F450165
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 290 | 469 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10045491|rootH2_100454915 |
| Length | 109 |
| Sequence | VSAEPQEGQSPVYRRRLIGRVASDKMDKTVVVEVVRFKRDAVYKKYVRVRKRYHAHDEKNEYKTGDRVEIIEHRPLSRQKRWAVTRLIARPATELVGGHVEAAQKAAEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 207 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 214 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 220 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 244 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 246 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 247 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 267 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 269 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 270 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 272 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 284 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.27 |
| Metatranscriptomes | 11.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0 |
| Rhizoplane | 5.33 |
| Rhizosphere | 84.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006769J43182_104289 | 3300002863 | Bacteria | 1186 |
| 2 | Ga0006769J43182_106300 | 3300002863 | Bacteria | 758 |
| 3 | Ga0006761J43178_107109 | 3300002865 | Bacteria | 508 |
| 4 | Ga0006763J43179_108456 | 3300002870 | Bacteria | 665 |
| 5 | Ga0006762J43184_109605 | 3300002872 | Unclassified | 610 |
| 6 | Ga0006765J45826_111039 | 3300003161 | Bacteria | 1101 |
| 7 | Ga0006759J45824_1027396 | 3300003163 | Bacteria | 1543 |
| 8 | Ga0006759J45824_1029961 | 3300003163 | Bacteria | 6330 |
| 9 | Ga0006759J45824_1037748 | 3300003163 | Bacteria | 1087 |
| 10 | Ga0006759J45824_1039453 | 3300003163 | Bacteria | 2123 |
| 11 | Ga0006758J48902_1009221 | 3300003300 | Bacteria | 1961 |
| 12 | Ga0006758J48902_1009222 | 3300003300 | Bacteria | 1430 |
| 13 | Ga0006758J48902_1009598 | 3300003300 | Bacteria | 4274 |
| 14 | Ga0006758J48902_1012886 | 3300003300 | Bacteria | 2834 |
| 15 | Ga0006758J48902_1021124 | 3300003300 | Bacteria | 508 |
| 16 | Ga0006770J48903_1016726 | 3300003305 | Bacteria | 2195 |
| 17 | rootH2_10045491 | 3300003320 | Bacteria | 3605 |
| 18 | rootH1_10015553 | 3300003323 | Bacteria | 3043 |
| 19 | rootH1_10015554 | 3300003323 | Bacteria | 1679 |
| 20 | Ga0032354_1050569 | 3300003693 | Bacteria | 911 |
| 21 | Ga0032354_1123461 | 3300003693 | Bacteria | 549 |
| 22 | Ga0006766_120163 | 3300003717 | Bacteria | 664 |
| 23 | Ga0058859_11363661 | 3300004798 | Bacteria | 639 |
| 24 | Ga0058859_11666696 | 3300004798 | Bacteria | 530 |
| 25 | Ga0058859_11793010 | 3300004798 | Bacteria | 1259 |
| 26 | Ga0058860_11423517 | 3300004801 | Bacteria | 555 |
| 27 | Ga0058860_12230108 | 3300004801 | Bacteria | 926 |
| 28 | Ga0065717_1013978 | 3300005276 | Bacteria | 546 |
| 29 | Ga0065707_11084460 | 3300005295 | Bacteria | 519 |
| 30 | Ga0070676_10018293 | 3300005328 | Bacteria | 3881 |
| 31 | Ga0070683_100241547 | 3300005329 | Bacteria | 1718 |
| 32 | Ga0070683_100803732 | 3300005329 | Bacteria | 902 |
| 33 | Ga0070683_102191005 | 3300005329 | Bacteria | 530 |
| 34 | Ga0070690_100558134 | 3300005330 | Bacteria | 864 |
| 35 | Ga0070690_100664315 | 3300005330 | Bacteria | 797 |
| 36 | Ga0070670_100337869 | 3300005331 | Bacteria | 1322 |
| 37 | Ga0070677_10024571 | 3300005333 | Bacteria | 2242 |
| 38 | Ga0070677_10081789 | 3300005333 | Bacteria | 1383 |
| 39 | Ga0068869_100050185 | 3300005334 | Bacteria | 3023 |
| 40 | Ga0068869_101184256 | 3300005334 | Bacteria | 671 |
| 41 | Ga0070680_100354549 | 3300005336 | Bacteria | 1248 |
| 42 | Ga0070682_100000787 | 3300005337 | Bacteria | 18636 |
| 43 | Ga0070682_100016985 | 3300005337 | Bacteria | 4237 |
| 44 | Ga0070682_100139853 | 3300005337 | Bacteria | 1649 |
| 45 | Ga0070682_101237566 | 3300005337 | Bacteria | 632 |
| 46 | Ga0070682_101649650 | 3300005337 | Bacteria | 556 |
| 47 | Ga0070682_101693088 | 3300005337 | Bacteria | 549 |
| 48 | Ga0070682_101843434 | 3300005337 | Bacteria | 529 |
| 49 | Ga0068868_100160818 | 3300005338 | Bacteria | 1854 |
| 50 | Ga0068868_100923284 | 3300005338 | Bacteria | 794 |
| 51 | Ga0070660_100406772 | 3300005339 | Bacteria | 1126 |
| 52 | Ga0070689_100068193 | 3300005340 | Bacteria | 2774 |
| 53 | Ga0070689_100124190 | 3300005340 | Bacteria | 2064 |
| 54 | Ga0070689_100342599 | 3300005340 | Bacteria | 1252 |
| 55 | Ga0070689_100688822 | 3300005340 | Bacteria | 892 |
| 56 | Ga0070691_10060647 | 3300005341 | Bacteria | 1819 |
| 57 | Ga0070687_101406173 | 3300005343 | Bacteria | 522 |
| 58 | Ga0070692_10149633 | 3300005345 | Bacteria | 1328 |
| 59 | Ga0070668_100028739 | 3300005347 | Bacteria | 4219 |
| 60 | Ga0070669_100025363 | 3300005353 | Bacteria | 4257 |
| 61 | Ga0070675_100183980 | 3300005354 | Bacteria | 1808 |
| 62 | Ga0070675_100195961 | 3300005354 | Bacteria | 1752 |
| 63 | Ga0070675_100318549 | 3300005354 | Bacteria | 1373 |
| 64 | Ga0070671_100191826 | 3300005355 | Bacteria | 1732 |
| 65 | Ga0070674_100007457 | 3300005356 | Bacteria | 6453 |
| 66 | Ga0070674_100367453 | 3300005356 | Bacteria | 1167 |
| 67 | Ga0070673_100051191 | 3300005364 | Bacteria | 3232 |
| 68 | Ga0070673_100071173 | 3300005364 | Bacteria | 2793 |
| 69 | Ga0070673_100677707 | 3300005364 | Bacteria | 945 |
| 70 | Ga0070688_100081462 | 3300005365 | Bacteria | 2096 |
| 71 | Ga0070688_100426728 | 3300005365 | Bacteria | 986 |
| 72 | Ga0070688_100874058 | 3300005365 | Bacteria | 707 |
| 73 | Ga0070659_100169875 | 3300005366 | Bacteria | 1786 |
| 74 | Ga0070713_101097969 | 3300005436 | Bacteria | 769 |
| 75 | Ga0070701_10085332 | 3300005438 | Bacteria | 1719 |
| 76 | Ga0070705_100852754 | 3300005440 | Bacteria | 729 |
| 77 | Ga0070700_100727749 | 3300005441 | Bacteria | 792 |
| 78 | Ga0070694_100586888 | 3300005444 | Bacteria | 896 |
| 79 | Ga0070663_100466825 | 3300005455 | Bacteria | 1043 |
| 80 | Ga0070678_100804705 | 3300005456 | Bacteria | 854 |
| 81 | Ga0070662_100093375 | 3300005457 | Bacteria | 2263 |
| 82 | Ga0070681_10212292 | 3300005458 | Bacteria | 1851 |
| 83 | Ga0070681_11003005 | 3300005458 | Bacteria | 755 |
| 84 | Ga0068867_100016292 | 3300005459 | Bacteria | 5278 |
| 85 | Ga0070685_10052930 | 3300005466 | Bacteria | 2350 |
| 86 | Ga0070685_10088782 | 3300005466 | Bacteria | 1867 |
| 87 | Ga0070685_10603653 | 3300005466 | Bacteria | 790 |
| 88 | Ga0070685_10858064 | 3300005466 | Bacteria | 673 |
| 89 | Ga0070685_11045815 | 3300005466 | Bacteria | 614 |
| 90 | Ga0070706_100500942 | 3300005467 | Bacteria | 1130 |
| 91 | Ga0070684_100086123 | 3300005535 | Bacteria | 2788 |
| 92 | Ga0070684_100501115 | 3300005535 | Bacteria | 1125 |
| 93 | Ga0070684_101318129 | 3300005535 | Bacteria | 680 |
| 94 | Ga0068853_100558747 | 3300005539 | Bacteria | 1085 |
| 95 | Ga0068853_100622443 | 3300005539 | Bacteria | 1026 |
| 96 | Ga0068853_102207948 | 3300005539 | Bacteria | 534 |
| 97 | Ga0068853_102235865 | 3300005539 | Bacteria | 530 |
| 98 | Ga0070672_100005856 | 3300005543 | Bacteria | 8198 |
| 99 | Ga0070672_100074196 | 3300005543 | Bacteria | 2713 |
| 100 | Ga0070672_100083257 | 3300005543 | Bacteria | 2567 |
| 101 | Ga0070672_100188208 | 3300005543 | Bacteria | 1722 |
| 102 | Ga0070672_100189079 | 3300005543 | Bacteria | 1718 |
| 103 | Ga0070686_100022242 | 3300005544 | Bacteria | 3774 |
| 104 | Ga0070686_101267123 | 3300005544 | Bacteria | 614 |
| 105 | Ga0070695_100147012 | 3300005545 | Bacteria | 1641 |
| 106 | Ga0070693_100339727 | 3300005547 | Bacteria | 1024 |
| 107 | Ga0070665_100826267 | 3300005548 | Bacteria | 940 |
| 108 | Ga0070665_101890826 | 3300005548 | Bacteria | 603 |
| 109 | Ga0070704_100408103 | 3300005549 | Bacteria | 1161 |
| 110 | Ga0068855_100000266 | 3300005563 | Bacteria | 65127 |
| 111 | Ga0068855_100021979 | 3300005563 | Bacteria | 7648 |
| 112 | Ga0070664_100697310 | 3300005564 | Bacteria | 946 |
| 113 | Ga0068857_101054500 | 3300005577 | Bacteria | 784 |
| 114 | Ga0068857_101060227 | 3300005577 | Bacteria | 782 |
| 115 | Ga0068854_100126246 | 3300005578 | Bacteria | 1949 |
