0070682_101237566 3300005337 Bacteria 632
46 Ga0070682_101649650 3300005337 Bacteria 556
47 Ga0070682_101693088 3300005337 Bacteria 549
48 Ga0070682_101843434 3300005337 Bacteria 529
49 Ga0068868_100160818 3300005338 Bacteria 1854
50 Ga0068868_100923284 3300005338 Bacteria 794
51 Ga0070660_100406772 3300005339 Bacteria 1126
52 Ga0070689_100068193 3300005340 Bacteria 2774
53 Ga0070689_100124190 3300005340 Bacteria 2064
54 Ga0070689_100342599 3300005340 Bacteria 1252
55 Ga0070689_100688822 3300005340 Bacteria 892
56 Ga0070691_10060647 3300005341 Bacteria 1819
57 Ga0070687_101406173 3300005343 Bacteria 522
58 Ga0070692_10149633 3300005345 Bacteria 1328
59 Ga0070668_100028739 3300005347 Bacteria 4219
60 Ga0070669_100025363 3300005353 Bacteria 4257
61 Ga0070675_100183980 3300005354 Bacteria 1808
62 Ga0070675_100195961 3300005354 Bacteria 1752
63 Ga0070675_100318549 3300005354 Bacteria 1373
64 Ga0070671_100191826 3300005355 Bacteria 1732
65 Ga0070674_100007457 3300005356 Bacteria 6453
66 Ga0070674_100367453 3300005356 Bacteria 1167
67 Ga0070673_100051191 3300005364 Bacteria 3232
68 Ga0070673_100071173 3300005364 Bacteria 2793
69 Ga0070673_100677707 3300005364 Bacteria 945
70 Ga0070688_100081462 3300005365 Bacteria 2096
71 Ga0070688_100426728 3300005365 Bacteria 986
72 Ga0070688_100874058 3300005365 Bacteria 707
73 Ga0070659_100169875 3300005366 Bacteria 1786
74 Ga0070713_101097969 3300005436 Bacteria 769
75 Ga0070701_10085332 3300005438 Bacteria 1719
76 Ga0070705_100852754 3300005440 Bacteria 729
77 Ga0070700_100727749 3300005441 Bacteria 792
78 Ga0070694_100586888 3300005444 Bacteria 896
79 Ga0070663_100466825 3300005455 Bacteria 1043
80 Ga0070678_100804705 3300005456 Bacteria 854
81 Ga0070662_100093375 3300005457 Bacteria 2263
82 Ga0070681_10212292 3300005458 Bacteria 1851
83 Ga0070681_11003005 3300005458 Bacteria 755
84 Ga0068867_100016292 3300005459 Bacteria 5278
85 Ga0070685_10052930 3300005466 Bacteria 2350
86 Ga0070685_10088782 3300005466 Bacteria 1867
87 Ga0070685_10603653 3300005466 Bacteria 790
88 Ga0070685_10858064 3300005466 Bacteria 673
89 Ga0070685_11045815 3300005466 Bacteria 614
90 Ga0070706_100500942 3300005467 Bacteria 1130
91 Ga0070684_100086123 3300005535 Bacteria 2788
92 Ga0070684_100501115 3300005535 Bacteria 1125
93 Ga0070684_101318129 3300005535 Bacteria 680
94 Ga0068853_100558747 3300005539 Bacteria 1085
95 Ga0068853_100622443 3300005539 Bacteria 1026
96 Ga0068853_102207948 3300005539 Bacteria 534
97 Ga0068853_102235865 3300005539 Bacteria 530
98 Ga0070672_100005856 3300005543 Bacteria 8198
99 Ga0070672_100074196 3300005543 Bacteria 2713
100 Ga0070672_100083257 3300005543 Bacteria 2567
101 Ga0070672_100188208 3300005543 Bacteria 1722
102 Ga0070672_100189079 3300005543 Bacteria 1718
103 Ga0070686_100022242 3300005544 Bacteria 3774
104 Ga0070686_101267123 3300005544 Bacteria 614
105 Ga0070695_100147012 3300005545 Bacteria 1641
106 Ga0070693_100339727 3300005547 Bacteria 1024
107 Ga0070665_100826267 3300005548 Bacteria 940
108 Ga0070665_101890826 3300005548 Bacteria 603
109 Ga0070704_100408103 3300005549 Bacteria 1161
110 Ga0068855_100000266 3300005563 Bacteria 65127
111 Ga0068855_100021979 3300005563 Bacteria 7648
112 Ga0070664_100697310 3300005564 Bacteria 946
113 Ga0068857_101054500 3300005577 Bacteria 784
114 Ga0068857_101060227 3300005577 Bacteria 782
115 Ga0068854_100126246 3300005578 Bacteria 1949
116 Ga0068856_100072939 3300005614 Bacteria 3399
117 Ga0068856_100711535 3300005614 Bacteria 1024
118 Ga0070702_101355678 3300005615 Bacteria 580
119 Ga0068859_100995658 3300005617 Bacteria 920
120 Ga0068859_102986625 3300005617 Bacteria 517
121 Ga0068864_100669070 3300005618 Bacteria 1012
122 Ga0068864_101108396 3300005618 Bacteria 788
123 Ga0068866_10091912 3300005718 Bacteria 1654
124 Ga0068866_10396743 3300005718 Bacteria 889
125 Ga0068861_100396217 3300005719 Bacteria 1224
126 Ga0068861_100457060 3300005719 Bacteria 1145
127 Ga0068851_10372549 3300005834 Bacteria 835
128 Ga0068851_10718012 3300005834 Bacteria 616
129 Ga0068851_10760925 3300005834 Bacteria 600
130 Ga0068870_10768276 3300005840 Bacteria 671
131 Ga0068863_100015171 3300005841 Bacteria 7402
132 Ga0068863_101710820 3300005841 Bacteria 639
133 Ga0068858_100295540 3300005842 Bacteria 1544
134 Ga0068858_101347111 3300005842 Bacteria 703
135 Ga0068862_100091874 3300005844 Bacteria 2644
136 Ga0068862_102095527 3300005844 Bacteria 577
137 Ga0081455_10537061 3300005937 Bacteria 776
138 Ga0070715_10425876 3300006163 Bacteria 744
139 Ga0070716_101720011 3300006173 Bacteria 518
140 Ga0070712_101578029 3300006175 Bacteria 574
141 Ga0075362_10218353 3300006177 Bacteria 931
142 Ga0075362_10271068 3300006177 Bacteria 838
143 Ga0075366_10009031 3300006195 Bacteria 5559
144 Ga0075366_10018157 3300006195 Bacteria 4061
145 Ga0075366_10081289 3300006195 Bacteria 1935
146 Ga0075366_10517867 3300006195 Bacteria 738
147 Ga0068871_100286387 3300006358 Bacteria 1442
148 Ga0068871_100313833 3300006358 Bacteria 1379
149 Ga0068871_101231209 3300006358 Bacteria 703
150 Ga0075430_100286181 3300006846 Bacteria 1364
151 Ga0075430_101138474 3300006846 Bacteria 643
152 Ga0075431_101875986 3300006847 Bacteria 555
153 Ga0075429_100717589 3300006880 Bacteria 876
154 Ga0068865_100759355 3300006881 Bacteria 833
155 Ga0075436_100799513 3300006914 Bacteria 702
156 Ga0097620_100995693 3300006931 Bacteria 920
157 Ga0097620_102985358 3300006931 Bacteria 517
158 Ga0105240_10368729 3300009093 Bacteria 1624
159 Ga0111539_11194141 3300009094 Bacteria 884
160 Ga0105245_10002954 3300009098 Bacteria 15251
161 Ga0105247_11152370 3300009101 Bacteria 615
162 Ga0114129_12226119 3300009147 Bacteria 659
163 Ga0105243_10918606 3300009148 Bacteria 872
164 Ga0105241_10003328 3300009174 Bacteria 11959
165 Ga0105241_12563013 3300009174 Bacteria 511
166 Ga0105242_12189552 3300009176 Bacteria 598
167 Ga0105248_12884117 3300009177 Bacteria 548
168 Ga0105237_10569738 3300009545 Bacteria 1139
169 Ga0105238_10733151 3300009551 Bacteria 1001
170 Ga0105238_11509572 3300009551 Bacteria 701
171 Ga0105249_11897303 3300009553 Bacteria 668
172 Ga0105239_10555629 3300010375 Bacteria 1307
173 Ga0105246_11461753 3300011119 Bacteria 640
174 Ga0157371_11252600 3300013102 Bacteria 573