| 116 | Ga0068856_100072939 | 3300005614 | Bacteria | 3399 |
| 117 | Ga0068856_100711535 | 3300005614 | Bacteria | 1024 |
| 118 | Ga0070702_101355678 | 3300005615 | Bacteria | 580 |
| 119 | Ga0068859_100995658 | 3300005617 | Bacteria | 920 |
| 120 | Ga0068859_102986625 | 3300005617 | Bacteria | 517 |
| 121 | Ga0068864_100669070 | 3300005618 | Bacteria | 1012 |
| 122 | Ga0068864_101108396 | 3300005618 | Bacteria | 788 |
| 123 | Ga0068866_10091912 | 3300005718 | Bacteria | 1654 |
| 124 | Ga0068866_10396743 | 3300005718 | Bacteria | 889 |
| 125 | Ga0068861_100396217 | 3300005719 | Bacteria | 1224 |
| 126 | Ga0068861_100457060 | 3300005719 | Bacteria | 1145 |
| 127 | Ga0068851_10372549 | 3300005834 | Bacteria | 835 |
| 128 | Ga0068851_10718012 | 3300005834 | Bacteria | 616 |
| 129 | Ga0068851_10760925 | 3300005834 | Bacteria | 600 |
| 130 | Ga0068870_10768276 | 3300005840 | Bacteria | 671 |
| 131 | Ga0068863_100015171 | 3300005841 | Bacteria | 7402 |
| 132 | Ga0068863_101710820 | 3300005841 | Bacteria | 639 |
| 133 | Ga0068858_100295540 | 3300005842 | Bacteria | 1544 |
| 134 | Ga0068858_101347111 | 3300005842 | Bacteria | 703 |
| 135 | Ga0068862_100091874 | 3300005844 | Bacteria | 2644 |
| 136 | Ga0068862_102095527 | 3300005844 | Bacteria | 577 |
| 137 | Ga0081455_10537061 | 3300005937 | Bacteria | 776 |
| 138 | Ga0070715_10425876 | 3300006163 | Bacteria | 744 |
| 139 | Ga0070716_101720011 | 3300006173 | Bacteria | 518 |
| 140 | Ga0070712_101578029 | 3300006175 | Bacteria | 574 |
| 141 | Ga0075362_10218353 | 3300006177 | Bacteria | 931 |
| 142 | Ga0075362_10271068 | 3300006177 | Bacteria | 838 |
| 143 | Ga0075366_10009031 | 3300006195 | Bacteria | 5559 |
| 144 | Ga0075366_10018157 | 3300006195 | Bacteria | 4061 |
| 145 | Ga0075366_10081289 | 3300006195 | Bacteria | 1935 |
| 146 | Ga0075366_10517867 | 3300006195 | Bacteria | 738 |
| 147 | Ga0068871_100286387 | 3300006358 | Bacteria | 1442 |
| 148 | Ga0068871_100313833 | 3300006358 | Bacteria | 1379 |
| 149 | Ga0068871_101231209 | 3300006358 | Bacteria | 703 |
| 150 | Ga0075430_100286181 | 3300006846 | Bacteria | 1364 |
| 151 | Ga0075430_101138474 | 3300006846 | Bacteria | 643 |
| 152 | Ga0075431_101875986 | 3300006847 | Bacteria | 555 |
| 153 | Ga0075429_100717589 | 3300006880 | Bacteria | 876 |
| 154 | Ga0068865_100759355 | 3300006881 | Bacteria | 833 |
| 155 | Ga0075436_100799513 | 3300006914 | Bacteria | 702 |
| 156 | Ga0097620_100995693 | 3300006931 | Bacteria | 920 |
| 157 | Ga0097620_102985358 | 3300006931 | Bacteria | 517 |
| 158 | Ga0105240_10368729 | 3300009093 | Bacteria | 1624 |
| 159 | Ga0111539_11194141 | 3300009094 | Bacteria | 884 |
| 160 | Ga0105245_10002954 | 3300009098 | Bacteria | 15251 |
| 161 | Ga0105247_11152370 | 3300009101 | Bacteria | 615 |
| 162 | Ga0114129_12226119 | 3300009147 | Bacteria | 659 |
| 163 | Ga0105243_10918606 | 3300009148 | Bacteria | 872 |
| 164 | Ga0105241_10003328 | 3300009174 | Bacteria | 11959 |
| 165 | Ga0105241_12563013 | 3300009174 | Bacteria | 511 |
| 166 | Ga0105242_12189552 | 3300009176 | Bacteria | 598 |
| 167 | Ga0105248_12884117 | 3300009177 | Bacteria | 548 |
| 168 | Ga0105237_10569738 | 3300009545 | Bacteria | 1139 |
| 169 | Ga0105238_10733151 | 3300009551 | Bacteria | 1001 |
| 170 | Ga0105238_11509572 | 3300009551 | Bacteria | 701 |
| 171 | Ga0105249_11897303 | 3300009553 | Bacteria | 668 |
| 172 | Ga0105239_10555629 | 3300010375 | Bacteria | 1307 |
| 173 | Ga0105246_11461753 | 3300011119 | Bacteria | 640 |
| 174 | Ga0157371_11252600 | 3300013102 | Bacteria | 573 |
| 175 | Ga0157370_11379431 | 3300013104 | Bacteria | 634 |
| 176 | Ga0157374_10039567 | 3300013296 | Bacteria | 4339 |
| 177 | Ga0157374_10446050 | 3300013296 | Bacteria | 1295 |
| 178 | Ga0157375_10379526 | 3300013308 | Bacteria | 1580 |
| 179 | Ga0163163_10668872 | 3300014325 | Bacteria | 1102 |
| 180 | Ga0163163_11213366 | 3300014325 | Bacteria | 817 |
| 181 | Ga0157380_10316530 | 3300014326 | Bacteria | 1445 |
| 182 | Ga0157380_12892543 | 3300014326 | Bacteria | 546 |
| 183 | Ga0157380_12965027 | 3300014326 | Unclassified | 540 |
| 184 | Ga0157377_10994466 | 3300014745 | Bacteria | 635 |
| 185 | Ga0157377_11055316 | 3300014745 | Bacteria | 619 |
| 186 | Ga0157377_11673329 | 3300014745 | Bacteria | 512 |
| 187 | Ga0157379_10549618 | 3300014968 | Bacteria | 1074 |
| 188 | Ga0157379_11984428 | 3300014968 | Bacteria | 575 |
| 189 | Ga0157376_10085510 | 3300014969 | Bacteria | 2718 |
| 190 | Ga0157376_10282688 | 3300014969 | Bacteria | 1563 |
| 191 | Ga0157376_10493542 | 3300014969 | Bacteria | 1202 |
| 192 | Ga0157376_10865049 | 3300014969 | Bacteria | 920 |
| 193 | Ga0157376_11171514 | 3300014969 | Bacteria | 796 |
| 194 | Ga0163161_10227494 | 3300017792 | Bacteria | 1446 |
| 195 | Ga0206352_10383322 | 3300020078 | Bacteria | 825 |
| 196 | Ga0213876_10573324 | 3300021384 | Bacteria | 600 |
| 197 | Ga0207666_1001625 | 3300025271 | Bacteria | 2664 |
| 198 | Ga0207697_10348596 | 3300025315 | Bacteria | 657 |
| 199 | Ga0207656_10455330 | 3300025321 | Bacteria | 647 |
| 200 | Ga0207682_10011730 | 3300025893 | Bacteria | 3424 |
| 201 | Ga0207682_10143047 | 3300025893 | Bacteria | 1074 |
| 202 | Ga0207642_10677187 | 3300025899 | Bacteria | 648 |
| 203 | Ga0207642_11128329 | 3300025899 | Bacteria | 507 |
| 204 | Ga0207688_10186585 | 3300025901 | Bacteria | 1239 |
| 205 | Ga0207680_10374993 | 3300025903 | Bacteria | 1002 |
| 206 | Ga0207647_10118635 | 3300025904 | Bacteria | 1561 |
| 207 | Ga0207685_10737060 | 3300025905 | Bacteria | 539 |
| 208 | Ga0207699_10740975 | 3300025906 | Bacteria | 721 |
| 209 | Ga0207645_10021058 | 3300025907 | Bacteria | 4257 |
| 210 | Ga0207645_11054841 | 3300025907 | Bacteria | 549 |
| 211 | Ga0207643_10206890 | 3300025908 | Bacteria | 1197 |
| 212 | Ga0207654_10005897 | 3300025911 | Bacteria | 6169 |
| 213 | Ga0207654_10519492 | 3300025911 | Bacteria | 843 |
| 214 | Ga0207707_10070280 | 3300025912 | Bacteria | 3051 |
| 215 | Ga0207707_10755366 | 3300025912 | Bacteria | 813 |
| 216 | Ga0207671_10619500 | 3300025914 | Bacteria | 862 |
| 217 | Ga0207662_10086791 | 3300025918 | Bacteria | 1918 |
| 218 | Ga0207657_10653070 | 3300025919 | Bacteria | 819 |
| 219 | Ga0207681_10002742 | 3300025923 | Bacteria | 11146 |
| 220 | Ga0207694_10176365 | 3300025924 | Bacteria | 1732 |
| 221 | Ga0207694_11139312 | 3300025924 | Bacteria | 660 |
| 222 | Ga0207650_10048909 | 3300025925 | Bacteria | 3120 |
| 223 | Ga0207659_10240778 | 3300025926 | Bacteria | 1463 |
| 224 | Ga0207659_10385428 | 3300025926 | Bacteria | 1169 |
| 225 | Ga0207659_10403812 | 3300025926 | Bacteria | 1143 |
| 226 | Ga0207687_10002323 | 3300025927 | Bacteria | 12949 |
| 227 | Ga0207700_10425332 | 3300025928 | Bacteria | 1167 |
| 228 | Ga0207644_10055836 | 3300025931 | Bacteria | 2848 |
| 229 | Ga0207690_10136438 | 3300025932 | Bacteria | 1802 |
| 230 | Ga0207706_10091565 | 3300025933 | Bacteria | 2673 |
| 231 | Ga0207686_11087414 | 3300025934 | Bacteria | 651 |
| 232 | Ga0207709_10210974 | 3300025935 | Bacteria | 1394 |
| 233 | Ga0207670_10150696 | 3300025936 | Bacteria | 1725 |
| 234 | Ga0207670_10156318 | 3300025936 | Bacteria | 1698 |
| 235 | Ga0207669_10672618 | 3300025937 | Bacteria | 848 |
| 236 | Ga0207704_10003857 | 3300025938 | Bacteria | 6810 |
| 237 | Ga0207704_10765814 | 3300025938 | Bacteria | 804 |
| 238 | Ga0207665_10850556 | 3300025939 | Bacteria | 722 |
| 239 | Ga0207665_11452521 | 3300025939 | Bacteria | 545 |
| 240 | Ga0207691_10036323 | 3300025940 | Bacteria | 4565 |
| 241 | Ga0207691_10204635 | 3300025940 | Bacteria | 1717 |
| 242 | Ga0207691_10289454 | 3300025940 | Bacteria | 1409 |
| 243 | Ga0207691_10713868 | 3300025940 | Bacteria | 845 |
| 244 | Ga0207691_10727844 | 3300025940 | Bacteria | 836 |
| 245 | Ga0207711_12046003 | 3300025941 | Unclassified | 515 |
| 246 | Ga0207689_10065221 | 3300025942 | Bacteria | 2996 |
| 247 | Ga0207689_11284890 | 3300025942 | Bacteria | 615 |
| 248 | Ga0207661_10060988 | 3300025944 | Bacteria | 3046 |
| 249 | Ga0207661_10082186 | 3300025944 | Bacteria | 2663 |
| 250 | Ga0207679_10286525 | 3300025945 | Bacteria | 1414 |
| 251 | Ga0207667_10000612 | 3300025949 | Bacteria | 46149 |
| 252 | Ga0207667_10003431 | 3300025949 | Bacteria | 19566 |
| 253 | Ga0207651_10007125 | 3300025960 | Bacteria | 5937 |
| 254 | Ga0207651_10064605 | 3300025960 | Bacteria | 2562 |
| 255 | Ga0207651_10855995 | 3300025960 | Bacteria | 808 |
| 256 | Ga0207651_11357292 | 3300025960 | Bacteria | 639 |
| 257 | Ga0207668_10693369 | 3300025972 | Bacteria | 894 |
| 258 | Ga0207640_10323909 | 3300025981 | Bacteria | 1228 |
| 259 | Ga0207658_10392774 | 3300025986 | Bacteria | 1217 |
| 260 | Ga0207677_10291313 | 3300026023 | Bacteria | 1345 |
| 261 | Ga0207703_10316451 | 3300026035 | Bacteria | 1428 |
| 262 | Ga0207703_11834217 | 3300026035 | Bacteria | 582 |
| 263 | Ga0207639_10047593 | 3300026041 | Bacteria | 3242 |
| 264 | Ga0207639_10492689 | 3300026041 | Bacteria | 1118 |
| 265 | Ga0207639_10992147 | 3300026041 | Bacteria | 786 |
| 266 | Ga0207678_10677898 | 3300026067 | Bacteria | 906 |
| 267 | Ga0207678_11178814 | 3300026067 | Bacteria | 678 |
| 268 | Ga0207708_10012451 | 3300026075 | Bacteria | 6340 |
| 269 | Ga0207708_10057952 | 3300026075 | Bacteria | 2955 |
| 270 | Ga0207708_11336648 | 3300026075 | Bacteria | 628 |
| 271 | Ga0207708_11616581 | 3300026075 | Unclassified | 569 |
| 272 | Ga0207702_10040498 | 3300026078 | Bacteria | 3906 |
| 273 | Ga0207702_10182964 | 3300026078 | Bacteria | 1931 |
| 274 | Ga0207702_10439820 | 3300026078 | Bacteria | 1264 |
| 275 | Ga0207641_10401323 | 3300026088 | Bacteria | 1316 |
| 276 | Ga0207641_11554345 | 3300026088 | Bacteria | 663 |
| 277 | Ga0207648_10011154 | 3300026089 | Bacteria | 8479 |
| 278 | Ga0207676_10514073 | 3300026095 | Bacteria | 1139 |
| 279 | Ga0207676_11130419 | 3300026095 | Bacteria | 775 |
| 280 | Ga0207674_10860911 | 3300026116 | Bacteria | 874 |
| 281 | Ga0207674_10965093 | 3300026116 | Bacteria | 821 |
| 282 | Ga0207675_100013850 | 3300026118 | Bacteria | 7520 |
| 283 | Ga0207675_100181324 | 3300026118 | Bacteria | 2016 |
| 284 | Ga0207675_100768026 | 3300026118 | Bacteria | 976 |
| 285 | Ga0207675_101074241 | 3300026118 | Bacteria | 824 |
| 286 | Ga0207683_10259086 | 3300026121 | Bacteria | 1588 |
| 287 | Ga0207683_10512688 | 3300026121 | Bacteria | 1108 |
| 288 | Ga0207683_10802614 | 3300026121 | Bacteria | 873 |
| 289 | Ga0207698_10903638 | 3300026142 | Bacteria | 890 |
| 290 | Ga0207698_12216058 | 3300026142 | Bacteria | 562 |
| 291 | Ga0209998_10004948 | 3300027717 | Bacteria | 2802 |
| 292 | Ga0207428_10017611 | 3300027907 | Bacteria | 6126 |
| 293 | Ga0268266_10962908 | 3300028379 | Bacteria | 826 |
| 294 | Ga0268266_11956922 | 3300028379 | Bacteria | 560 |
| 295 | Ga0268265_10034866 | 3300028380 | Bacteria | 3671 |
| 296 | Ga0268265_11308794 | 3300028380 | Bacteria | 725 |
| 297 | Ga0268264_10136493 | 3300028381 | Bacteria | 2181 |
| 298 | Ga0265337_1001901 | 3300028556 | Bacteria | 9942 |
| 299 | Ga0265319_1060122 | 3300028563 | Bacteria | 1234 |
| 300 | Ga0265334_10001615 | 3300028573 | Bacteria | 10823 |
| 301 | Ga0265336_10076203 | 3300028666 | Bacteria | 1002 |
| 302 | Ga0307515_10202150 | 3300028794 | Bacteria | 1859 |
| 303 | Ga0307515_10654784 | 3300028794 | Bacteria | 663 |
| 304 | Ga0265338_10382558 | 3300028800 | Bacteria | 1006 |
| 305 | Ga0265332_10084104 | 3300031238 | Bacteria | 1349 |
| 306 | Ga0265332_10155677 | 3300031238 | Bacteria | 955 |
| 307 | Ga0265320_10001512 | 3300031240 | Bacteria | 16930 |
| 308 | Ga0265325_10118345 | 3300031241 | Bacteria | 1280 |
| 309 | Ga0265340_10015118 | 3300031247 | Bacteria | 4016 |
| 310 | Ga0265339_10055328 | 3300031249 | Bacteria | 2153 |
| 311 | Ga0307513_10090959 | 3300031456 | Bacteria | 3111 |
| 312 | Ga0307513_10667955 | 3300031456 | Bacteria | 746 |
| 313 | Ga0307509_10500318 | 3300031507 | Bacteria | 900 |
| 314 | Ga0307509_10843681 | 3300031507 | Bacteria | 581 |
| 315 | Ga0307508_10050191 | 3300031616 | Bacteria | 3713 |
| 316 | Ga0307508_10810175 | 3300031616 | Bacteria | 554 |
| 317 | Ga0265314_10276656 | 3300031711 | Bacteria | 951 |
| 318 | Ga0307516_10003404 | 3300031730 | Bacteria | 20479 |
| 319 | Ga0307412_11226029 | 3300031911 | Bacteria | 673 |
| 320 | Ga0307411_11306245 | 3300032005 | Bacteria | 661 |
| 321 | Ga0307411_11320669 | 3300032005 | Bacteria | 658 |
| 322 | Ga0316592_1113147 | 3300033524 | Unclassified | 628 |
| 323 | Ga0316588_1150386 | 3300033528 | Bacteria | 597 |
| 324 | Ga0316596_1123044 | 3300033541 | Bacteria | 707 |
| 325 | Ga0373958_0009873 | 3300034819 | Bacteria | 1581 |
| 326 | Ga0373926_0037278 | 3300035083 | Bacteria | 1729 |
| 327 | Ga0373929_0185126 | 3300035085 | Bacteria | 576 |
| 328 | Ga0373945_0138113 | 3300035116 | Bacteria | 981 |
| 329 | Ga0373943_0011073 | 3300035170 | Bacteria | 4051 |
| 330 | Ga0373935_0390479 | 3300035692 | Bacteria | 998 |
| 331 | Ga0373927_0161417 | 3300035695 | Bacteria | 1468 |
| 332 | Ga0373933_0762442 | 3300035724 | Bacteria | 637 |
| 333 | Ga0373937_0408129 | 3300036401 | Bacteria | 1289 |
| 334 | Ga0373937_1251706 | 3300036401 | Bacteria | 690 |
| 335 | Ga0436365_1839659 | 3300039437 | Bacteria | 4011 |
| 336 | Ga0451787_227323 | 3300041441 | Bacteria | 658 |
| 337 | Ga0451787_430695 | 3300041441 | Bacteria | 2872 |
| 338 | Ga0451789_0502497 | 3300041443 | Bacteria | 598 |
| 339 | Ga0451789_0934748 | 3300041443 | Bacteria | 559 |
| 340 | Ga0451794_07065 | 3300041446 | Bacteria | 1237 |
| 341 | Ga0451791_1548520 | 3300041451 | Bacteria | 563 |
| 342 | Ga0451793_1893695 | 3300041452 | Bacteria | 643 |
| 343 | Ga0451797_0895524 | 3300041453 | Bacteria | 687 |
| 344 | Ga0451795_1143703 | 3300041456 | Bacteria | 681 |
| 345 | Ga0451798_0262246 | 3300041458 | Bacteria | 638 |
| 346 | Ga0451798_0874282 | 3300041458 | Bacteria | 1069 |
| 347 | Ga0451800_0558223 | 3300041459 | Bacteria | 1409 |
| 348 | Ga0451805_026080 | 3300041461 | Bacteria | 882 |
| 349 | Ga0451804_0599107 | 3300041463 | Bacteria | 625 |
| 350 | Ga0451804_0747749 | 3300041463 | Bacteria | 563 |
| 351 | Ga0451808_33157 | 3300041464 | Bacteria | 607 |
| 352 | Ga0451807_0974580 | 3300041486 | Bacteria | 1692 |
| 353 | Ga0451807_0978842 | 3300041486 | Bacteria | 702 |
| 354 | Ga0451807_1144583 | 3300041486 | Bacteria | 508 |
| 355 | Ga0451807_1291030 | 3300041486 | Bacteria | 641 |
| 356 | Ga0451807_2271178 | 3300041486 | Bacteria | 599 |
| 357 | Ga0451841_1083457 | 3300041498 | Bacteria | 1025 |
| 358 | Ga0451849_0111712 | 3300041505 | Bacteria | 615 |
| 359 | Ga0451849_1344458 | 3300041505 | Bacteria | 3728 |
| 360 | Ga0451850_63564 | 3300041506 | Bacteria | 877 |
| 361 | Ga0451851_0850392 | 3300041507 | Bacteria | 930 |
| 362 | Ga0451843_0372412 | 3300041509 | Bacteria | 751 |
| 363 | Ga0451853_1266368 | 3300041512 | Bacteria | 15952 |
| 364 | Ga0451853_1756466 | 3300041512 | Bacteria | 966 |
| 365 | Ga0451853_2204238 | 3300041512 | Bacteria | 789 |
| 366 | Ga0451853_3977348 | 3300041512 | Bacteria | 1406 |
| 367 | Ga0439445_0049438 | 3300042004 | Bacteria | 1132 |
| 368 | Ga0439445_0049753 | 3300042004 | Bacteria | 1129 |
| 369 | Ga0439458_0212994 | 3300042157 | Bacteria | 531 |
| 370 | Ga0453684_1877951 | 3300044712 | Bacteria | 607 |
| 371 | Ga0466971_0121247 | 3300044719 | Bacteria | 1210 |
| 372 | Ga0466960_0030191 | 3300044901 | Bacteria | 2493 |
| 373 | Ga0466959_0532825 | 3300045049 | Bacteria | 793 |
| 374 | Ga0451576_0136068 | 3300045051 | Bacteria | 2562 |
| 375 | Ga0451576_0635891 | 3300045051 | Bacteria | 1121 |
| 376 | Ga0495623_0653304 | 3300046679 | Bacteria | 542 |
| 377 | Ga0495658_0132955 | 3300046683 | Bacteria | 1516 |
| 378 | Ga0495680_0062109 | 3300047322 | Bacteria | 2873 |
| 379 | Ga0496102_0436016 | 3300048905 | Bacteria | 1230 |
| 380 | Ga0496104_0036226 | 3300048907 | Bacteria | 4612 |
| 381 | Ga0496112_0030222 | 3300048915 | Bacteria | 5242 |
| 382 | Ga0496115_0561298 | 3300048918 | Bacteria | 911 |
| 383 | Ga0501306_024178 | 3300049127 | Bacteria | 867 |
| 384 | Ga0501306_041246 | 3300049127 | Bacteria | 717 |
| 385 | Ga0501308_011068 | 3300049128 | Bacteria | 1011 |