175 Ga0157370_11379431 3300013104 Bacteria 634
176 Ga0157374_10039567 3300013296 Bacteria 4339
177 Ga0157374_10446050 3300013296 Bacteria 1295
178 Ga0157375_10379526 3300013308 Bacteria 1580
179 Ga0163163_10668872 3300014325 Bacteria 1102
180 Ga0163163_11213366 3300014325 Bacteria 817
181 Ga0157380_10316530 3300014326 Bacteria 1445
182 Ga0157380_12892543 3300014326 Bacteria 546
183 Ga0157380_12965027 3300014326 Unclassified 540
184 Ga0157377_10994466 3300014745 Bacteria 635
185 Ga0157377_11055316 3300014745 Bacteria 619
186 Ga0157377_11673329 3300014745 Bacteria 512
187 Ga0157379_10549618 3300014968 Bacteria 1074
188 Ga0157379_11984428 3300014968 Bacteria 575
189 Ga0157376_10085510 3300014969 Bacteria 2718
190 Ga0157376_10282688 3300014969 Bacteria 1563
191 Ga0157376_10493542 3300014969 Bacteria 1202
192 Ga0157376_10865049 3300014969 Bacteria 920
193 Ga0157376_11171514 3300014969 Bacteria 796
194 Ga0163161_10227494 3300017792 Bacteria 1446
195 Ga0206352_10383322 3300020078 Bacteria 825
196 Ga0213876_10573324 3300021384 Bacteria 600
197 Ga0207666_1001625 3300025271 Bacteria 2664
198 Ga0207697_10348596 3300025315 Bacteria 657
199 Ga0207656_10455330 3300025321 Bacteria 647
200 Ga0207682_10011730 3300025893 Bacteria 3424
201 Ga0207682_10143047 3300025893 Bacteria 1074
202 Ga0207642_10677187 3300025899 Bacteria 648
203 Ga0207642_11128329 3300025899 Bacteria 507
204 Ga0207688_10186585 3300025901 Bacteria 1239
205 Ga0207680_10374993 3300025903 Bacteria 1002
206 Ga0207647_10118635 3300025904 Bacteria 1561
207 Ga0207685_10737060 3300025905 Bacteria 539
208 Ga0207699_10740975 3300025906 Bacteria 721
209 Ga0207645_10021058 3300025907 Bacteria 4257
210 Ga0207645_11054841 3300025907 Bacteria 549
211 Ga0207643_10206890 3300025908 Bacteria 1197
212 Ga0207654_10005897 3300025911 Bacteria 6169
213 Ga0207654_10519492 3300025911 Bacteria 843
214 Ga0207707_10070280 3300025912 Bacteria 3051
215 Ga0207707_10755366 3300025912 Bacteria 813
216 Ga0207671_10619500 3300025914 Bacteria 862
217 Ga0207662_10086791 3300025918 Bacteria 1918
218 Ga0207657_10653070 3300025919 Bacteria 819
219 Ga0207681_10002742 3300025923 Bacteria 11146
220 Ga0207694_10176365 3300025924 Bacteria 1732
221 Ga0207694_11139312 3300025924 Bacteria 660
222 Ga0207650_10048909 3300025925 Bacteria 3120
223 Ga0207659_10240778 3300025926 Bacteria 1463
224 Ga0207659_10385428 3300025926 Bacteria 1169
225 Ga0207659_10403812 3300025926 Bacteria 1143
226 Ga0207687_10002323 3300025927 Bacteria 12949
227 Ga0207700_10425332 3300025928 Bacteria 1167
228 Ga0207644_10055836 3300025931 Bacteria 2848
229 Ga0207690_10136438 3300025932 Bacteria 1802
230 Ga0207706_10091565 3300025933 Bacteria 2673
231 Ga0207686_11087414 3300025934 Bacteria 651
232 Ga0207709_10210974 3300025935 Bacteria 1394
233 Ga0207670_10150696 3300025936 Bacteria 1725
234 Ga0207670_10156318 3300025936 Bacteria 1698
235 Ga0207669_10672618 3300025937 Bacteria 848
236 Ga0207704_10003857 3300025938 Bacteria 6810
237 Ga0207704_10765814 3300025938 Bacteria 804
238 Ga0207665_10850556 3300025939 Bacteria 722
239 Ga0207665_11452521 3300025939 Bacteria 545
240 Ga0207691_10036323 3300025940 Bacteria 4565
241 Ga0207691_10204635 3300025940 Bacteria 1717
242 Ga0207691_10289454 3300025940 Bacteria 1409
243 Ga0207691_10713868 3300025940 Bacteria 845
244 Ga0207691_10727844 3300025940 Bacteria 836
245 Ga0207711_12046003 3300025941 Unclassified 515
246 Ga0207689_10065221 3300025942 Bacteria 2996
247 Ga0207689_11284890 3300025942 Bacteria 615
248 Ga0207661_10060988 3300025944 Bacteria 3046
249 Ga0207661_10082186 3300025944 Bacteria 2663
250 Ga0207679_10286525 3300025945 Bacteria 1414
251 Ga0207667_10000612 3300025949 Bacteria 46149
252 Ga0207667_10003431 3300025949 Bacteria 19566
253 Ga0207651_10007125 3300025960 Bacteria 5937
254 Ga0207651_10064605 3300025960 Bacteria 2562
255 Ga0207651_10855995 3300025960 Bacteria 808
256 Ga0207651_11357292 3300025960 Bacteria 639
257 Ga0207668_10693369 3300025972 Bacteria 894
258 Ga0207640_10323909 3300025981 Bacteria 1228
259 Ga0207658_10392774 3300025986 Bacteria 1217
260 Ga0207677_10291313 3300026023 Bacteria 1345
261 Ga0207703_10316451 3300026035 Bacteria 1428
262 Ga0207703_11834217 3300026035 Bacteria 582
263 Ga0207639_10047593 3300026041 Bacteria 3242
264 Ga0207639_10492689 3300026041 Bacteria 1118
265 Ga0207639_10992147 3300026041 Bacteria 786
266 Ga0207678_10677898 3300026067 Bacteria 906
267 Ga0207678_11178814 3300026067 Bacteria 678
268 Ga0207708_10012451 3300026075 Bacteria 6340
269 Ga0207708_10057952 3300026075 Bacteria 2955
270 Ga0207708_11336648 3300026075 Bacteria 628
271 Ga0207708_11616581 3300026075 Unclassified 569
272 Ga0207702_10040498 3300026078 Bacteria 3906
273 Ga0207702_10182964 3300026078 Bacteria 1931
274 Ga0207702_10439820 3300026078 Bacteria 1264
275 Ga0207641_10401323 3300026088 Bacteria 1316
276 Ga0207641_11554345 3300026088 Bacteria 663
277 Ga0207648_10011154 3300026089 Bacteria 8479
278 Ga0207676_10514073 3300026095 Bacteria 1139
279 Ga0207676_11130419 3300026095 Bacteria 775
280 Ga0207674_10860911 3300026116 Bacteria 874
281 Ga0207674_10965093 3300026116 Bacteria 821
282 Ga0207675_100013850 3300026118 Bacteria 7520
283 Ga0207675_100181324 3300026118 Bacteria 2016
284 Ga0207675_100768026 3300026118 Bacteria 976
285 Ga0207675_101074241 3300026118 Bacteria 824
286 Ga0207683_10259086 3300026121 Bacteria 1588
287 Ga0207683_10512688 3300026121 Bacteria 1108
288 Ga0207683_10802614 3300026121 Bacteria 873
289 Ga0207698_10903638 3300026142 Bacteria 890
290 Ga0207698_12216058 3300026142 Bacteria 562
291 Ga0209998_10004948 3300027717 Bacteria 2802
292 Ga0207428_10017611 3300027907 Bacteria 6126
293 Ga0268266_10962908 3300028379 Bacteria 826
294 Ga0268266_11956922 3300028379 Bacteria 560
295 Ga0268265_10034866 3300028380 Bacteria 3671
296 Ga0268265_11308794 3300028380 Bacteria 725
297 Ga0268264_10136493 3300028381 Bacteria 2181
298 Ga0265337_1001901 3300028556 Bacteria 9942
299 Ga0265319_1060122 3300028563 Bacteria 1234
300 Ga0265334_10001615 3300028573 Bacteria 10823
301 Ga0265336_10076203 3300028666 Bacteria 1002
302 Ga0307515_10202150 3300028794 Bacteria 1859
303 Ga0307515_10654784 3300028794 Bacteria 663
304 Ga0265338_10382558 3300028800 Bacteria 1006