| 386 | Ga0501308_014383 | 3300049128 | Bacteria | 926 |
| 387 | Ga0501309_038483 | 3300049129 | Bacteria | 725 |
| 388 | Ga0501310_010584 | 3300049130 | Bacteria | 1031 |
| 389 | Ga0501310_015014 | 3300049130 | Bacteria | 915 |
| 390 | Ga0501310_034206 | 3300049130 | Bacteria | 686 |
| 391 | Ga0501305_018599 | 3300049161 | Bacteria | 1007 |
| 392 | Ga0501305_023035 | 3300049161 | Bacteria | 930 |
| 393 | Ga0501307_006084 | 3300049162 | Bacteria | 1292 |
| 394 | Ga0501307_008393 | 3300049162 | Bacteria | 1159 |
| 395 | Ga0501307_092382 | 3300049162 | Bacteria | 506 |
| 396 | Ga0501290_061926 | 3300049513 | Bacteria | 604 |
| 397 | Ga0501292_132493 | 3300049515 | Bacteria | 516 |
| 398 | Ga0501294_017782 | 3300049517 | Bacteria | 749 |
| 399 | Ga0501299_094957 | 3300049522 | Bacteria | 683 |
| 400 | Ga0501311_012757 | 3300049527 | Bacteria | 1053 |
| 401 | Ga0501313_005318 | 3300049529 | Bacteria | 1355 |
| 402 | Ga0501313_049363 | 3300049529 | Bacteria | 579 |
| 403 | Ga0501314_003556 | 3300049530 | Bacteria | 1259 |
| 404 | Ga0501314_013384 | 3300049530 | Bacteria | 795 |
| 405 | Ga0501315_079563 | 3300049531 | Bacteria | 555 |
| 406 | Ga0501326_05426 | 3300049542 | Bacteria | 693 |
| 407 | Ga0501340_025543 | 3300049556 | Bacteria | 515 |
| 408 | Ga0501042_0376179 | 3300049578 | Bacteria | 1028 |
| 409 | Ga0501047_0083068 | 3300049581 | Bacteria | 3079 |
| 410 | Ga0501067_0003773 | 3300049583 | Bacteria | 8357 |
| 411 | Ga0501067_0009930 | 3300049583 | Bacteria | 5271 |
| 412 | Ga0501068_0195360 | 3300049584 | Bacteria | 1283 |
| 413 | Ga0501068_0314939 | 3300049584 | Bacteria | 1003 |
| 414 | Ga0501070_0345621 | 3300049586 | Bacteria | 1208 |
| 415 | Ga0501071_0018420 | 3300049587 | Bacteria | 4834 |
| 416 | Ga0501072_0155592 | 3300049588 | Bacteria | 1823 |
| 417 | Ga0501072_0824832 | 3300049588 | Bacteria | 726 |
| 418 | Ga0501073_0003382 | 3300049589 | Bacteria | 11991 |
| 419 | Ga0501073_0007918 | 3300049589 | Bacteria | 7882 |
| 420 | Ga0501073_0147160 | 3300049589 | Bacteria | 1632 |
| 421 | Ga0501073_0468049 | 3300049589 | Bacteria | 871 |
| 422 | Ga0501074_0002140 | 3300049590 | Bacteria | 13659 |
| 423 | Ga0501076_0009809 | 3300049592 | Bacteria | 7075 |
| 424 | Ga0501077_0109859 | 3300049593 | Bacteria | 1747 |
| 425 | Ga0501199_030610 | 3300049650 | Bacteria | 663 |
| 426 | Ga0501210_027006 | 3300049657 | Bacteria | 577 |
| 427 | Ga0501222_048189 | 3300049662 | Bacteria | 620 |
| 428 | Ga0501242_075069 | 3300049674 | Bacteria | 535 |
| 429 | Ga0501246_026919 | 3300049676 | Bacteria | 627 |
| 430 | Ga0501253_058867 | 3300049683 | Bacteria | 823 |
| 431 | Ga0501260_053820 | 3300049689 | Bacteria | 512 |
| 432 | Ga0501221_228627 | 3300049704 | Bacteria | 527 |
| 433 | Ga0501225_0037033 | 3300049705 | Bacteria | 1344 |
| 434 | Ga0501079_0080947 | 3300049741 | Bacteria | 2511 |
| 435 | Ga0501079_0593202 | 3300049741 | Bacteria | 872 |
| 436 | Ga0501080_0001538 | 3300049742 | Bacteria | 19472 |
| 437 | Ga0501080_0012444 | 3300049742 | Bacteria | 7800 |
| 438 | Ga0501080_0088773 | 3300049742 | Bacteria | 2872 |
| 439 | Ga0501080_0710557 | 3300049742 | Bacteria | 886 |
| 440 | Ga0501081_1564162 | 3300049743 | Bacteria | 501 |
| 441 | Ga0501083_0015971 | 3300049744 | Bacteria | 5257 |
| 442 | Ga0501083_0023661 | 3300049744 | Bacteria | 4259 |
| 443 | Ga0501083_0195843 | 3300049744 | Bacteria | 1319 |
| 444 | Ga0501083_0471175 | 3300049744 | Bacteria | 817 |
| 445 | Ga0501083_0798520 | 3300049744 | Bacteria | 614 |
| 446 | Ga0501265_049455 | 3300049762 | Bacteria | 658 |
| 447 | nmdc:mga03683_193661_c1 | 3300050489 | Bacteria | 931 |
| 448 | nmdc:mga00v17_39504_c1 | 3300050491 | Bacteria | 2826 |
| 449 | nmdc:mga0k408_14443_c1 | 3300050493 | Bacteria | 4352 |
| 450 | nmdc:mga0k408_18243_c1 | 3300050493 | Bacteria | 3915 |
| 451 | nmdc:mga0k408_23012_c1 | 3300050493 | Bacteria | 3512 |
| 452 | nmdc:mga0k408_34669_c1 | 3300050493 | Bacteria | 2890 |
| 453 | nmdc:mga0k408_3991_c1 | 3300050493 | Bacteria | 7823 |
| 454 | nmdc:mga0k408_598713_c1 | 3300050493 | Bacteria | 650 |
| 455 | nmdc:mga08y16_20950_c1 | 3300050511 | Bacteria | 6902 |
| 456 | nmdc:mga08y16_596915_c1 | 3300050511 | Bacteria | 1113 |
| 457 | nmdc:mga08x19_268098_c1 | 3300050514 | Bacteria | 1181 |
| 458 | Ga0500635_0007996 | 3300053080 | Bacteria | 2885 |
| 459 | Ga0495595_0439037 | 3300053084 | Bacteria | 663 |
| 460 | Ga0500644_0006354 | 3300053088 | Bacteria | 3023 |
| 461 | Ga0500647_0228163 | 3300053091 | Bacteria | 830 |
| 462 | Ga0501084_0117414 | 3300054114 | Bacteria | 2237 |
| 463 | Ga0501084_0144668 | 3300054114 | Bacteria | 2002 |
| 464 | Ga0501084_0408519 | 3300054114 | Bacteria | 1147 |
| 465 | Ga0587084_012826 | 3300059477 | Bacteria | 1142 |
| 466 | Ga0587109_053057 | 3300059624 | Bacteria | 836 |
| 467 | Ga0501082_0073718 | 3300060353 | Bacteria | 2940 |
| 468 | Ga0501082_0337953 | 3300060353 | Bacteria | 1312 |
| 469 | Ga0501082_1479513 | 3300060353 | Bacteria | 593 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300004801 | Ga0058860_12230108 | Ga0058860_122301081 | 88 |
| 2 | 3300005328 | Ga0070676_10018293 | Ga0070676_100182933 | 88 |
| 3 | 3300005329 | Ga0070683_100803732 | Ga0070683_1008037322 | 88 |
| 4 | 3300005329 | Ga0070683_102191005 | Ga0070683_1021910051 | 88 |
| 5 | 3300005333 | Ga0070677_10081789 | Ga0070677_100817892 | 88 |
| 6 | 3300005334 | Ga0068869_100050185 | Ga0068869_1000501857 | 88 |
| 7 | 3300005336 | Ga0070680_100354549 | Ga0070680_1003545493 | 88 |
| 8 | 3300005337 | Ga0070682_101649650 | Ga0070682_1016496501 | 88 |
| 9 | 3300005338 | Ga0068868_100160818 | Ga0068868_1001608184 | 88 |
| 10 | 3300005338 | Ga0068868_100923284 | Ga0068868_1009232841 | 88 |
| 11 | 3300005339 | Ga0070660_100406772 | Ga0070660_1004067721 | 88 |
| 12 | 3300005340 | Ga0070689_100068193 | Ga0070689_1000681934 | 88 |
| 13 | 3300005340 | Ga0070689_100688822 | Ga0070689_1006888221 | 88 |
| 14 | 3300005341 | Ga0070691_10060647 | Ga0070691_100606473 | 88 |
| 15 | 3300005343 | Ga0070687_101406173 | Ga0070687_1014061731 | 88 |
| 16 | 3300005345 | Ga0070692_10149633 | Ga0070692_101496332 | 88 |
| 17 | 3300005347 | Ga0070668_100028739 | Ga0070668_1000287399 | 88 |
| 18 | 3300005353 | Ga0070669_100025363 | Ga0070669_1000253634 | 88 |
| 19 | 3300005354 | Ga0070675_100183980 | Ga0070675_1001839803 | 88 |
| 20 | 3300005354 | Ga0070675_100318549 | Ga0070675_1003185493 | 88 |
| 21 | 3300005355 | Ga0070671_100191826 | Ga0070671_1001918264 | 88 |
| 22 | 3300005356 | Ga0070674_100007457 | Ga0070674_1000074577 | 88 |
| 23 | 3300005356 | Ga0070674_100367453 | Ga0070674_1003674532 | 88 |
| 24 | 3300005364 | Ga0070673_100051191 | Ga0070673_1000511914 | 88 |
| 25 | 3300005364 | Ga0070673_100071173 | Ga0070673_1000711734 | 88 |
| 26 | 3300005364 | Ga0070673_100677707 | Ga0070673_1006777072 | 88 |
| 27 | 3300005365 | Ga0070688_100426728 | Ga0070688_1004267282 | 88 |
| 28 | 3300005365 | Ga0070688_100874058 | Ga0070688_1008740581 | 88 |
| 29 | 3300005366 | Ga0070659_100169875 | Ga0070659_1001698753 | 88 |
| 30 | 3300005436 | Ga0070713_101097969 | Ga0070713_1010979691 | 88 |
| 31 | 3300005438 | Ga0070701_10085332 | Ga0070701_100853323 | 88 |
| 32 | 3300005440 | Ga0070705_100852754 | Ga0070705_1008527542 | 88 |
| 33 | 3300005441 | Ga0070700_100727749 | Ga0070700_1007277492 | 88 |
| 34 | 3300005455 | Ga0070663_100466825 | Ga0070663_1004668252 | 88 |
| 35 | 3300005456 | Ga0070678_100804705 | Ga0070678_1008047052 | 88 |
| 36 | 3300005457 | Ga0070662_100093375 | Ga0070662_1000933752 | 88 |
| 37 | 3300005458 | Ga0070681_10212292 | Ga0070681_102122922 | 88 |
| 38 | 3300005458 | Ga0070681_11003005 | Ga0070681_110030053 | 88 |
| 39 | 3300005459 | Ga0068867_100016292 | Ga0068867_1000162924 | 88 |
| 40 | 3300005466 | Ga0070685_10088782 | Ga0070685_100887824 | 88 |
| 41 | 3300005466 | Ga0070685_10603653 | Ga0070685_106036532 | 88 |
| 42 | 3300005466 | Ga0070685_11045815 | Ga0070685_110458151 | 88 |
| 43 | 3300005535 | Ga0070684_100501115 | Ga0070684_1005011153 | 88 |