305 Ga0265332_10084104 3300031238 Bacteria 1349
306 Ga0265332_10155677 3300031238 Bacteria 955
307 Ga0265320_10001512 3300031240 Bacteria 16930
308 Ga0265325_10118345 3300031241 Bacteria 1280
309 Ga0265340_10015118 3300031247 Bacteria 4016
310 Ga0265339_10055328 3300031249 Bacteria 2153
311 Ga0307513_10090959 3300031456 Bacteria 3111
312 Ga0307513_10667955 3300031456 Bacteria 746
313 Ga0307509_10500318 3300031507 Bacteria 900
314 Ga0307509_10843681 3300031507 Bacteria 581
315 Ga0307508_10050191 3300031616 Bacteria 3713
316 Ga0307508_10810175 3300031616 Bacteria 554
317 Ga0265314_10276656 3300031711 Bacteria 951
318 Ga0307516_10003404 3300031730 Bacteria 20479
319 Ga0307412_11226029 3300031911 Bacteria 673
320 Ga0307411_11306245 3300032005 Bacteria 661
321 Ga0307411_11320669 3300032005 Bacteria 658
322 Ga0316592_1113147 3300033524 Unclassified 628
323 Ga0316588_1150386 3300033528 Bacteria 597
324 Ga0316596_1123044 3300033541 Bacteria 707
325 Ga0373958_0009873 3300034819 Bacteria 1581
326 Ga0373926_0037278 3300035083 Bacteria 1729
327 Ga0373929_0185126 3300035085 Bacteria 576
328 Ga0373945_0138113 3300035116 Bacteria 981
329 Ga0373943_0011073 3300035170 Bacteria 4051
330 Ga0373935_0390479 3300035692 Bacteria 998
331 Ga0373927_0161417 3300035695 Bacteria 1468
332 Ga0373933_0762442 3300035724 Bacteria 637
333 Ga0373937_0408129 3300036401 Bacteria 1289
334 Ga0373937_1251706 3300036401 Bacteria 690
335 Ga0436365_1839659 3300039437 Bacteria 4011
336 Ga0451787_227323 3300041441 Bacteria 658
337 Ga0451787_430695 3300041441 Bacteria 2872
338 Ga0451789_0502497 3300041443 Bacteria 598
339 Ga0451789_0934748 3300041443 Bacteria 559
340 Ga0451794_07065 3300041446 Bacteria 1237
341 Ga0451791_1548520 3300041451 Bacteria 563
342 Ga0451793_1893695 3300041452 Bacteria 643
343 Ga0451797_0895524 3300041453 Bacteria 687
344 Ga0451795_1143703 3300041456 Bacteria 681
345 Ga0451798_0262246 3300041458 Bacteria 638
346 Ga0451798_0874282 3300041458 Bacteria 1069
347 Ga0451800_0558223 3300041459 Bacteria 1409
348 Ga0451805_026080 3300041461 Bacteria 882
349 Ga0451804_0599107 3300041463 Bacteria 625
350 Ga0451804_0747749 3300041463 Bacteria 563
351 Ga0451808_33157 3300041464 Bacteria 607
352 Ga0451807_0974580 3300041486 Bacteria 1692
353 Ga0451807_0978842 3300041486 Bacteria 702
354 Ga0451807_1144583 3300041486 Bacteria 508
355 Ga0451807_1291030 3300041486 Bacteria 641
356 Ga0451807_2271178 3300041486 Bacteria 599
357 Ga0451841_1083457 3300041498 Bacteria 1025
358 Ga0451849_0111712 3300041505 Bacteria 615
359 Ga0451849_1344458 3300041505 Bacteria 3728
360 Ga0451850_63564 3300041506 Bacteria 877
361 Ga0451851_0850392 3300041507 Bacteria 930
362 Ga0451843_0372412 3300041509 Bacteria 751
363 Ga0451853_1266368 3300041512 Bacteria 15952
364 Ga0451853_1756466 3300041512 Bacteria 966
365 Ga0451853_2204238 3300041512 Bacteria 789
366 Ga0451853_3977348 3300041512 Bacteria 1406
367 Ga0439445_0049438 3300042004 Bacteria 1132
368 Ga0439445_0049753 3300042004 Bacteria 1129
369 Ga0439458_0212994 3300042157 Bacteria 531
370 Ga0453684_1877951 3300044712 Bacteria 607
371 Ga0466971_0121247 3300044719 Bacteria 1210
372 Ga0466960_0030191 3300044901 Bacteria 2493
373 Ga0466959_0532825 3300045049 Bacteria 793
374 Ga0451576_0136068 3300045051 Bacteria 2562
375 Ga0451576_0635891 3300045051 Bacteria 1121
376 Ga0495623_0653304 3300046679 Bacteria 542
377 Ga0495658_0132955 3300046683 Bacteria 1516
378 Ga0495680_0062109 3300047322 Bacteria 2873
379 Ga0496102_0436016 3300048905 Bacteria 1230
380 Ga0496104_0036226 3300048907 Bacteria 4612
381 Ga0496112_0030222 3300048915 Bacteria 5242
382 Ga0496115_0561298 3300048918 Bacteria 911
383 Ga0501306_024178 3300049127 Bacteria 867
384 Ga0501306_041246 3300049127 Bacteria 717
385 Ga0501308_011068 3300049128 Bacteria 1011
386 Ga0501308_014383 3300049128 Bacteria 926
387 Ga0501309_038483 3300049129 Bacteria 725
388 Ga0501310_010584 3300049130 Bacteria 1031
389 Ga0501310_015014 3300049130 Bacteria 915
390 Ga0501310_034206 3300049130 Bacteria 686
391 Ga0501305_018599 3300049161 Bacteria 1007
392 Ga0501305_023035 3300049161 Bacteria 930
393 Ga0501307_006084 3300049162 Bacteria 1292
394 Ga0501307_008393 3300049162 Bacteria 1159
395 Ga0501307_092382 3300049162 Bacteria 506
396 Ga0501290_061926 3300049513 Bacteria 604
397 Ga0501292_132493 3300049515 Bacteria 516
398 Ga0501294_017782 3300049517 Bacteria 749
399 Ga0501299_094957 3300049522 Bacteria 683
400 Ga0501311_012757 3300049527 Bacteria 1053
401 Ga0501313_005318 3300049529 Bacteria 1355
402 Ga0501313_049363 3300049529 Bacteria 579
403 Ga0501314_003556 3300049530 Bacteria 1259
404 Ga0501314_013384 3300049530 Bacteria 795
405 Ga0501315_079563 3300049531 Bacteria 555
406 Ga0501326_05426 3300049542 Bacteria 693
407 Ga0501340_025543 3300049556 Bacteria 515
408 Ga0501042_0376179 3300049578 Bacteria 1028
409 Ga0501047_0083068 3300049581 Bacteria 3079
410 Ga0501067_0003773 3300049583 Bacteria 8357
411 Ga0501067_0009930 3300049583 Bacteria 5271
412 Ga0501068_0195360 3300049584 Bacteria 1283
413 Ga0501068_0314939 3300049584 Bacteria 1003
414 Ga0501070_0345621 3300049586 Bacteria 1208
415 Ga0501071_0018420 3300049587 Bacteria 4834
416 Ga0501072_0155592 3300049588 Bacteria 1823
417 Ga0501072_0824832 3300049588 Bacteria 726
418 Ga0501073_0003382 3300049589 Bacteria 11991
419 Ga0501073_0007918 3300049589 Bacteria 7882
420 Ga0501073_0147160 3300049589 Bacteria 1632
421 Ga0501073_0468049 3300049589 Bacteria 871
422 Ga0501074_0002140 3300049590 Bacteria 13659
423 Ga0501076_0009809 3300049592 Bacteria 7075
424 Ga0501077_0109859 3300049593 Bacteria 1747
425 Ga0501199_030610 3300049650 Bacteria 663
426 Ga0501210_027006 3300049657 Bacteria 577
427 Ga0501222_048189 3300049662 Bacteria 620
428 Ga0501242_075069 3300049674 Bacteria 535
429 Ga0501246_026919 3300049676 Bacteria 627
430 Ga0501253_058867 3300049683 Bacteria 823
431 Ga0501260_053820 3300049689 Bacteria 512
432 Ga0501221_228627 3300049704 Bacteria 527
433 Ga0501225_0037033 3300049705 Bacteria 1344
434 Ga0501079_0080947 3300049741 Bacteria 2511
435 Ga0501079_0593202 3300049741 Bacteria 872
436 Ga0501080_0001538 3300049742 Bacteria 19472
437 Ga0501080_0012444 3300049742 Bacteria 7800
438 Ga0501080_0088773 3300049742 Bacteria 2872