| 44 | 3300005535 | Ga0070684_101318129 | Ga0070684_1013181292 | 88 |
| 45 | 3300005539 | Ga0068853_100558747 | Ga0068853_1005587472 | 88 |
| 46 | 3300005539 | Ga0068853_100622443 | Ga0068853_1006224432 | 88 |
| 47 | 3300005539 | Ga0068853_102207948 | Ga0068853_1022079482 | 88 |
| 48 | 3300005543 | Ga0070672_100074196 | Ga0070672_1000741964 | 88 |
| 49 | 3300005543 | Ga0070672_100083257 | Ga0070672_1000832574 | 88 |
| 50 | 3300005543 | Ga0070672_100188208 | Ga0070672_1001882084 | 88 |
| 51 | 3300005543 | Ga0070672_100189079 | Ga0070672_1001890792 | 88 |
| 52 | 3300005544 | Ga0070686_100022242 | Ga0070686_1000222424 | 88 |
| 53 | 3300005544 | Ga0070686_101267123 | Ga0070686_1012671232 | 88 |
| 54 | 3300005545 | Ga0070695_100147012 | Ga0070695_1001470121 | 88 |
| 55 | 3300005548 | Ga0070665_100826267 | Ga0070665_1008262673 | 88 |
| 56 | 3300005548 | Ga0070665_101890826 | Ga0070665_1018908262 | 88 |
| 57 | 3300005549 | Ga0070704_100408103 | Ga0070704_1004081033 | 88 |
| 58 | 3300005564 | Ga0070664_100697310 | Ga0070664_1006973102 | 88 |
| 59 | 3300005577 | Ga0068857_101060227 | Ga0068857_1010602272 | 88 |
| 60 | 3300005578 | Ga0068854_100126246 | Ga0068854_1001262462 | 88 |
| 61 | 3300005614 | Ga0068856_100711535 | Ga0068856_1007115353 | 88 |
| 62 | 3300005617 | Ga0068859_100995658 | Ga0068859_1009956582 | 88 |
| 63 | 3300005718 | Ga0068866_10091912 | Ga0068866_100919124 | 88 |
| 64 | 3300005718 | Ga0068866_10396743 | Ga0068866_103967433 | 88 |
| 65 | 3300005719 | Ga0068861_100457060 | Ga0068861_1004570603 | 88 |
| 66 | 3300005834 | Ga0068851_10718012 | Ga0068851_107180122 | 88 |
| 67 | 3300005834 | Ga0068851_10760925 | Ga0068851_107609252 | 88 |
| 68 | 3300005840 | Ga0068870_10768276 | Ga0068870_107682762 | 88 |
| 69 | 3300005841 | Ga0068863_101710820 | Ga0068863_1017108202 | 88 |
| 70 | 3300005842 | Ga0068858_100295540 | Ga0068858_1002955402 | 88 |
| 71 | 3300005844 | Ga0068862_100091874 | Ga0068862_1000918747 | 88 |
| 72 | 3300005937 | Ga0081455_10537061 | Ga0081455_105370612 | 88 |
| 73 | 3300006163 | Ga0070715_10425876 | Ga0070715_104258762 | 88 |
| 74 | 3300006173 | Ga0070716_101720011 | Ga0070716_1017200111 | 88 |
| 75 | 3300006358 | Ga0068871_100286387 | Ga0068871_1002863874 | 88 |
| 76 | 3300006846 | Ga0075430_100286181 | Ga0075430_1002861814 | 88 |
| 77 | 3300006846 | Ga0075430_101138474 | Ga0075430_1011384742 | 88 |
| 78 | 3300006880 | Ga0075429_100717589 | Ga0075429_1007175893 | 88 |
| 79 | 3300006881 | Ga0068865_100759355 | Ga0068865_1007593552 | 88 |
| 80 | 3300006931 | Ga0097620_100995693 | Ga0097620_1009956932 | 88 |
| 81 | 3300009101 | Ga0105247_11152370 | Ga0105247_111523701 | 88 |
| 82 | 3300009148 | Ga0105243_10918606 | Ga0105243_109186062 | 88 |
| 83 | 3300009174 | Ga0105241_12563013 | Ga0105241_125630132 | 88 |
| 84 | 3300009553 | Ga0105249_11897303 | Ga0105249_118973031 | 88 |
| 85 | 3300011119 | Ga0105246_11461753 | Ga0105246_114617532 | 88 |
| 86 | 3300013102 | Ga0157371_11252600 | Ga0157371_112526002 | 88 |
| 87 | 3300013296 | Ga0157374_10039567 | Ga0157374_100395674 | 88 |
| 88 | 3300013308 | Ga0157375_10379526 | Ga0157375_103795262 | 88 |
| 89 | 3300014326 | Ga0157380_12892543 | Ga0157380_128925432 | 88 |
| 90 | 3300014745 | Ga0157377_11055316 | Ga0157377_110553162 | 88 |
| 91 | 3300014745 | Ga0157377_11673329 | Ga0157377_116733292 | 88 |
| 92 | 3300014968 | Ga0157379_10549618 | Ga0157379_105496183 | 88 |
| 93 | 3300021384 | Ga0213876_10573324 | Ga0213876_105733242 | 88 |
| 94 | 3300025271 | Ga0207666_1001625 | Ga0207666_10016257 | 88 |
| 95 | 3300025315 | Ga0207697_10348596 | Ga0207697_103485962 | 88 |
| 96 | 3300025321 | Ga0207656_10455330 | Ga0207656_104553302 | 88 |
| 97 | 3300025893 | Ga0207682_10143047 | Ga0207682_101430473 | 88 |
| 98 | 3300025899 | Ga0207642_10677187 | Ga0207642_106771872 | 88 |
| 99 | 3300025901 | Ga0207688_10186585 | Ga0207688_101865852 | 88 |
| 100 | 3300025903 | Ga0207680_10374993 | Ga0207680_103749933 | 88 |
| 101 | 3300025904 | Ga0207647_10118635 | Ga0207647_101186353 | 88 |
| 102 | 3300025905 | Ga0207685_10737060 | Ga0207685_107370602 | 88 |
| 103 | 3300025906 | Ga0207699_10740975 | Ga0207699_107409752 | 88 |
| 104 | 3300025907 | Ga0207645_10021058 | Ga0207645_100210588 | 88 |
| 105 | 3300025907 | Ga0207645_11054841 | Ga0207645_110548412 | 88 |
| 106 | 3300025908 | Ga0207643_10206890 | Ga0207643_102068903 | 88 |
| 107 | 3300025912 | Ga0207707_10070280 | Ga0207707_100702804 | 88 |
| 108 | 3300025912 | Ga0207707_10755366 | Ga0207707_107553662 | 88 |
| 109 | 3300025918 | Ga0207662_10086791 | Ga0207662_100867914 | 88 |
| 110 | 3300025919 | Ga0207657_10653070 | Ga0207657_106530702 | 88 |
| 111 | 3300025923 | Ga0207681_10002742 | Ga0207681_1000274213 | 88 |
| 112 | 3300025924 | Ga0207694_10176365 | Ga0207694_101763654 | 88 |
| 113 | 3300025925 | Ga0207650_10048909 | Ga0207650_100489093 | 88 |
| 114 | 3300025926 | Ga0207659_10385428 | Ga0207659_103854283 | 88 |
| 115 | 3300025926 | Ga0207659_10403812 | Ga0207659_104038123 | 88 |
| 116 | 3300025928 | Ga0207700_10425332 | Ga0207700_104253321 | 88 |
| 117 | 3300025931 | Ga0207644_10055836 | Ga0207644_100558364 | 88 |
| 118 | 3300025932 | Ga0207690_10136438 | Ga0207690_101364383 | 88 |
| 119 | 3300025933 | Ga0207706_10091565 | Ga0207706_100915656 | 88 |
| 120 | 3300025934 | Ga0207686_11087414 | Ga0207686_110874142 | 88 |
| 121 | 3300025935 | Ga0207709_10210974 | Ga0207709_102109744 | 88 |
| 122 | 3300025936 | Ga0207670_10150696 | Ga0207670_101506963 | 88 |
| 123 | 3300025937 | Ga0207669_10672618 | Ga0207669_106726181 | 88 |
| 124 | 3300025938 | Ga0207704_10003857 | Ga0207704_1000385712 | 88 |
| 125 | 3300025938 | Ga0207704_10765814 | Ga0207704_107658143 | 88 |
| 126 | 3300025939 | Ga0207665_11452521 | Ga0207665_114525212 | 88 |
| 127 | 3300025940 | Ga0207691_10204635 | Ga0207691_102046354 | 88 |
| 128 | 3300025940 | Ga0207691_10289454 | Ga0207691_102894542 | 88 |
| 129 | 3300025940 | Ga0207691_10713868 | Ga0207691_107138681 | 88 |
| 130 | 3300025940 | Ga0207691_10727844 | Ga0207691_107278442 | 88 |
| 131 | 3300025941 | Ga0207711_12046003 | Ga0207711_120460031 | 88 |
| 132 | 3300025942 | Ga0207689_10065221 | Ga0207689_100652213 | 88 |
| 133 | 3300025944 | Ga0207661_10082186 | Ga0207661_100821863 | 88 |
| 134 | 3300025945 | Ga0207679_10286525 | Ga0207679_102865252 | 88 |
| 135 | 3300025960 | Ga0207651_10007125 | Ga0207651_1000712511 | 88 |
| 136 | 3300025960 | Ga0207651_10064605 | Ga0207651_100646054 | 88 |
| 137 | 3300025960 | Ga0207651_10855995 | Ga0207651_108559951 | 88 |
| 138 | 3300025960 | Ga0207651_11357292 | Ga0207651_113572921 | 88 |
| 139 | 3300025972 | Ga0207668_10693369 | Ga0207668_106933692 | 88 |
| 140 | 3300025981 | Ga0207640_10323909 | Ga0207640_103239093 | 88 |
| 141 | 3300025986 | Ga0207658_10392774 | Ga0207658_103927744 | 88 |
| 142 | 3300026023 | Ga0207677_10291313 | Ga0207677_102913133 | 88 |
| 143 | 3300026035 | Ga0207703_10316451 | Ga0207703_103164514 | 88 |
| 144 | 3300026035 | Ga0207703_11834217 | Ga0207703_118342171 | 88 |
| 145 | 3300026041 | Ga0207639_10047593 | Ga0207639_100475937 | 88 |
| 146 | 3300026041 | Ga0207639_10492689 | Ga0207639_104926891 | 88 |
| 147 | 3300026067 | Ga0207678_10677898 | Ga0207678_106778981 | 88 |
| 148 | 3300026067 | Ga0207678_11178814 | Ga0207678_111788141 | 88 |
| 149 | 3300026075 | Ga0207708_10012451 | Ga0207708_1001245111 | 88 |
| 150 | 3300026075 | Ga0207708_11336648 | Ga0207708_113366482 | 88 |
| 151 | 3300026078 | Ga0207702_10182964 | Ga0207702_101829643 | 88 |
| 152 | 3300026078 | Ga0207702_10439820 | Ga0207702_104398204 | 88 |
| 153 | 3300026088 | Ga0207641_11554345 | Ga0207641_115543452 | 88 |
| 154 | 3300026089 | Ga0207648_10011154 | Ga0207648_1001115411 | 88 |
| 155 | 3300026095 | Ga0207676_10514073 | Ga0207676_105140734 | 88 |
| 156 | 3300026116 | Ga0207674_10860911 | Ga0207674_108609112 | 88 |
| 157 | 3300026118 | Ga0207675_100013850 | Ga0207675_1000138508 | 88 |
| 158 | 3300026118 | Ga0207675_101074241 | Ga0207675_1010742412 | 88 |
| 159 | 3300026121 | Ga0207683_10259086 | Ga0207683_102590862 | 88 |
| 160 | 3300026121 | Ga0207683_10512688 | Ga0207683_105126881 | 88 |
| 161 | 3300026142 | Ga0207698_10903638 | Ga0207698_109036381 | 88 |
| 162 | 3300027717 | Ga0209998_10004948 | Ga0209998_100049487 | 88 |
| 163 | 3300027907 | Ga0207428_10017611 | Ga0207428_1001761112 | 88 |
| 164 | 3300028379 | Ga0268266_10962908 | Ga0268266_109629082 | 88 |
| 165 | 3300028379 | Ga0268266_11956922 | Ga0268266_119569222 | 88 |
| 166 | 3300028380 | Ga0268265_10034866 | Ga0268265_100348668 | 88 |
| 167 | 3300028381 | Ga0268264_10136493 | Ga0268264_101364934 | 88 |
| 168 | 3300028563 | Ga0265319_1060122 | Ga0265319_10601222 | 88 |
| 169 | 3300028666 | Ga0265336_10076203 | Ga0265336_100762033 | 88 |
| 170 | 3300028800 | Ga0265338_10382558 | Ga0265338_103825582 | 88 |
| 171 | 3300031238 | Ga0265332_10155677 | Ga0265332_101556772 | 88 |
| 172 | 3300031241 | Ga0265325_10118345 | Ga0265325_101183452 | 88 |
| 173 | 3300031247 | Ga0265340_10015118 | Ga0265340_100151183 | 88 |
| 174 | 3300031249 | Ga0265339_10055328 | Ga0265339_100553284 | 88 |
| 175 | 3300034819 | Ga0373958_0009873 | Ga0373958_0009873_390_656 | 88 |
| 176 | 3300035170 | Ga0373943_0011073 | Ga0373943_0011073_1172_1438 | 88 |
| 177 | 3300035695 | Ga0373927_0161417 | Ga0373927_0161417_414_680 | 88 |
| 178 | 3300035724 | Ga0373933_0762442 | Ga0373933_0762442_121_387 | 88 |
| 179 | 3300039437 | Ga0436365_1839659 | Ga0436365_1839659_926_1192 | 88 |
| 180 | 3300041486 | Ga0451807_1291030 | Ga0451807_1291030_272_538 | 88 |
| 181 | 3300042157 | Ga0439458_0212994 | Ga0439458_0212994_162_428 | 88 |
| 182 | 3300046679 | Ga0495623_0653304 | Ga0495623_0653304_246_512 | 88 |
| 183 | 3300048905 | Ga0496102_0436016 | Ga0496102_0436016_144_410 | 88 |
| 184 | 3300048907 | Ga0496104_0036226 | Ga0496104_0036226_2265_2531 | 88 |
| 185 | 3300048915 | Ga0496112_0030222 | Ga0496112_0030222_4614_4880 | 88 |
| 186 | 3300048918 | Ga0496115_0561298 | Ga0496115_0561298_29_295 | 88 |
| 187 | 3300049583 | Ga0501067_0003773 | Ga0501067_0003773_5073_5339 | 88 |
| 188 | 3300049589 | Ga0501073_0003382 | Ga0501073_0003382_3860_4126 | 88 |
| 189 | 3300050511 | nmdc:mga08y16_20950_c1 | nmdc:mga08y16_20950_c1_5284_5550 | 88 |
| 190 | 3300053084 | Ga0495595_0439037 | Ga0495595_0439037_70_336 | 88 |
| 191 | 3300005337 | Ga0070682_101693088 | Ga0070682_1016930882 | 89 |
| 192 | 3300060353 | Ga0501082_0337953 | Ga0501082_0337953_982_1266 | 89 |
| 193 | 3300004798 | Ga0058859_11363661 | Ga0058859_113636612 | 91 |
| 194 | 3300033528 | Ga0316588_1150386 | Ga0316588_11503861 | 91 |
| 195 | 3300041486 | Ga0451807_1144583 | Ga0451807_1144583_220_498 | 91 |
| 196 | 3300049588 | Ga0501072_0155592 | Ga0501072_0155592_72_362 | 91 |
| 197 | 3300049589 | Ga0501073_0007918 | Ga0501073_0007918_4649_4939 | 91 |
| 198 | 3300049589 | Ga0501073_0468049 | Ga0501073_0468049_87_377 | 91 |
| 199 | 3300049590 | Ga0501074_0002140 | Ga0501074_0002140_8782_9072 | 91 |
| 200 | 3300049592 | Ga0501076_0009809 | Ga0501076_0009809_4163_4453 | 91 |
| 201 | 3300049741 | Ga0501079_0080947 | Ga0501079_0080947_1966_2256 | 91 |
| 202 | 3300049742 | Ga0501080_0001538 | Ga0501080_0001538_4481_4771 | 91 |
| 203 | 3300049742 | Ga0501080_0012444 | Ga0501080_0012444_6815_7105 | 91 |
| 204 | 3300049744 | Ga0501083_0015971 | Ga0501083_0015971_4133_4423 | 91 |
| 205 | 3300049744 | Ga0501083_0023661 | Ga0501083_0023661_1860_2150 | 91 |
| 206 | 3300054114 | Ga0501084_0117414 | Ga0501084_0117414_722_1012 | 91 |
| 207 | 3300054114 | Ga0501084_0144668 | Ga0501084_0144668_1689_1979 | 91 |
| 208 | 3300054114 | Ga0501084_0408519 | Ga0501084_0408519_242_532 | 91 |
| 209 | 3300060353 | Ga0501082_0073718 | Ga0501082_0073718_2172_2462 | 91 |
| 210 | 3300009147 | Ga0114129_12226119 | Ga0114129_122261192 | 92 |
| 211 | 3300014969 | Ga0157376_10865049 | Ga0157376_108650492 | 92 |
| 212 | 3300025942 | Ga0207689_11284890 | Ga0207689_112848901 | 92 |
| 213 | 3300041461 | Ga0451805_026080 | Ga0451805_026080_294_572 | 92 |
| 214 | 3300049744 | Ga0501083_0471175 | Ga0501083_0471175_239_517 | 92 |
| 215 | 3300005330 | Ga0070690_100664315 | Ga0070690_1006643152 | 93 |
| 216 | 3300006847 | Ga0075431_101875986 | Ga0075431_1018759862 | 93 |
| 217 | 3300006914 | Ga0075436_100799513 | Ga0075436_1007995132 | 93 |
| 218 | 3300028556 | Ga0265337_1001901 | Ga0265337_10019014 | 93 |
| 219 | 3300031238 | Ga0265332_10084104 | Ga0265332_100841044 | 93 |
| 220 | 3300031240 | Ga0265320_10001512 | Ga0265320_1000151224 | 93 |
| 221 | 3300031711 | Ga0265314_10276656 | Ga0265314_102766563 | 93 |
| 222 | 3300033524 | Ga0316592_1113147 | Ga0316592_11131472 | 93 |
| 223 | 3300035083 | Ga0373926_0037278 | Ga0373926_0037278_1030_1326 | 93 |
| 224 | 3300035116 | Ga0373945_0138113 | Ga0373945_0138113_59_355 | 93 |
| 225 | 3300036401 | Ga0373937_0408129 | Ga0373937_0408129_858_1154 | 93 |
| 226 | 3300036401 | Ga0373937_1251706 | Ga0373937_1251706_364_663 | 93 |
| 227 | 3300044712 | Ga0453684_1877951 | Ga0453684_1877951_98_391 | 93 |
| 228 | 3300045051 | Ga0451576_0635891 | Ga0451576_0635891_786_1085 | 93 |
| 229 | 3300049744 | Ga0501083_0798520 | Ga0501083_0798520_207_524 | 93 |
| 230 | 3300050514 | nmdc:mga08x19_268098_c1 | nmdc:mga08x19_268098_c1_517_813 | 93 |
| 231 | 3300053088 | Ga0500644_0006354 | Ga0500644_0006354_1746_2057 | 93 |
| 232 | 3300003717 | Ga0006766_120163 | Ga0006766_1201633 | 94 |
| 233 | 3300005340 | Ga0070689_100124190 | Ga0070689_1001241903 | 94 |
| 234 | 3300006175 | Ga0070712_101578029 | Ga0070712_1015780291 | 94 |
| 235 | 3300006177 | Ga0075362_10218353 | Ga0075362_102183533 | 94 |
| 236 | 3300006195 | Ga0075366_10081289 | Ga0075366_100812893 | 94 |
| 237 | 3300006195 | Ga0075366_10517867 | Ga0075366_105178673 | 94 |
| 238 | 3300025936 | Ga0207670_10156318 | Ga0207670_101563183 | 94 |
| 239 | 3300026075 | Ga0207708_10057952 | Ga0207708_100579525 | 94 |
| 240 | 3300028573 | Ga0265334_10001615 | Ga0265334_1000161513 | 94 |
| 241 | 3300031911 | Ga0307412_11226029 | Ga0307412_112260292 | 94 |
| 242 | 3300032005 | Ga0307411_11306245 | Ga0307411_113062453 | 94 |
| 243 | 3300035085 | Ga0373929_0185126 | Ga0373929_0185126_151_435 | 94 |
| 244 | 3300041451 | Ga0451791_1548520 | Ga0451791_1548520_245_529 | 94 |
| 245 | 3300041456 | Ga0451795_1143703 | Ga0451795_1143703_101_385 | 94 |
| 246 | 3300041486 | Ga0451807_0974580 | Ga0451807_0974580_1028_1312 | 94 |
| 247 | 3300041498 | Ga0451841_1083457 | Ga0451841_1083457_586_870 | 94 |
| 248 | 3300041505 | Ga0451849_1344458 | Ga0451849_1344458_2423_2707 | 94 |
| 249 | 3300041506 | Ga0451850_63564 | Ga0451850_63564_228_512 | 94 |
| 250 | 3300041509 | Ga0451843_0372412 | Ga0451843_0372412_98_382 | 94 |
| 251 | 3300041512 | Ga0451853_1266368 | Ga0451853_1266368_11823_12107 | 94 |
| 252 | 3300041512 | Ga0451853_1756466 | Ga0451853_1756466_269_553 | 94 |
| 253 | 3300046683 | Ga0495658_0132955 | Ga0495658_0132955_1003_1305 | 94 |
| 254 | 3300047322 | Ga0495680_0062109 | Ga0495680_0062109_717_1019 | 94 |
| 255 | 3300049583 | Ga0501067_0009930 | Ga0501067_0009930_3690_3974 | 94 |
| 256 | 3300049584 | Ga0501068_0314939 | Ga0501068_0314939_46_330 | 94 |
| 257 | 3300049589 | Ga0501073_0147160 | Ga0501073_0147160_87_371 | 94 |
| 258 | 3300049593 | Ga0501077_0109859 | Ga0501077_0109859_864_1148 | 94 |
| 259 | 3300049742 | Ga0501080_0710557 | Ga0501080_0710557_46_342 | 94 |
| 260 | 3300050489 | nmdc:mga03683_193661_c1 | nmdc:mga03683_193661_c1_286_570 | 94 |
| 261 | 3300050491 | nmdc:mga00v17_39504_c1 | nmdc:mga00v17_39504_c1_415_699 | 94 |
| 262 | 3300050493 | nmdc:mga0k408_18243_c1 | nmdc:mga0k408_18243_c1_2246_2530 | 94 |
| 263 | 3300050493 | nmdc:mga0k408_34669_c1 | nmdc:mga0k408_34669_c1_657_941 | 94 |
| 264 | 3300059624 | Ga0587109_053057 | Ga0587109_053057_455_739 | 94 |
| 265 | 3300060353 | Ga0501082_1479513 | Ga0501082_1479513_203_499 | 94 |
| 266 | 3300003323 | rootH1_10015554 | rootH1_100155544 | 95 |
| 267 | 3300009098 | Ga0105245_10002954 | Ga0105245_1000295421 | 95 |
| 268 | 3300009174 | Ga0105241_10003328 | Ga0105241_100033286 | 95 |
| 269 | 3300014969 | Ga0157376_10085510 | Ga0157376_100855105 | 95 |
| 270 | 3300025911 | Ga0207654_10005897 | Ga0207654_100058976 | 95 |