439 Ga0501080_0710557 3300049742 Bacteria 886
440 Ga0501081_1564162 3300049743 Bacteria 501
441 Ga0501083_0015971 3300049744 Bacteria 5257
442 Ga0501083_0023661 3300049744 Bacteria 4259
443 Ga0501083_0195843 3300049744 Bacteria 1319
444 Ga0501083_0471175 3300049744 Bacteria 817
445 Ga0501083_0798520 3300049744 Bacteria 614
446 Ga0501265_049455 3300049762 Bacteria 658
447 nmdc:mga03683_193661_c1 3300050489 Bacteria 931
448 nmdc:mga00v17_39504_c1 3300050491 Bacteria 2826
449 nmdc:mga0k408_14443_c1 3300050493 Bacteria 4352
450 nmdc:mga0k408_18243_c1 3300050493 Bacteria 3915
451 nmdc:mga0k408_23012_c1 3300050493 Bacteria 3512
452 nmdc:mga0k408_34669_c1 3300050493 Bacteria 2890
453 nmdc:mga0k408_3991_c1 3300050493 Bacteria 7823
454 nmdc:mga0k408_598713_c1 3300050493 Bacteria 650
455 nmdc:mga08y16_20950_c1 3300050511 Bacteria 6902
456 nmdc:mga08y16_596915_c1 3300050511 Bacteria 1113
457 nmdc:mga08x19_268098_c1 3300050514 Bacteria 1181
458 Ga0500635_0007996 3300053080 Bacteria 2885
459 Ga0495595_0439037 3300053084 Bacteria 663
460 Ga0500644_0006354 3300053088 Bacteria 3023
461 Ga0500647_0228163 3300053091 Bacteria 830
462 Ga0501084_0117414 3300054114 Bacteria 2237
463 Ga0501084_0144668 3300054114 Bacteria 2002
464 Ga0501084_0408519 3300054114 Bacteria 1147
465 Ga0587084_012826 3300059477 Bacteria 1142
466 Ga0587109_053057 3300059624 Bacteria 836
467 Ga0501082_0073718 3300060353 Bacteria 2940
468 Ga0501082_0337953 3300060353 Bacteria 1312
469 Ga0501082_1479513 3300060353 Bacteria 593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004801 Ga0058860_12230108 Ga0058860_122301081 88
2 3300005328 Ga0070676_10018293 Ga0070676_100182933 88
3 3300005329 Ga0070683_100803732 Ga0070683_1008037322 88
4 3300005329 Ga0070683_102191005 Ga0070683_1021910051 88
5 3300005333 Ga0070677_10081789 Ga0070677_100817892 88
6 3300005334 Ga0068869_100050185 Ga0068869_1000501857 88
7 3300005336 Ga0070680_100354549 Ga0070680_1003545493 88
8 3300005337 Ga0070682_101649650 Ga0070682_1016496501 88
9 3300005338 Ga0068868_100160818 Ga0068868_1001608184 88
10 3300005338 Ga0068868_100923284 Ga0068868_1009232841 88
11 3300005339 Ga0070660_100406772 Ga0070660_1004067721 88
12 3300005340 Ga0070689_100068193 Ga0070689_1000681934 88
13 3300005340 Ga0070689_100688822 Ga0070689_1006888221 88
14 3300005341 Ga0070691_10060647 Ga0070691_100606473 88
15 3300005343 Ga0070687_101406173 Ga0070687_1014061731 88
16 3300005345 Ga0070692_10149633 Ga0070692_101496332 88
17 3300005347 Ga0070668_100028739 Ga0070668_1000287399 88
18 3300005353 Ga0070669_100025363 Ga0070669_1000253634 88
19 3300005354 Ga0070675_100183980 Ga0070675_1001839803 88
20 3300005354 Ga0070675_100318549 Ga0070675_1003185493 88
21 3300005355 Ga0070671_100191826 Ga0070671_1001918264 88
22 3300005356 Ga0070674_100007457 Ga0070674_1000074577 88
23 3300005356 Ga0070674_100367453 Ga0070674_1003674532 88
24 3300005364 Ga0070673_100051191 Ga0070673_1000511914 88
25 3300005364 Ga0070673_100071173 Ga0070673_1000711734 88
26 3300005364 Ga0070673_100677707 Ga0070673_1006777072 88
27 3300005365 Ga0070688_100426728 Ga0070688_1004267282 88
28 3300005365 Ga0070688_100874058 Ga0070688_1008740581 88
29 3300005366 Ga0070659_100169875 Ga0070659_1001698753 88
30 3300005436 Ga0070713_101097969 Ga0070713_1010979691 88
31 3300005438 Ga0070701_10085332 Ga0070701_100853323 88
32 3300005440 Ga0070705_100852754 Ga0070705_1008527542 88
33 3300005441 Ga0070700_100727749 Ga0070700_1007277492 88
34 3300005455 Ga0070663_100466825 Ga0070663_1004668252 88
35 3300005456 Ga0070678_100804705 Ga0070678_1008047052 88
36 3300005457 Ga0070662_100093375 Ga0070662_1000933752 88
37 3300005458 Ga0070681_10212292 Ga0070681_102122922 88
38 3300005458 Ga0070681_11003005 Ga0070681_110030053 88
39 3300005459 Ga0068867_100016292 Ga0068867_1000162924 88
40 3300005466 Ga0070685_10088782 Ga0070685_100887824 88
41 3300005466 Ga0070685_10603653 Ga0070685_106036532 88
42 3300005466 Ga0070685_11045815 Ga0070685_110458151 88
43 3300005535 Ga0070684_100501115 Ga0070684_1005011153 88
44 3300005535 Ga0070684_101318129 Ga0070684_1013181292 88
45 3300005539 Ga0068853_100558747 Ga0068853_1005587472 88
46 3300005539 Ga0068853_100622443 Ga0068853_1006224432 88
47 3300005539 Ga0068853_102207948 Ga0068853_1022079482 88
48 3300005543 Ga0070672_100074196 Ga0070672_1000741964 88
49 3300005543 Ga0070672_100083257 Ga0070672_1000832574 88
50 3300005543 Ga0070672_100188208 Ga0070672_1001882084 88
51 3300005543 Ga0070672_100189079 Ga0070672_1001890792 88
52 3300005544 Ga0070686_100022242 Ga0070686_1000222424 88
53 3300005544 Ga0070686_101267123 Ga0070686_1012671232 88
54 3300005545 Ga0070695_100147012 Ga0070695_1001470121 88
55 3300005548 Ga0070665_100826267 Ga0070665_1008262673 88
56 3300005548 Ga0070665_101890826 Ga0070665_1018908262 88
57 3300005549 Ga0070704_100408103 Ga0070704_1004081033 88
58 3300005564 Ga0070664_100697310 Ga0070664_1006973102 88
59 3300005577 Ga0068857_101060227 Ga0068857_1010602272 88
60 3300005578 Ga0068854_100126246 Ga0068854_1001262462 88
61 3300005614 Ga0068856_100711535 Ga0068856_1007115353 88
62 3300005617 Ga0068859_100995658 Ga0068859_1009956582 88
63 3300005718 Ga0068866_10091912 Ga0068866_100919124 88
64 3300005718 Ga0068866_10396743 Ga0068866_103967433 88
65 3300005719 Ga0068861_100457060 Ga0068861_1004570603 88
66 3300005834 Ga0068851_10718012 Ga0068851_107180122 88
67 3300005834 Ga0068851_10760925 Ga0068851_107609252 88
68 3300005840 Ga0068870_10768276 Ga0068870_107682762 88
69 3300005841 Ga0068863_101710820 Ga0068863_1017108202 88
70 3300005842 Ga0068858_100295540 Ga0068858_1002955402 88
71 3300005844 Ga0068862_100091874 Ga0068862_1000918747 88
72 3300005937 Ga0081455_10537061 Ga0081455_105370612 88
73 3300006163 Ga0070715_10425876 Ga0070715_104258762 88
74 3300006173 Ga0070716_101720011 Ga0070716_1017200111 88
75 3300006358 Ga0068871_100286387 Ga0068871_1002863874 88
76 3300006846 Ga0075430_100286181 Ga0075430_1002861814 88
77 3300006846 Ga0075430_101138474 Ga0075430_1011384742 88
78 3300006880 Ga0075429_100717589 Ga0075429_1007175893 88
79 3300006881 Ga0068865_100759355 Ga0068865_1007593552 88
80 3300006931 Ga0097620_100995693 Ga0097620_1009956932 88
81 3300009101 Ga0105247_11152370 Ga0105247_111523701 88