| 271 | 3300025927 | Ga0207687_10002323 | Ga0207687_100023239 | 95 |
| 272 | 3300042004 | Ga0439445_0049438 | Ga0439445_0049438_817_1113 | 95 |
| 273 | 3300049128 | Ga0501308_014383 | Ga0501308_014383_370_663 | 95 |
| 274 | 3300049130 | Ga0501310_034206 | Ga0501310_034206_58_351 | 95 |
| 275 | 3300002863 | Ga0006769J43182_106300 | Ga0006769J43182_1063003 | 96 |
| 276 | 3300002872 | Ga0006762J43184_109605 | Ga0006762J43184_1096052 | 96 |
| 277 | 3300003163 | Ga0006759J45824_1027396 | Ga0006759J45824_10273963 | 96 |
| 278 | 3300003163 | Ga0006759J45824_1037748 | Ga0006759J45824_10377483 | 96 |
| 279 | 3300003163 | Ga0006759J45824_1039453 | Ga0006759J45824_10394533 | 96 |
| 280 | 3300003300 | Ga0006758J48902_1009221 | Ga0006758J48902_10092215 | 96 |
| 281 | 3300003300 | Ga0006758J48902_1009222 | Ga0006758J48902_10092224 | 96 |
| 282 | 3300003300 | Ga0006758J48902_1012886 | Ga0006758J48902_10128864 | 96 |
| 283 | 3300003300 | Ga0006758J48902_1021124 | Ga0006758J48902_10211241 | 96 |
| 284 | 3300003323 | rootH1_10015553 | rootH1_100155537 | 96 |
| 285 | 3300003693 | Ga0032354_1123461 | Ga0032354_11234611 | 96 |
| 286 | 3300004798 | Ga0058859_11793010 | Ga0058859_117930102 | 96 |
| 287 | 3300004801 | Ga0058860_11423517 | Ga0058860_114235171 | 96 |
| 288 | 3300005295 | Ga0065707_11084460 | Ga0065707_110844602 | 96 |
| 289 | 3300005329 | Ga0070683_100241547 | Ga0070683_1002415474 | 96 |
| 290 | 3300005330 | Ga0070690_100558134 | Ga0070690_1005581342 | 96 |
| 291 | 3300005331 | Ga0070670_100337869 | Ga0070670_1003378693 | 96 |
| 292 | 3300005333 | Ga0070677_10024571 | Ga0070677_100245712 | 96 |
| 293 | 3300005334 | Ga0068869_101184256 | Ga0068869_1011842562 | 96 |
| 294 | 3300005337 | Ga0070682_100000787 | Ga0070682_10000078723 | 96 |
| 295 | 3300005337 | Ga0070682_100016985 | Ga0070682_1000169854 | 96 |
| 296 | 3300005337 | Ga0070682_100139853 | Ga0070682_1001398534 | 96 |
| 297 | 3300005337 | Ga0070682_101843434 | Ga0070682_1018434342 | 96 |
| 298 | 3300005340 | Ga0070689_100342599 | Ga0070689_1003425992 | 96 |
| 299 | 3300005354 | Ga0070675_100195961 | Ga0070675_1001959612 | 96 |
| 300 | 3300005365 | Ga0070688_100081462 | Ga0070688_1000814623 | 96 |
| 301 | 3300005466 | Ga0070685_10052930 | Ga0070685_100529302 | 96 |
| 302 | 3300005466 | Ga0070685_10858064 | Ga0070685_108580642 | 96 |
| 303 | 3300005467 | Ga0070706_100500942 | Ga0070706_1005009422 | 96 |
| 304 | 3300005535 | Ga0070684_100086123 | Ga0070684_1000861233 | 96 |
| 305 | 3300005539 | Ga0068853_102235865 | Ga0068853_1022358651 | 96 |
| 306 | 3300005543 | Ga0070672_100005856 | Ga0070672_1000058564 | 96 |
| 307 | 3300005547 | Ga0070693_100339727 | Ga0070693_1003397272 | 96 |
| 308 | 3300005563 | Ga0068855_100021979 | Ga0068855_1000219799 | 96 |
| 309 | 3300005614 | Ga0068856_100072939 | Ga0068856_1000729394 | 96 |
| 310 | 3300005615 | Ga0070702_101355678 | Ga0070702_1013556781 | 96 |
| 311 | 3300005617 | Ga0068859_102986625 | Ga0068859_1029866251 | 96 |
| 312 | 3300005618 | Ga0068864_100669070 | Ga0068864_1006690703 | 96 |
| 313 | 3300005618 | Ga0068864_101108396 | Ga0068864_1011083962 | 96 |
| 314 | 3300005719 | Ga0068861_100396217 | Ga0068861_1003962173 | 96 |
| 315 | 3300005834 | Ga0068851_10372549 | Ga0068851_103725491 | 96 |
| 316 | 3300005841 | Ga0068863_100015171 | Ga0068863_1000151718 | 96 |
| 317 | 3300005842 | Ga0068858_101347111 | Ga0068858_1013471112 | 96 |
| 318 | 3300005844 | Ga0068862_102095527 | Ga0068862_1020955272 | 96 |
| 319 | 3300006177 | Ga0075362_10271068 | Ga0075362_102710682 | 96 |
| 320 | 3300006195 | Ga0075366_10018157 | Ga0075366_100181575 | 96 |
| 321 | 3300006358 | Ga0068871_100313833 | Ga0068871_1003138332 | 96 |
| 322 | 3300006358 | Ga0068871_101231209 | Ga0068871_1012312092 | 96 |
| 323 | 3300006931 | Ga0097620_102985358 | Ga0097620_1029853581 | 96 |
| 324 | 3300009093 | Ga0105240_10368729 | Ga0105240_103687292 | 96 |
| 325 | 3300009094 | Ga0111539_11194141 | Ga0111539_111941413 | 96 |
| 326 | 3300009176 | Ga0105242_12189552 | Ga0105242_121895522 | 96 |
| 327 | 3300009177 | Ga0105248_12884117 | Ga0105248_128841172 | 96 |
| 328 | 3300009545 | Ga0105237_10569738 | Ga0105237_105697383 | 96 |
| 329 | 3300009551 | Ga0105238_10733151 | Ga0105238_107331513 | 96 |
| 330 | 3300009551 | Ga0105238_11509572 | Ga0105238_115095722 | 96 |
| 331 | 3300010375 | Ga0105239_10555629 | Ga0105239_105556292 | 96 |
| 332 | 3300013104 | Ga0157370_11379431 | Ga0157370_113794312 | 96 |
| 333 | 3300013296 | Ga0157374_10446050 | Ga0157374_104460502 | 96 |
| 334 | 3300014325 | Ga0163163_10668872 | Ga0163163_106688723 | 96 |
| 335 | 3300014325 | Ga0163163_11213366 | Ga0163163_112133662 | 96 |
| 336 | 3300014326 | Ga0157380_10316530 | Ga0157380_103165303 | 96 |
| 337 | 3300014326 | Ga0157380_12965027 | Ga0157380_129650272 | 96 |
| 338 | 3300014969 | Ga0157376_10282688 | Ga0157376_102826884 | 96 |
| 339 | 3300014969 | Ga0157376_10493542 | Ga0157376_104935423 | 96 |
| 340 | 3300014969 | Ga0157376_11171514 | Ga0157376_111715142 | 96 |
| 341 | 3300017792 | Ga0163161_10227494 | Ga0163161_102274944 | 96 |
| 342 | 3300025893 | Ga0207682_10011730 | Ga0207682_100117304 | 96 |
| 343 | 3300025899 | Ga0207642_11128329 | Ga0207642_111283292 | 96 |
| 344 | 3300025914 | Ga0207671_10619500 | Ga0207671_106195002 | 96 |
| 345 | 3300025924 | Ga0207694_11139312 | Ga0207694_111393122 | 96 |
| 346 | 3300025926 | Ga0207659_10240778 | Ga0207659_102407782 | 96 |
| 347 | 3300025939 | Ga0207665_10850556 | Ga0207665_108505562 | 96 |
| 348 | 3300025940 | Ga0207691_10036323 | Ga0207691_100363238 | 96 |
| 349 | 3300025944 | Ga0207661_10060988 | Ga0207661_100609884 | 96 |
| 350 | 3300025949 | Ga0207667_10000612 | Ga0207667_1000061239 | 96 |
| 351 | 3300026041 | Ga0207639_10992147 | Ga0207639_109921472 | 96 |
| 352 | 3300026075 | Ga0207708_11616581 | Ga0207708_116165811 | 96 |
| 353 | 3300026078 | Ga0207702_10040498 | Ga0207702_100404985 | 96 |
| 354 | 3300026088 | Ga0207641_10401323 | Ga0207641_104013234 | 96 |
| 355 | 3300026095 | Ga0207676_11130419 | Ga0207676_111304192 | 96 |
| 356 | 3300026116 | Ga0207674_10965093 | Ga0207674_109650933 | 96 |
| 357 | 3300026118 | Ga0207675_100181324 | Ga0207675_1001813244 | 96 |
| 358 | 3300026118 | Ga0207675_100768026 | Ga0207675_1007680262 | 96 |
| 359 | 3300026121 | Ga0207683_10802614 | Ga0207683_108026142 | 96 |
| 360 | 3300026142 | Ga0207698_12216058 | Ga0207698_122160582 | 96 |
| 361 | 3300028794 | Ga0307515_10202150 | Ga0307515_102021506 | 96 |
| 362 | 3300028794 | Ga0307515_10654784 | Ga0307515_106547842 | 96 |
| 363 | 3300031456 | Ga0307513_10090959 | Ga0307513_100909592 | 96 |
| 364 | 3300031507 | Ga0307509_10500318 | Ga0307509_105003183 | 96 |
| 365 | 3300031616 | Ga0307508_10050191 | Ga0307508_100501913 | 96 |
| 366 | 3300031616 | Ga0307508_10810175 | Ga0307508_108101752 | 96 |
| 367 | 3300031730 | Ga0307516_10003404 | Ga0307516_1000340418 | 96 |
| 368 | 3300033541 | Ga0316596_1123044 | Ga0316596_11230442 | 96 |
| 369 | 3300035692 | Ga0373935_0390479 | Ga0373935_0390479_471_761 | 96 |
| 370 | 3300041441 | Ga0451787_227323 | Ga0451787_227323_228_518 | 96 |
| 371 | 3300041443 | Ga0451789_0502497 | Ga0451789_0502497_236_526 | 96 |
| 372 | 3300041452 | Ga0451793_1893695 | Ga0451793_1893695_143_433 | 96 |
| 373 | 3300041458 | Ga0451798_0262246 | Ga0451798_0262246_291_581 | 96 |
| 374 | 3300041458 | Ga0451798_0874282 | Ga0451798_0874282_748_1038 | 96 |
| 375 | 3300041486 | Ga0451807_2271178 | Ga0451807_2271178_116_406 | 96 |
| 376 | 3300041512 | Ga0451853_2204238 | Ga0451853_2204238_300_590 | 96 |
| 377 | 3300042004 | Ga0439445_0049753 | Ga0439445_0049753_155_445 | 96 |
| 378 | 3300044719 | Ga0466971_0121247 | Ga0466971_0121247_210_500 | 96 |
| 379 | 3300044901 | Ga0466960_0030191 | Ga0466960_0030191_1249_1539 | 96 |
| 380 | 3300045049 | Ga0466959_0532825 | Ga0466959_0532825_46_336 | 96 |
| 381 | 3300049127 | Ga0501306_024178 | Ga0501306_024178_362_652 | 96 |
| 382 | 3300049162 | Ga0501307_006084 | Ga0501307_006084_243_542 | 96 |
| 383 | 3300049162 | Ga0501307_092382 | Ga0501307_092382_170_460 | 96 |