82 3300009148 Ga0105243_10918606 Ga0105243_109186062 88
83 3300009174 Ga0105241_12563013 Ga0105241_125630132 88
84 3300009553 Ga0105249_11897303 Ga0105249_118973031 88
85 3300011119 Ga0105246_11461753 Ga0105246_114617532 88
86 3300013102 Ga0157371_11252600 Ga0157371_112526002 88
87 3300013296 Ga0157374_10039567 Ga0157374_100395674 88
88 3300013308 Ga0157375_10379526 Ga0157375_103795262 88
89 3300014326 Ga0157380_12892543 Ga0157380_128925432 88
90 3300014745 Ga0157377_11055316 Ga0157377_110553162 88
91 3300014745 Ga0157377_11673329 Ga0157377_116733292 88
92 3300014968 Ga0157379_10549618 Ga0157379_105496183 88
93 3300021384 Ga0213876_10573324 Ga0213876_105733242 88
94 3300025271 Ga0207666_1001625 Ga0207666_10016257 88
95 3300025315 Ga0207697_10348596 Ga0207697_103485962 88
96 3300025321 Ga0207656_10455330 Ga0207656_104553302 88
97 3300025893 Ga0207682_10143047 Ga0207682_101430473 88
98 3300025899 Ga0207642_10677187 Ga0207642_106771872 88
99 3300025901 Ga0207688_10186585 Ga0207688_101865852 88
100 3300025903 Ga0207680_10374993 Ga0207680_103749933 88
101 3300025904 Ga0207647_10118635 Ga0207647_101186353 88
102 3300025905 Ga0207685_10737060 Ga0207685_107370602 88
103 3300025906 Ga0207699_10740975 Ga0207699_107409752 88
104 3300025907 Ga0207645_10021058 Ga0207645_100210588 88
105 3300025907 Ga0207645_11054841 Ga0207645_110548412 88
106 3300025908 Ga0207643_10206890 Ga0207643_102068903 88
107 3300025912 Ga0207707_10070280 Ga0207707_100702804 88
108 3300025912 Ga0207707_10755366 Ga0207707_107553662 88
109 3300025918 Ga0207662_10086791 Ga0207662_100867914 88
110 3300025919 Ga0207657_10653070 Ga0207657_106530702 88
111 3300025923 Ga0207681_10002742 Ga0207681_1000274213 88
112 3300025924 Ga0207694_10176365 Ga0207694_101763654 88
113 3300025925 Ga0207650_10048909 Ga0207650_100489093 88
114 3300025926 Ga0207659_10385428 Ga0207659_103854283 88
115 3300025926 Ga0207659_10403812 Ga0207659_104038123 88
116 3300025928 Ga0207700_10425332 Ga0207700_104253321 88
117 3300025931 Ga0207644_10055836 Ga0207644_100558364 88
118 3300025932 Ga0207690_10136438 Ga0207690_101364383 88
119 3300025933 Ga0207706_10091565 Ga0207706_100915656 88
120 3300025934 Ga0207686_11087414 Ga0207686_110874142 88
121 3300025935 Ga0207709_10210974 Ga0207709_102109744 88
122 3300025936 Ga0207670_10150696 Ga0207670_101506963 88
123 3300025937 Ga0207669_10672618 Ga0207669_106726181 88
124 3300025938 Ga0207704_10003857 Ga0207704_1000385712 88
125 3300025938 Ga0207704_10765814 Ga0207704_107658143 88
126 3300025939 Ga0207665_11452521 Ga0207665_114525212 88
127 3300025940 Ga0207691_10204635 Ga0207691_102046354 88
128 3300025940 Ga0207691_10289454 Ga0207691_102894542 88
129 3300025940 Ga0207691_10713868 Ga0207691_107138681 88
130 3300025940 Ga0207691_10727844 Ga0207691_107278442 88
131 3300025941 Ga0207711_12046003 Ga0207711_120460031 88
132 3300025942 Ga0207689_10065221 Ga0207689_100652213 88
133 3300025944 Ga0207661_10082186 Ga0207661_100821863 88
134 3300025945 Ga0207679_10286525 Ga0207679_102865252 88
135 3300025960 Ga0207651_10007125 Ga0207651_1000712511 88
136 3300025960 Ga0207651_10064605 Ga0207651_100646054 88
137 3300025960 Ga0207651_10855995 Ga0207651_108559951 88
138 3300025960 Ga0207651_11357292 Ga0207651_113572921 88
139 3300025972 Ga0207668_10693369 Ga0207668_106933692 88
140 3300025981 Ga0207640_10323909 Ga0207640_103239093 88
141 3300025986 Ga0207658_10392774 Ga0207658_103927744 88
142 3300026023 Ga0207677_10291313 Ga0207677_102913133 88
143 3300026035 Ga0207703_10316451 Ga0207703_103164514 88
144 3300026035 Ga0207703_11834217 Ga0207703_118342171 88
145 3300026041 Ga0207639_10047593 Ga0207639_100475937 88
146 3300026041 Ga0207639_10492689 Ga0207639_104926891 88
147 3300026067 Ga0207678_10677898 Ga0207678_106778981 88
148 3300026067 Ga0207678_11178814 Ga0207678_111788141 88
149 3300026075 Ga0207708_10012451 Ga0207708_1001245111 88
150 3300026075 Ga0207708_11336648 Ga0207708_113366482 88
151 3300026078 Ga0207702_10182964 Ga0207702_101829643 88
152 3300026078 Ga0207702_10439820 Ga0207702_104398204 88
153 3300026088 Ga0207641_11554345 Ga0207641_115543452 88
154 3300026089 Ga0207648_10011154 Ga0207648_1001115411 88
155 3300026095 Ga0207676_10514073 Ga0207676_105140734 88
156 3300026116 Ga0207674_10860911 Ga0207674_108609112 88
157 3300026118 Ga0207675_100013850 Ga0207675_1000138508 88
158 3300026118 Ga0207675_101074241 Ga0207675_1010742412 88
159 3300026121 Ga0207683_10259086 Ga0207683_102590862 88
160 3300026121 Ga0207683_10512688 Ga0207683_105126881 88
161 3300026142 Ga0207698_10903638 Ga0207698_109036381 88
162 3300027717 Ga0209998_10004948 Ga0209998_100049487 88
163 3300027907 Ga0207428_10017611 Ga0207428_1001761112 88
164 3300028379 Ga0268266_10962908 Ga0268266_109629082 88
165 3300028379 Ga0268266_11956922 Ga0268266_119569222 88
166 3300028380 Ga0268265_10034866 Ga0268265_100348668 88
167 3300028381 Ga0268264_10136493 Ga0268264_101364934 88
168 3300028563 Ga0265319_1060122 Ga0265319_10601222 88
169 3300028666 Ga0265336_10076203 Ga0265336_100762033 88
170 3300028800 Ga0265338_10382558 Ga0265338_103825582 88
171 3300031238 Ga0265332_10155677 Ga0265332_101556772 88
172 3300031241 Ga0265325_10118345 Ga0265325_101183452 88
173 3300031247 Ga0265340_10015118 Ga0265340_100151183 88
174 3300031249 Ga0265339_10055328 Ga0265339_100553284 88
175 3300034819 Ga0373958_0009873 Ga0373958_0009873_390_656 88
176 3300035170 Ga0373943_0011073 Ga0373943_0011073_1172_1438 88
177 3300035695 Ga0373927_0161417 Ga0373927_0161417_414_680 88
178 3300035724 Ga0373933_0762442 Ga0373933_0762442_121_387 88
179 3300039437 Ga0436365_1839659 Ga0436365_1839659_926_1192 88
180 3300041486 Ga0451807_1291030 Ga0451807_1291030_272_538 88
181 3300042157 Ga0439458_0212994 Ga0439458_0212994_162_428 88
182 3300046679 Ga0495623_0653304 Ga0495623_0653304_246_512 88
183 3300048905 Ga0496102_0436016 Ga0496102_0436016_144_410 88
184 3300048907 Ga0496104_0036226 Ga0496104_0036226_2265_2531 88
185 3300048915 Ga0496112_0030222 Ga0496112_0030222_4614_4880 88
186 3300048918 Ga0496115_0561298 Ga0496115_0561298_29_295 88
187 3300049583 Ga0501067_0003773 Ga0501067_0003773_5073_5339 88
188 3300049589 Ga0501073_0003382 Ga0501073_0003382_3860_4126 88
189 3300050511 nmdc:mga08y16_20950_c1 nmdc:mga08y16_20950_c1_5284_5550 88
190 3300053084 Ga0495595_0439037 Ga0495595_0439037_70_336 88
191 3300005337 Ga0070682_101693088 Ga0070682_1016930882 89
192 3300060353 Ga0501082_0337953 Ga0501082_0337953_982_1266 89
193 3300004798 Ga0058859_11363661 Ga0058859_113636612 91
194 3300033528 Ga0316588_1150386 Ga0316588_11503861 91
195 3300041486 Ga0451807_1144583 Ga0451807_1144583_220_498 91
196 3300049588 Ga0501072_0155592 Ga0501072_0155592_72_362 91
197 3300049589 Ga0501073_0007918 Ga0501073_0007918_4649_4939 91
198 3300049589 Ga0501073_0468049 Ga0501073_0468049_87_377 91
199 3300049590 Ga0501074_0002140 Ga0501074_0002140_8782_9072 91
200 3300049592 Ga0501076_0009809 Ga0501076_0009809_4163_4453 91
201 3300049741 Ga0501079_0080947 Ga0501079_0080947_1966_2256 91
202 3300049742 Ga0501080_0001538 Ga0501080_0001538_4481_4771 91
203 3300049742 Ga0501080_0012444 Ga0501080_0012444_6815_7105 91
204 3300049744 Ga0501083_0015971 Ga0501083_0015971_4133_4423 91
205 3300049744 Ga0501083_0023661 Ga0501083_0023661_1860_2150 91
206 3300054114 Ga0501084_0117414 Ga0501084_0117414_722_1012 91
207 3300054114 Ga0501084_0144668 Ga0501084_0144668_1689_1979 91
208 3300054114 Ga0501084_0408519 Ga0501084_0408519_242_532 91
209 3300060353 Ga0501082_0073718 Ga0501082_0073718_2172_2462 91
210 3300009147 Ga0114129_12226119 Ga0114129_122261192 92
211 3300014969 Ga0157376_10865049 Ga0157376_108650492 92
212 3300025942 Ga0207689_11284890 Ga0207689_112848901 92
213 3300041461 Ga0451805_026080 Ga0451805_026080_294_572 92
214 3300049744 Ga0501083_0471175 Ga0501083_0471175_239_517 92
215 3300005330 Ga0070690_100664315 Ga0070690_1006643152 93
216 3300006847 Ga0075431_101875986 Ga0075431_1018759862 93
217 3300006914 Ga0075436_100799513 Ga0075436_1007995132 93
218 3300028556 Ga0265337_1001901 Ga0265337_10019014 93
219 3300031238 Ga0265332_10084104 Ga0265332_100841044 93
220 3300031240 Ga0265320_10001512 Ga0265320_1000151224 93
221 3300031711 Ga0265314_10276656 Ga0265314_102766563 93
222 3300033524 Ga0316592_1113147 Ga0316592_11131472 93
223 3300035083 Ga0373926_0037278 Ga0373926_0037278_1030_1326 93
224 3300035116 Ga0373945_0138113 Ga0373945_0138113_59_355 93
225 3300036401 Ga0373937_0408129 Ga0373937_0408129_858_1154 93
226 3300036401 Ga0373937_1251706 Ga0373937_1251706_364_663 93
227 3300044712 Ga0453684_1877951 Ga0453684_1877951_98_391 93
228 3300045051 Ga0451576_0635891 Ga0451576_0635891_786_1085 93
229 3300049744 Ga0501083_0798520 Ga0501083_0798520_207_524 93
230 3300050514 nmdc:mga08x19_268098_c1 nmdc:mga08x19_268098_c1_517_813 93
231 3300053088 Ga0500644_0006354 Ga0500644_0006354_1746_2057 93
232 3300003717 Ga0006766_120163 Ga0006766_1201633 94
233 3300005340 Ga0070689_100124190 Ga0070689_1001241903 94
234 3300006175 Ga0070712_101578029 Ga0070712_1015780291 94
235 3300006177 Ga0075362_10218353 Ga0075362_102183533 94
236 3300006195 Ga0075366_10081289 Ga0075366_100812893 94
237 3300006195 Ga0075366_10517867 Ga0075366_105178673 94
238 3300025936 Ga0207670_10156318 Ga0207670_101563183 94
239 3300026075 Ga0207708_10057952 Ga0207708_100579525 94
240 3300028573 Ga0265334_10001615 Ga0265334_1000161513 94
241 3300031911 Ga0307412_11226029 Ga0307412_112260292 94
242 3300032005 Ga0307411_11306245 Ga0307411_113062453 94
243 3300035085 Ga0373929_0185126 Ga0373929_0185126_151_435 94
244 3300041451 Ga0451791_1548520 Ga0451791_1548520_245_529 94
245 3300041456 Ga0451795_1143703 Ga0451795_1143703_101_385 94
246 3300041486 Ga0451807_0974580 Ga0451807_0974580_1028_1312 94
247 3300041498 Ga0451841_1083457 Ga0451841_1083457_586_870 94
248 3300041505 Ga0451849_1344458 Ga0451849_1344458_2423_2707 94
249 3300041506 Ga0451850_63564 Ga0451850_63564_228_512 94
250 3300041509 Ga0451843_0372412 Ga0451843_0372412_98_382 94
251 3300041512 Ga0451853_1266368 Ga0451853_1266368_11823_12107 94
252 3300041512 Ga0451853_1756466 Ga0451853_1756466_269_553 94
253 3300046683 Ga0495658_0132955 Ga0495658_0132955_1003_1305 94
254 3300047322 Ga0495680_0062109 Ga0495680_0062109_717_1019 94
255 3300049583 Ga0501067_0009930 Ga0501067_0009930_3690_3974 94
256 3300049584 Ga0501068_0314939 Ga0501068_0314939_46_330 94
257 3300049589 Ga0501073_0147160 Ga0501073_0147160_87_371 94
258 3300049593 Ga0501077_0109859 Ga0501077_0109859_864_1148 94
259 3300049742 Ga0501080_0710557 Ga0501080_0710557_46_342 94
260 3300050489 nmdc:mga03683_193661_c1 nmdc:mga03683_193661_c1_286_570 94
261 3300050491 nmdc:mga00v17_39504_c1 nmdc:mga00v17_39504_c1_415_699 94
262 3300050493 nmdc:mga0k408_18243_c1 nmdc:mga0k408_18243_c1_2246_2530 94
263 3300050493 nmdc:mga0k408_34669_c1 nmdc:mga0k408_34669_c1_657_941 94
264 3300059624 Ga0587109_053057 Ga0587109_053057_455_739 94
265 3300060353 Ga0501082_1479513 Ga0501082_1479513_203_499 94
266 3300003323 rootH1_10015554 rootH1_100155544 95
267 3300009098 Ga0105245_10002954 Ga0105245_1000295421 95
268 3300009174 Ga0105241_10003328 Ga0105241_100033286 95
269 3300014969 Ga0157376_10085510 Ga0157376_100855105 95
270 3300025911 Ga0207654_10005897 Ga0207654_100058976 95
271 3300025927 Ga0207687_10002323 Ga0207687_100023239 95
272 3300042004 Ga0439445_0049438 Ga0439445_0049438_817_1113 95
273 3300049128 Ga0501308_014383 Ga0501308_014383_370_663 95
274 3300049130 Ga0501310_034206 Ga0501310_034206_58_351 95
275 3300002863 Ga0006769J43182_106300 Ga0006769J43182_1063003 96
276 3300002872 Ga0006762J43184_109605 Ga0006762J43184_1096052 96
277 3300003163 Ga0006759J45824_1027396 Ga0006759J45824_10273963 96
278 3300003163 Ga0006759J45824_1037748 Ga0006759J45824_10377483 96
279 3300003163 Ga0006759J45824_1039453 Ga0006759J45824_10394533 96
280 3300003300 Ga0006758J48902_1009221 Ga0006758J48902_10092215 96
281 3300003300 Ga0006758J48902_1009222 Ga0006758J48902_10092224 96
282 3300003300 Ga0006758J48902_1012886 Ga0006758J48902_10128864 96
283 3300003300 Ga0006758J48902_1021124 Ga0006758J48902_10211241 96
284 3300003323 rootH1_10015553 rootH1_100155537 96
285 3300003693 Ga0032354_1123461 Ga0032354_11234611 96
286 3300004798 Ga0058859_11793010 Ga0058859_117930102 96
287 3300004801 Ga0058860_11423517 Ga0058860_114235171 96
288 3300005295 Ga0065707_11084460 Ga0065707_110844602 96
289 3300005329 Ga0070683_100241547 Ga0070683_1002415474 96
290 3300005330 Ga0070690_100558134 Ga0070690_1005581342 96
291 3300005331 Ga0070670_100337869 Ga0070670_1003378693 96
292 3300005333 Ga0070677_10024571 Ga0070677_100245712 96
293 3300005334 Ga0068869_101184256 Ga0068869_1011842562 96
294 3300005337 Ga0070682_100000787 Ga0070682_10000078723 96
295 3300005337 Ga0070682_100016985 Ga0070682_1000169854 96
296 3300005337 Ga0070682_100139853 Ga0070682_1001398534 96
297 3300005337 Ga0070682_101843434 Ga0070682_1018434342 96
298 3300005340 Ga0070689_100342599 Ga0070689_1003425992 96
299 3300005354 Ga0070675_100195961 Ga0070675_1001959612 96
300 3300005365 Ga0070688_100081462 Ga0070688_1000814623 96
301 3300005466 Ga0070685_10052930 Ga0070685_100529302 96
302 3300005466 Ga0070685_10858064 Ga0070685_108580642 96
303 3300005467 Ga0070706_100500942 Ga0070706_1005009422 96
304 3300005535 Ga0070684_100086123 Ga0070684_1000861233 96
305 3300005539 Ga0068853_102235865 Ga0068853_1022358651 96
306 3300005543 Ga0070672_100005856 Ga0070672_1000058564 96
307 3300005547 Ga0070693_100339727 Ga0070693_1003397272 96
308 3300005563 Ga0068855_100021979 Ga0068855_1000219799 96
309 3300005614 Ga0068856_100072939 Ga0068856_1000729394 96
310 3300005615 Ga0070702_101355678 Ga0070702_1013556781 96
311 3300005617 Ga0068859_102986625 Ga0068859_1029866251 96
312 3300005618 Ga0068864_100669070 Ga0068864_1006690703 96
313 3300005618 Ga0068864_101108396 Ga0068864_1011083962 96
314 3300005719 Ga0068861_100396217 Ga0068861_1003962173 96
315 3300005834 Ga0068851_10372549 Ga0068851_103725491 96
316 3300005841 Ga0068863_100015171 Ga0068863_1000151718 96
317 3300005842 Ga0068858_101347111 Ga0068858_1013471112 96
318 3300005844 Ga0068862_102095527 Ga0068862_1020955272 96
319 3300006177 Ga0075362_10271068 Ga0075362_102710682 96
320 3300006195 Ga0075366_10018157 Ga0075366_100181575 96
321 3300006358 Ga0068871_100313833 Ga0068871_1003138332 96
322 3300006358 Ga0068871_101231209 Ga0068871_1012312092 96
323 3300006931 Ga0097620_102985358 Ga0097620_1029853581 96
324 3300009093 Ga0105240_10368729 Ga0105240_103687292 96
325 3300009094 Ga0111539_11194141 Ga0111539_111941413 96
326 3300009176 Ga0105242_12189552 Ga0105242_121895522 96
327 3300009177 Ga0105248_12884117 Ga0105248_128841172 96
328 3300009545 Ga0105237_10569738 Ga0105237_105697383 96
329 3300009551 Ga0105238_10733151 Ga0105238_107331513 96
330 3300009551 Ga0105238_11509572 Ga0105238_115095722 96
331 3300010375 Ga0105239_10555629 Ga0105239_105556292 96
332 3300013104 Ga0157370_11379431 Ga0157370_113794312 96
333 3300013296 Ga0157374_10446050 Ga0157374_104460502 96
334 3300014325 Ga0163163_10668872 Ga0163163_106688723 96
335 3300014325 Ga0163163_11213366 Ga0163163_112133662 96
336 3300014326 Ga0157380_10316530 Ga0157380_103165303 96
337 3300014326 Ga0157380_12965027 Ga0157380_129650272 96
338 3300014969 Ga0157376_10282688 Ga0157376_102826884 96
339 3300014969 Ga0157376_10493542 Ga0157376_104935423 96
340 3300014969 Ga0157376_11171514 Ga0157376_111715142 96
341 3300017792 Ga0163161_10227494 Ga0163161_102274944 96
342 3300025893 Ga0207682_10011730 Ga0207682_100117304 96
343 3300025899 Ga0207642_11128329 Ga0207642_111283292 96
344 3300025914 Ga0207671_10619500 Ga0207671_106195002 96
345 3300025924 Ga0207694_11139312 Ga0207694_111393122 96
346 3300025926 Ga0207659_10240778 Ga0207659_102407782 96
347 3300025939 Ga0207665_10850556 Ga0207665_108505562 96
348 3300025940 Ga0207691_10036323 Ga0207691_100363238 96
349 3300025944 Ga0207661_10060988 Ga0207661_100609884 96
350 3300025949 Ga0207667_10000612 Ga0207667_1000061239 96
351 3300026041 Ga0207639_10992147 Ga0207639_109921472 96
352 3300026075 Ga0207708_11616581 Ga0207708_116165811 96
353 3300026078 Ga0207702_10040498 Ga0207702_100404985 96
354 3300026088 Ga0207641_10401323 Ga0207641_104013234 96
355 3300026095 Ga0207676_11130419 Ga0207676_111304192 96
356 3300026116 Ga0207674_10965093 Ga0207674_109650933 96
357 3300026118 Ga0207675_100181324 Ga0207675_1001813244 96
358 3300026118 Ga0207675_100768026 Ga0207675_1007680262 96
359 3300026121 Ga0207683_10802614 Ga0207683_108026142 96
360 3300026142 Ga0207698_12216058 Ga0207698_122160582 96
361 3300028794 Ga0307515_10202150 Ga0307515_102021506 96
362 3300028794 Ga0307515_10654784 Ga0307515_106547842 96
363 3300031456 Ga0307513_10090959 Ga0307513_100909592 96
364 3300031507 Ga0307509_10500318 Ga0307509_105003183 96
365 3300031616 Ga0307508_10050191 Ga0307508_100501913 96
366 3300031616 Ga0307508_10810175 Ga0307508_108101752 96
367 3300031730 Ga0307516_10003404 Ga0307516_1000340418 96
368 3300033541 Ga0316596_1123044 Ga0316596_11230442 96
369 3300035692 Ga0373935_0390479 Ga0373935_0390479_471_761 96
370 3300041441 Ga0451787_227323 Ga0451787_227323_228_518 96
371 3300041443 Ga0451789_0502497 Ga0451789_0502497_236_526 96
372 3300041452 Ga0451793_1893695 Ga0451793_1893695_143_433 96
373 3300041458 Ga0451798_0262246 Ga0451798_0262246_291_581 96
374 3300041458 Ga0451798_0874282 Ga0451798_0874282_748_1038 96
375 3300041486 Ga0451807_2271178 Ga0451807_2271178_116_406 96
376 3300041512 Ga0451853_2204238 Ga0451853_2204238_300_590 96
377 3300042004 Ga0439445_0049753 Ga0439445_0049753_155_445 96
378 3300044719 Ga0466971_0121247 Ga0466971_0121247_210_500 96
379 3300044901 Ga0466960_0030191 Ga0466960_0030191_1249_1539 96
380 3300045049 Ga0466959_0532825 Ga0466959_0532825_46_336 96
381 3300049127 Ga0501306_024178 Ga0501306_024178_362_652 96
382 3300049162 Ga0501307_006084 Ga0501307_006084_243_542 96
383 3300049162 Ga0501307_092382 Ga0501307_092382_170_460 96
384 3300049529 Ga0501313_049363 Ga0501313_049363_148_438 96
385 3300049530 Ga0501314_003556 Ga0501314_003556_138_428 96
386 3300049581 Ga0501047_0083068 Ga0501047_0083068_2510_2800 96
387 3300049586 Ga0501070_0345621 Ga0501070_0345621_597_887 96
388 3300049744 Ga0501083_0195843 Ga0501083_0195843_226_516 96
389 3300050493 nmdc:mga0k408_14443_c1 nmdc:mga0k408_14443_c1_2059_2349 96
390 3300053080 Ga0500635_0007996 Ga0500635_0007996_918_1208 96
391 3300053091 Ga0500647_0228163 Ga0500647_0228163_217_507 96
392 3300059477 Ga0587084_012826 Ga0587084_012826_223_513 96
393 3300003320 rootH2_10045491 rootH2_100454915 97
394 3300005337 Ga0070682_101237566 Ga0070682_1012375662 97
395 3300006195 Ga0075366_10009031 Ga0075366_100090314 97
396 3300014745 Ga0157377_10994466 Ga0157377_109944662 97
397 3300025911 Ga0207654_10519492 Ga0207654_105194922 97
398 3300045051 Ga0451576_0136068 Ga0451576_0136068_428_748 97
399 3300049578 Ga0501042_0376179 Ga0501042_0376179_387_707 97
400 3300049584 Ga0501068_0195360 Ga0501068_0195360_356_676 97
401 3300049587 Ga0501071_0018420 Ga0501071_0018420_2353_2673 97
402 3300049588 Ga0501072_0824832 Ga0501072_0824832_71_391 97
403 3300049741 Ga0501079_0593202 Ga0501079_0593202_227_547 97
404 3300049742 Ga0501080_0088773 Ga0501080_0088773_1787_2107 97
405 3300049743 Ga0501081_1564162 Ga0501081_1564162_131_451 97
406 3300050493 nmdc:mga0k408_23012_c1 nmdc:mga0k408_23012_c1_1909_2223 97
407 3300002863 Ga0006769J43182_104289 Ga0006769J43182_1042894 98
408 3300002865 Ga0006761J43178_107109 Ga0006761J43178_1071092 98
409 3300002870 Ga0006763J43179_108456 Ga0006763J43179_1084563 98
410 3300003161 Ga0006765J45826_111039 Ga0006765J45826_1110393 98
411 3300003163 Ga0006759J45824_1029961 Ga0006759J45824_10299615 98
412 3300003300 Ga0006758J48902_1009598 Ga0006758J48902_10095985 98
413 3300003305 Ga0006770J48903_1016726 Ga0006770J48903_10167265 98
414 3300003693 Ga0032354_1050569 Ga0032354_10505693 98
415 3300004798 Ga0058859_11666696 Ga0058859_116666962 98
416 3300005276 Ga0065717_1013978 Ga0065717_10139781 98
417 3300005444 Ga0070694_100586888 Ga0070694_1005868882 98
418 3300005563 Ga0068855_100000266 Ga0068855_10000026639 98
419 3300005577 Ga0068857_101054500 Ga0068857_1010545003 98
420 3300014968 Ga0157379_11984428 Ga0157379_119844281 98
421 3300020078 Ga0206352_10383322 Ga0206352_103833222 98
422 3300025949 Ga0207667_10003431 Ga0207667_1000343113 98
423 3300028380 Ga0268265_11308794 Ga0268265_113087942 98
424 3300031456 Ga0307513_10667955 Ga0307513_106679553 98
425 3300031507 Ga0307509_10843681 Ga0307509_108436812 98
426 3300032005 Ga0307411_11320669 Ga0307411_113206692 98
427 3300041441 Ga0451787_430695 Ga0451787_430695_2165_2461 98
428 3300041443 Ga0451789_0934748 Ga0451789_0934748_163_459 98
429 3300041446 Ga0451794_07065 Ga0451794_07065_343_639 98
430 3300041453 Ga0451797_0895524 Ga0451797_0895524_86_382 98
431 3300041459 Ga0451800_0558223 Ga0451800_0558223_865_1161 98
432 3300041463 Ga0451804_0599107 Ga0451804_0599107_135_431 98
433 3300041463 Ga0451804_0747749 Ga0451804_0747749_67_363 98
434 3300041464 Ga0451808_33157 Ga0451808_33157_269_565 98
435 3300041486 Ga0451807_0978842 Ga0451807_0978842_206_502 98
436 3300041505 Ga0451849_0111712 Ga0451849_0111712_57_353 98
437 3300041507 Ga0451851_0850392 Ga0451851_0850392_124_420 98
438 3300041512 Ga0451853_3977348 Ga0451853_3977348_761_1057 98
439 3300049127 Ga0501306_041246 Ga0501306_041246_116_412 98
440 3300049128 Ga0501308_011068 Ga0501308_011068_587_883 98
441 3300049129 Ga0501309_038483 Ga0501309_038483_236_541 98
442 3300049130 Ga0501310_010584 Ga0501310_010584_262_558 98
443 3300049130 Ga0501310_015014 Ga0501310_015014_382_678 98
444 3300049161 Ga0501305_018599 Ga0501305_018599_566_862 98
445 3300049161 Ga0501305_023035 Ga0501305_023035_237_533 98
446 3300049162 Ga0501307_008393 Ga0501307_008393_686_982 98
447 3300049513 Ga0501290_061926 Ga0501290_061926_248_544 98
448 3300049515 Ga0501292_132493 Ga0501292_132493_185_481 98
449 3300049517 Ga0501294_017782 Ga0501294_017782_229_525 98
450 3300049522 Ga0501299_094957 Ga0501299_094957_48_344 98
451 3300049527 Ga0501311_012757 Ga0501311_012757_333_629 98
452 3300049529 Ga0501313_005318 Ga0501313_005318_552_848 98
453 3300049530 Ga0501314_013384 Ga0501314_013384_140_436 98
454 3300049531 Ga0501315_079563 Ga0501315_079563_237_533 98
455 3300049542 Ga0501326_05426 Ga0501326_05426_198_494 98
456 3300049556 Ga0501340_025543 Ga0501340_025543_80_376 98
457 3300049650 Ga0501199_030610 Ga0501199_030610_25_321 98
458 3300049657 Ga0501210_027006 Ga0501210_027006_215_511 98
459 3300049662 Ga0501222_048189 Ga0501222_048189_270_566 98
460 3300049674 Ga0501242_075069 Ga0501242_075069_183_479 98
461 3300049676 Ga0501246_026919 Ga0501246_026919_100_396 98
462 3300049683 Ga0501253_058867 Ga0501253_058867_248_544 98
463 3300049689 Ga0501260_053820 Ga0501260_053820_85_381 98
464 3300049704 Ga0501221_228627 Ga0501221_228627_61_357 98
465 3300049705 Ga0501225_0037033 Ga0501225_0037033_990_1286 98
466 3300049762 Ga0501265_049455 Ga0501265_049455_350_646 98
467 3300050493 nmdc:mga0k408_3991_c1 nmdc:mga0k408_3991_c1_7356_7673 98
468 3300050493 nmdc:mga0k408_598713_c1 nmdc:mga0k408_598713_c1_276_572 98
469 3300050511 nmdc:mga08y16_596915_c1 nmdc:mga08y16_596915_c1_79_390 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

19

86

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4w-assembly1.cif.gz_AQ structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.964 15 90
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.9621 13 88
8fmw-assembly1.cif.gz_Q the structure of a hibernating ribosome in the lyme disease pathogen 0.9594 12 91
1n36-assembly1.cif.gz_Q structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position 0.958 13 91
4v8c-assembly1.cif.gz_CT crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.9569 13 89
ID Description Score Start End Superfamily
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9588 15 91 2.40.50.140
3ms0Q00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9577 13 90 2.40.50.140
af_Q9LHN1_1_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9523 15 91 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9471 13 89 2.40.50.140
af_Q2FW15_6_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.941 13 91 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A662D8U8-F1-model_v4 Small ribosomal subunit protein uS17 0.9759 13 93 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7C2LTV3-F1-model_v4 Small ribosomal subunit protein uS17 0.9703 13 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A523V837-F1-model_v4 Small ribosomal subunit protein uS17 0.9693 14 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7X3Y523-F1-model_v4 Small ribosomal subunit protein uS17 0.9684 14 95 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A6B1HF68-F1-model_v4 Small ribosomal subunit protein uS17 0.968 15 95 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
84.35 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map