| 384 | 3300049529 | Ga0501313_049363 | Ga0501313_049363_148_438 | 96 |
| 385 | 3300049530 | Ga0501314_003556 | Ga0501314_003556_138_428 | 96 |
| 386 | 3300049581 | Ga0501047_0083068 | Ga0501047_0083068_2510_2800 | 96 |
| 387 | 3300049586 | Ga0501070_0345621 | Ga0501070_0345621_597_887 | 96 |
| 388 | 3300049744 | Ga0501083_0195843 | Ga0501083_0195843_226_516 | 96 |
| 389 | 3300050493 | nmdc:mga0k408_14443_c1 | nmdc:mga0k408_14443_c1_2059_2349 | 96 |
| 390 | 3300053080 | Ga0500635_0007996 | Ga0500635_0007996_918_1208 | 96 |
| 391 | 3300053091 | Ga0500647_0228163 | Ga0500647_0228163_217_507 | 96 |
| 392 | 3300059477 | Ga0587084_012826 | Ga0587084_012826_223_513 | 96 |
| 393 | 3300003320 | rootH2_10045491 | rootH2_100454915 | 97 |
| 394 | 3300005337 | Ga0070682_101237566 | Ga0070682_1012375662 | 97 |
| 395 | 3300006195 | Ga0075366_10009031 | Ga0075366_100090314 | 97 |
| 396 | 3300014745 | Ga0157377_10994466 | Ga0157377_109944662 | 97 |
| 397 | 3300025911 | Ga0207654_10519492 | Ga0207654_105194922 | 97 |
| 398 | 3300045051 | Ga0451576_0136068 | Ga0451576_0136068_428_748 | 97 |
| 399 | 3300049578 | Ga0501042_0376179 | Ga0501042_0376179_387_707 | 97 |
| 400 | 3300049584 | Ga0501068_0195360 | Ga0501068_0195360_356_676 | 97 |
| 401 | 3300049587 | Ga0501071_0018420 | Ga0501071_0018420_2353_2673 | 97 |
| 402 | 3300049588 | Ga0501072_0824832 | Ga0501072_0824832_71_391 | 97 |
| 403 | 3300049741 | Ga0501079_0593202 | Ga0501079_0593202_227_547 | 97 |
| 404 | 3300049742 | Ga0501080_0088773 | Ga0501080_0088773_1787_2107 | 97 |
| 405 | 3300049743 | Ga0501081_1564162 | Ga0501081_1564162_131_451 | 97 |
| 406 | 3300050493 | nmdc:mga0k408_23012_c1 | nmdc:mga0k408_23012_c1_1909_2223 | 97 |
| 407 | 3300002863 | Ga0006769J43182_104289 | Ga0006769J43182_1042894 | 98 |
| 408 | 3300002865 | Ga0006761J43178_107109 | Ga0006761J43178_1071092 | 98 |
| 409 | 3300002870 | Ga0006763J43179_108456 | Ga0006763J43179_1084563 | 98 |
| 410 | 3300003161 | Ga0006765J45826_111039 | Ga0006765J45826_1110393 | 98 |
| 411 | 3300003163 | Ga0006759J45824_1029961 | Ga0006759J45824_10299615 | 98 |
| 412 | 3300003300 | Ga0006758J48902_1009598 | Ga0006758J48902_10095985 | 98 |
| 413 | 3300003305 | Ga0006770J48903_1016726 | Ga0006770J48903_10167265 | 98 |
| 414 | 3300003693 | Ga0032354_1050569 | Ga0032354_10505693 | 98 |
| 415 | 3300004798 | Ga0058859_11666696 | Ga0058859_116666962 | 98 |
| 416 | 3300005276 | Ga0065717_1013978 | Ga0065717_10139781 | 98 |
| 417 | 3300005444 | Ga0070694_100586888 | Ga0070694_1005868882 | 98 |
| 418 | 3300005563 | Ga0068855_100000266 | Ga0068855_10000026639 | 98 |
| 419 | 3300005577 | Ga0068857_101054500 | Ga0068857_1010545003 | 98 |
| 420 | 3300014968 | Ga0157379_11984428 | Ga0157379_119844281 | 98 |
| 421 | 3300020078 | Ga0206352_10383322 | Ga0206352_103833222 | 98 |
| 422 | 3300025949 | Ga0207667_10003431 | Ga0207667_1000343113 | 98 |
| 423 | 3300028380 | Ga0268265_11308794 | Ga0268265_113087942 | 98 |
| 424 | 3300031456 | Ga0307513_10667955 | Ga0307513_106679553 | 98 |
| 425 | 3300031507 | Ga0307509_10843681 | Ga0307509_108436812 | 98 |
| 426 | 3300032005 | Ga0307411_11320669 | Ga0307411_113206692 | 98 |
| 427 | 3300041441 | Ga0451787_430695 | Ga0451787_430695_2165_2461 | 98 |
| 428 | 3300041443 | Ga0451789_0934748 | Ga0451789_0934748_163_459 | 98 |
| 429 | 3300041446 | Ga0451794_07065 | Ga0451794_07065_343_639 | 98 |
| 430 | 3300041453 | Ga0451797_0895524 | Ga0451797_0895524_86_382 | 98 |
| 431 | 3300041459 | Ga0451800_0558223 | Ga0451800_0558223_865_1161 | 98 |
| 432 | 3300041463 | Ga0451804_0599107 | Ga0451804_0599107_135_431 | 98 |
| 433 | 3300041463 | Ga0451804_0747749 | Ga0451804_0747749_67_363 | 98 |
| 434 | 3300041464 | Ga0451808_33157 | Ga0451808_33157_269_565 | 98 |
| 435 | 3300041486 | Ga0451807_0978842 | Ga0451807_0978842_206_502 | 98 |
| 436 | 3300041505 | Ga0451849_0111712 | Ga0451849_0111712_57_353 | 98 |
| 437 | 3300041507 | Ga0451851_0850392 | Ga0451851_0850392_124_420 | 98 |
| 438 | 3300041512 | Ga0451853_3977348 | Ga0451853_3977348_761_1057 | 98 |
| 439 | 3300049127 | Ga0501306_041246 | Ga0501306_041246_116_412 | 98 |
| 440 | 3300049128 | Ga0501308_011068 | Ga0501308_011068_587_883 | 98 |
| 441 | 3300049129 | Ga0501309_038483 | Ga0501309_038483_236_541 | 98 |
| 442 | 3300049130 | Ga0501310_010584 | Ga0501310_010584_262_558 | 98 |
| 443 | 3300049130 | Ga0501310_015014 | Ga0501310_015014_382_678 | 98 |
| 444 | 3300049161 | Ga0501305_018599 | Ga0501305_018599_566_862 | 98 |
| 445 | 3300049161 | Ga0501305_023035 | Ga0501305_023035_237_533 | 98 |
| 446 | 3300049162 | Ga0501307_008393 | Ga0501307_008393_686_982 | 98 |
| 447 | 3300049513 | Ga0501290_061926 | Ga0501290_061926_248_544 | 98 |
| 448 | 3300049515 | Ga0501292_132493 | Ga0501292_132493_185_481 | 98 |
| 449 | 3300049517 | Ga0501294_017782 | Ga0501294_017782_229_525 | 98 |
| 450 | 3300049522 | Ga0501299_094957 | Ga0501299_094957_48_344 | 98 |
| 451 | 3300049527 | Ga0501311_012757 | Ga0501311_012757_333_629 | 98 |
| 452 | 3300049529 | Ga0501313_005318 | Ga0501313_005318_552_848 | 98 |
| 453 | 3300049530 | Ga0501314_013384 | Ga0501314_013384_140_436 | 98 |
| 454 | 3300049531 | Ga0501315_079563 | Ga0501315_079563_237_533 | 98 |
| 455 | 3300049542 | Ga0501326_05426 | Ga0501326_05426_198_494 | 98 |
| 456 | 3300049556 | Ga0501340_025543 | Ga0501340_025543_80_376 | 98 |
| 457 | 3300049650 | Ga0501199_030610 | Ga0501199_030610_25_321 | 98 |
| 458 | 3300049657 | Ga0501210_027006 | Ga0501210_027006_215_511 | 98 |
| 459 | 3300049662 | Ga0501222_048189 | Ga0501222_048189_270_566 | 98 |
| 460 | 3300049674 | Ga0501242_075069 | Ga0501242_075069_183_479 | 98 |
| 461 | 3300049676 | Ga0501246_026919 | Ga0501246_026919_100_396 | 98 |
| 462 | 3300049683 | Ga0501253_058867 | Ga0501253_058867_248_544 | 98 |
| 463 | 3300049689 | Ga0501260_053820 | Ga0501260_053820_85_381 | 98 |
| 464 | 3300049704 | Ga0501221_228627 | Ga0501221_228627_61_357 | 98 |
| 465 | 3300049705 | Ga0501225_0037033 | Ga0501225_0037033_990_1286 | 98 |
| 466 | 3300049762 | Ga0501265_049455 | Ga0501265_049455_350_646 | 98 |
| 467 | 3300050493 | nmdc:mga0k408_3991_c1 | nmdc:mga0k408_3991_c1_7356_7673 | 98 |
| 468 | 3300050493 | nmdc:mga0k408_598713_c1 | nmdc:mga0k408_598713_c1_276_572 | 98 |
| 469 | 3300050511 | nmdc:mga08y16_596915_c1 | nmdc:mga08y16_596915_c1_79_390 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v4w-assembly1.cif.gz_AQ | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.964 | 15 | 90 |
| 1i96-assembly1.cif.gz_Q | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.9621 | 13 | 88 |
| 8fmw-assembly1.cif.gz_Q | the structure of a hibernating ribosome in the lyme disease pathogen | 0.9594 | 12 | 91 |
| 1n36-assembly1.cif.gz_Q | structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position | 0.958 | 13 | 91 |
| 4v8c-assembly1.cif.gz_CT | crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). | 0.9569 | 13 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9588 | 15 | 91 | 2.40.50.140 |
| 3ms0Q00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9577 | 13 | 90 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9523 | 15 | 91 | 2.40.50.140 |
| af_Q03246_1_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9471 | 13 | 89 | 2.40.50.140 |
| af_Q2FW15_6_86_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.941 | 13 | 91 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662D8U8-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9759 | 13 | 93 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7C2LTV3-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9703 | 13 | 91 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A523V837-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9693 | 14 | 91 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7X3Y523-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9684 | 14 | 95 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A6B1HF68-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.968 | 15 | 95 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar