F449941

General Info

Members Datasets Scaffolds Average Seq Length
467 295 445 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221611|2644074493
Length 363
Sequence STVCGSPPGYPIECQSAWEHLSTDPCIYLEPCLVSELHKFLFDGLPVRGMLVRLTDAWTDILARRAGNSATGAYAAPVTELLGEMAAAGVLMQSNIKFNGALVLQVFGDGPVKLAVAEVQSDLSLRATATVTGEVPADARLSQMVNVGGGGRCAITLDPKNRHPGQQPYQGVVPLHGDHHEKLDRLSDVLQHYMLQSEQLDTVLVLGANDKVAAGLLIQRMPIKGEGNLASGLSHRENEDQIGHNEDYNRIAHLAASLTREELLSLDVDTILRRLFWEEKLVRFEPQQGETGPRFACTCSRERVSAMLRNLGAEEAESILAERGEIEVGCEFCGQQYRFDAVDAAQIFVEPAIIQPPAPTGMQ

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2738543012 Acidovorax sp. CF301 Isolate Unclassified
14 2738543013 Variovorax sp. BT01 Isolate Unclassified
15 2816332133 Acidovorax radicis 2721A Isolate Unclassified
16 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
19 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
20 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
21 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
22 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
23 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
158 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
196 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
197 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
272 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
273 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
274 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
275 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
292 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0.21
Isolates 4.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0.43
Rhizoplane 1.07
Rhizosphere 67.02
Stem 0
Stem Tuber 0
Unclassified 15.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000107 3300002705 Bacteria 59945
2 JGI25156J39149_1000421 3300002705 Bacteria 26329
3 JGI25154J39366_1000529 3300002738 Bacteria 19186
4 JGI25157J39369_1000020 3300002741 Bacteria 173287
5 JGI25153J46596_10005247 3300003215 Bacteria 6812
6 rootH1_10014123 3300003316 Bacteria 10366
7 rootH1_10001754 3300003316 Bacteria 7739
8 rootH1_10001754 3300003323 Bacteria 12269
9 Ga0006562J51391_1061276 3300003578 Bacteria 2330
10 Ga0055539_1000155 3300003752 Bacteria 65927
11 Ga0055533_1000028 3300003756 Bacteria 311012
12 Ga0055525_1000021 3300003759 Bacteria 370802
13 Ga0055525_1000795 3300003759 Bacteria 9960
14 Ga0055535_1000167 3300003761 Bacteria 71096
15 Ga0055529_1000151 3300003763 Bacteria 98866
16 Ga0055534_1002844 3300003784 Bacteria 5764
17 Ga0055531_10000051 3300003794 Bacteria 130125
18 Ga0065704_10123419 3300005289 Bacteria 1734
19 Ga0065712_10127186 3300005290 Bacteria 1593
20 Ga0070658_10012989 3300005327 Bacteria 6683
21 Ga0070658_10071311 3300005327 Bacteria 2845
22 Ga0070676_10035705 3300005328 Bacteria 2860
23 Ga0070676_10051762 3300005328 Bacteria 2412
24 Ga0070683_100122677 3300005329 Bacteria 2455
25 Ga0070690_100105241 3300005330 Bacteria 1875
26 Ga0070670_100049613 3300005331 Bacteria 3609
27 Ga0070670_100049753 3300005331 Bacteria 3603
28 Ga0070670_100060956 3300005331 Bacteria 3239
29 Ga0070677_10005435 3300005333 Bacteria 4199
30 Ga0068869_100013561 3300005334 Bacteria 5424
31 Ga0068869_100127021 3300005334 Bacteria 1957
32 Ga0068868_100005383 3300005338 Bacteria 8993
33 Ga0068868_100018577 3300005338 Bacteria 5201
34 Ga0068868_100065930 3300005338 Bacteria 2878
35 Ga0070668_100279471 3300005347 Bacteria 1394
36 Ga0070669_100006105 3300005353 Bacteria 8694
37 Ga0070675_100001535 3300005354 Bacteria 17078
38 Ga0070675_100005184 3300005354 Bacteria 9937
39 Ga0070671_100028948 3300005355 Bacteria 4565
40 Ga0070671_100049582 3300005355 Bacteria 3493
41 Ga0070671_100130598 3300005355 Bacteria 2116
42 Ga0070674_100009036 3300005356 Bacteria 5957
43 Ga0070674_100014666 3300005356 Bacteria 4875
44 Ga0070674_100198646 3300005356 Bacteria 1547
45 Ga0070673_100013924 3300005364 Bacteria 5584
46 Ga0070673_100031808 3300005364 Bacteria 3964
47 Ga0070667_100175874 3300005367 Bacteria 1892
48 Ga0070678_100100359 3300005456 Bacteria 2242
49 Ga0070678_100128147 3300005456 Bacteria 2012
50 Ga0070662_100055941 3300005457 Bacteria 2863
51 Ga0070662_100273023 3300005457 Bacteria 1366
52 Ga0068867_100002841 3300005459 Bacteria 12176
53 Ga0068867_100002971 3300005459 Bacteria 11946
54 Ga0068867_100035680 3300005459 Bacteria 3608
55 Ga0070672_100002062 3300005543 Bacteria 12665
56 Ga0070672_100100210 3300005543 Bacteria 2349
57 Ga0070665_100008010 3300005548 Bacteria 10703
58 Ga0068855_100000405 3300005563 Bacteria 53352
59 Ga0068855_100095783 3300005563 Bacteria 3421
60 Ga0068855_100097233 3300005563 Bacteria 3391
61 Ga0070664_100169409 3300005564 Bacteria 1937
62 Ga0068857_100079157 3300005577 Bacteria 2934
63 Ga0068857_100176495 3300005577 Bacteria 1943
64 Ga0068854_100175533 3300005578 Bacteria 1670
65 Ga0068856_100107056 3300005614 Bacteria 2791
66 Ga0068870_10031217 3300005840 Bacteria 2698
67 Ga0068870_10034692 3300005840 Bacteria 2583
68 Ga0068863_100482481 3300005841 Bacteria 1219
69 Ga0068862_100312604 3300005844 Bacteria 1448
70 Ga0068862_100336055 3300005844 Bacteria 1398
71 Ga0075365_10173261 3300006038 Bacteria 1507
72 Ga0075363_100053323 3300006048 Bacteria 2161
73 Ga0075362_10132251 3300006177 Bacteria 1188
74 Ga0075362_10152263 3300006177 Bacteria 1110
75 Ga0075367_10063374 3300006178 Bacteria 2209
76 Ga0075367_10066519 3300006178 Bacteria 2159
77 Ga0075366_10001775 3300006195 Bacteria 10886
78 Ga0075366_10010236 3300006195 Bacteria 5261
79 Ga0075366_10011230 3300006195 Bacteria 5053
80 Ga0075366_10012381 3300006195 Bacteria 4839
81 Ga0075366_10014071 3300006195 Bacteria 4565
82 Ga0075366_10042380 3300006195 Bacteria 2695
83 Ga0075370_10005894 3300006353 Bacteria 6128
84 Ga0075370_10012283 3300006353 Bacteria 4521
85 Ga0075370_10022729 3300006353 Bacteria 3447
86 Ga0075370_10072478 3300006353 Bacteria 1972
87 Ga0068871_100007609 3300006358 Bacteria 7747
88 Ga0068865_100039848 3300006881 Bacteria 3189
89 Ga0079104_1000002 3300006946 Bacteria 514469
90 Ga0105250_10001691 3300009092 Bacteria 11652
91 Ga0105240_10003241 3300009093 Bacteria 25466
92 Ga0105245_10030579 3300009098 Bacteria 4762
93 Ga0114129_10104062 3300009147 Bacteria 3923
94 Ga0105243_10004780 3300009148 Bacteria 10647
95 Ga0105243_10160714 3300009148 Bacteria 1937
96 Ga0105241_10201009 3300009174 Bacteria 1664
97 Ga0105242_10000656 3300009176 Bacteria 27099
98 Ga0105242_10135941 3300009176 Bacteria 2127
99 Ga0105242_10600316 3300009176 Bacteria 1063
100 Ga0105248_10443335 3300009177 Bacteria 1463
101 Ga0105237_10036055 3300009545 Bacteria 5004
102 Ga0105237_10103686 3300009545 Bacteria 2836
103 Ga0105238_10095358 3300009551 Bacteria 2962
104 Ga0105239_10012269 3300010375 Bacteria 9545
105 Ga0105246_10305681 3300011119 Bacteria 1286
106 Ga0157369_10039806 3300013105 Bacteria 5136
107 Ga0163162_10108773 3300013306 Bacteria 2869
108 Ga0157372_10287117 3300013307 Bacteria 1913
109 Ga0157375_10220662 3300013308 Bacteria 2054
110 Ga0157379_10016805 3300014968 Bacteria 6440
111 Ga0163161_10053518 3300017792 Bacteria 2927
112 Ga0213872_10000011 3300021361 Bacteria 194139
113 Ga0213872_10000172 3300021361 Bacteria 58334
114 Ga0213872_10000359 3300021361 Bacteria 38340
115 Ga0209674_100007 3300025226 Bacteria 1077082
116 Ga0209674_101662 3300025226 Bacteria 5539
117 Ga0209563_100033 3300025230 Bacteria 457883
118 Ga0207427_100912 3300025231 Bacteria 12733
119 Ga0209258_100146 3300025242 Bacteria 163331
120 Ga0209258_100499 3300025242 Bacteria 38873
121 Ga0209646_1000062 3300025246 Bacteria 252045
122 Ga0209026_1000026 3300025250 Bacteria 352109
123 Ga0209677_100082 3300025253 Bacteria 118875
124 Ga0209677_100116 3300025253 Bacteria 82606
125 Ga0209148_1015030 3300025254 Bacteria 1361
126 Ga0209759_1000050 3300025256 Bacteria 215979
127 Ga0209759_1000855 3300025256 Bacteria 23683
128 Ga0209759_1012293 3300025256 Bacteria 2380
129 Ga0209759_1020127 3300025256 Bacteria 1560
130 Ga0209455_1000059 3300025272 Bacteria 339995
131 Ga0209673_1033474 3300025273 Bacteria 1566
132 Ga0209130_1001702 3300025284 Bacteria 13299
133 Ga0209675_1002145 3300025291 Bacteria 10408
134 Ga0209676_1034220 3300025292 Bacteria 1504
135 Ga0209025_1028509 3300025294 Bacteria 2732
136 Ga0209758_1000045 3300025297 Bacteria 369174
137 Ga0209050_1003330 3300025298 Bacteria 11984
138 Ga0209050_1027799 3300025298 Bacteria 1853
139 Ga0209051_1000320 3300025303 Bacteria 72764
140 Ga0209051_1003268 3300025303 Bacteria 10758
141 Ga0209051_1004347 3300025303 Bacteria 8779
142 Ga0209051_1004802 3300025303 Bacteria 8151
143 Ga0209257_1000017 3300025304 Bacteria 866287
144 Ga0209257_1000161 3300025304 Bacteria 176089
145 Ga0207682_10001523 3300025893 Bacteria 10677
146 Ga0207645_10008686 3300025907 Bacteria 7073
147 Ga0207645_10021380 3300025907 Bacteria 4219
148 Ga0207645_10050483 3300025907 Bacteria 2656
149 Ga0207643_10037250 3300025908 Bacteria 2729
150 Ga0207705_10012186 3300025909 Bacteria 6215
151 Ga0207705_10084335 3300025909 Bacteria 2320
152 Ga0207654_10020266 3300025911 Bacteria 3522
153 Ga0207695_10075501 3300025913 Bacteria 3429
154 Ga0207695_10242082 3300025913 Bacteria 1705
155 Ga0207652_10171367 3300025921 Bacteria 1948
156 Ga0207681_10071740 3300025923 Bacteria 2416
157 Ga0207694_10065552 3300025924 Bacteria 2832
158 Ga0207650_10002460 3300025925 Bacteria 12887
159 Ga0207650_10069254 3300025925 Bacteria 2650
160 Ga0207659_10001118 3300025926 Bacteria 15897
161 Ga0207659_10006295 3300025926 Bacteria 7260
162 Ga0207687_10246298 3300025927 Bacteria 1419
163 Ga0207687_10506932 3300025927 Bacteria 1008
164 Ga0207644_10034911 3300025931 Bacteria 3521
165 Ga0207706_10017618 3300025933 Bacteria 6435
166 Ga0207706_10323890 3300025933 Bacteria 1341
167 Ga0207686_10024745 3300025934 Bacteria 3483
168 Ga0207709_10000015 3300025935 Bacteria 493221
169 Ga0207709_10151732 3300025935 Bacteria 1605
170 Ga0207669_10078565 3300025937 Bacteria 2103
171 Ga0207704_10039057 3300025938 Bacteria 2760
172 Ga0207691_10006082 3300025940 Bacteria 11664
173 Ga0207691_10007915 3300025940 Bacteria 10231
174 Ga0207691_10054596 3300025940 Bacteria 3644
175 Ga0207689_10014862 3300025942 Bacteria 6607
176 Ga0207689_10041667 3300025942 Bacteria 3799
177 Ga0207679_10013263 3300025945 Bacteria 5400
178 Ga0207679_10145579 3300025945 Bacteria 1921
179 Ga0207667_10002900 3300025949 Bacteria 21297
180 Ga0207667_10025190 3300025949 Bacteria 6518
181 Ga0207651_10006687 3300025960 Bacteria 6069
182 Ga0207651_10008923 3300025960 Bacteria 5446
183 Ga0207668_10204384 3300025972 Bacteria 1575
184 Ga0207640_10015753 3300025981 Bacteria 4382
185 Ga0207677_10002779 3300026023 Bacteria 9244
186 Ga0207677_10020394 3300026023 Bacteria 4024
187 Ga0207677_10085330 3300026023 Bacteria 2279
188 Ga0207677_10086774 3300026023 Bacteria 2263
189 Ga0207639_10139682 3300026041 Bacteria 2017
190 Ga0207639_10163917 3300026041 Bacteria 1876
191 Ga0207702_10000225 3300026078 Bacteria 65968
192 Ga0207702_10260757 3300026078 Bacteria 1632
193 Ga0207641_10079866 3300026088 Bacteria 2837
194 Ga0207648_10002848 3300026089 Bacteria 18311
195 Ga0207648_10010781 3300026089 Bacteria 8636
196 Ga0207648_10026360 3300026089 Bacteria 5166
197 Ga0207674_10006381 3300026116 Bacteria 13881
198 Ga0207674_10008218 3300026116 Bacteria 12093
199 Ga0207675_100239110 3300026118 Bacteria 1754
200 Ga0207683_10006663 3300026121 Bacteria 9879
201 Ga0207683_10098567 3300026121 Bacteria 2608
202 Ga0207683_10163110 3300026121 Bacteria 2016
203 Ga0207698_10391690 3300026142 Bacteria 1325
204 Ga0209281_1000007 3300027111 Bacteria 938265
205 Ga0209970_1001451 3300027614 Bacteria 4143
206 Ga0209974_10028570 3300027876 Bacteria 1847
207 Ga0268266_10048458 3300028379 Bacteria 3642
208 Ga0268265_10343402 3300028380 Bacteria 1360
209 Ga0265336_10000016 3300028666 Bacteria 238832
210 Ga0307517_10001871 3300028786 Bacteria 34464
211 Ga0307515_10000020 3300028794 Bacteria 411735
212 Ga0307515_10000051 3300028794 Bacteria 272100
213 Ga0307515_10000991 3300028794 Bacteria 64898
214 Ga0307515_10001283 3300028794 Bacteria 57022
215 Ga0307515_10007242 3300028794 Bacteria 21968
216 Ga0307515_10008378 3300028794 Bacteria 20167
217 Ga0307515_10206057 3300028794 Bacteria 1826
218 Ga0307515_10246446 3300028794 Bacteria 1547
219 Ga0265324_10000951 3300029957 Bacteria 18083
220 Ga0307512_10032669 3300030522 Bacteria 4488
221 Ga0314311_1144639 3300030733 Bacteria 4757
222 Ga0316179_1070123 3300030734 Bacteria 2410
223 Ga0316183_1037305 3300030742 Bacteria 2432
224 Ga0265330_10000033 3300031235 Bacteria 126931
225 Ga0265332_10000001 3300031238 Bacteria 863783
226 Ga0265332_10000009 3300031238 Bacteria 295760
227 Ga0265332_10086402 3300031238 Bacteria 1329
228 Ga0265328_10005588 3300031239 Bacteria 5377
229 Ga0265320_10070162 3300031240 Bacteria 1653
230 Ga0265340_10015080 3300031247 Bacteria 4022
231 Ga0265331_10002981 3300031250 Bacteria 11141
232 Ga0265327_10001098 3300031251 Bacteria 37523
233 Ga0265316_10000115 3300031344 Bacteria 86934
234 Ga0307513_10001123 3300031456 Bacteria 38793
235 Ga0307513_10078229 3300031456 Bacteria 3421
236 Ga0307509_10014210 3300031507 Bacteria 9377
237 Ga0307509_10095501 3300031507 Bacteria 3028
238 Ga0307509_10119740 3300031507 Bacteria 2613
239 Ga0307509_10124868 3300031507 Bacteria 2542
240 Ga0307408_100000079 3300031548 Bacteria 108053
241 Ga0307408_100072360 3300031548 Bacteria 2552
242 Ga0307408_100191962 3300031548 Bacteria 1646
243 Ga0307508_10000007 3300031616 Bacteria 268359
244 Ga0307508_10000227 3300031616 Bacteria 68533
245 Ga0307508_10000945 3300031616 Bacteria 33844
246 Ga0307508_10174098 3300031616 Bacteria 1755
247 Ga0307514_10055368 3300031649 Bacteria 3049
248 Ga0307514_10057028 3300031649 Bacteria 2994
249 Ga0265314_10000022 3300031711 Bacteria 297299
250 Ga0265314_10012971 3300031711 Bacteria 6767
251 Ga0307516_10004946 3300031730 Bacteria 16201
252 Ga0307516_10005605 3300031730 Bacteria 14948
253 Ga0307405_10056697 3300031731 Bacteria 2458
254 Ga0307405_10072245 3300031731 Bacteria 2223
255 Ga0307413_10081974 3300031824 Bacteria 2070
256 Ga0307410_10037721 3300031852 Bacteria 3159
257 Ga0307410_10054826 3300031852 Bacteria 2704
258 Ga0307406_10002089 3300031901 Bacteria 10892
259 Ga0307406_10028793 3300031901 Bacteria 3358
260 Ga0307411_10023852 3300032005 Bacteria 3634
261 Ga0307411_10164140 3300032005 Bacteria 1668
262 Ga0307507_10154160 3300033179 Bacteria 1718
263 Ga0307510_10008187 3300033180 Bacteria 12453
264 Ga0307510_10020701 3300033180 Bacteria 7681
265 Ga0373931_0105899 3300035691 Bacteria 1589
266 Ga0395899_0016898 3300037312 Bacteria 5562
267 Ga0395900_0015251 3300037418 Bacteria 7836
268 Ga0395900_0058546 3300037418 Bacteria 3966
269 Ga0395900_0126397 3300037418 Bacteria 2622
270 Ga0395900_0147136 3300037418 Bacteria 2409
271 Ga0395898_0000868 3300037466 Bacteria 49428
272 Ga0395898_0025754 3300037466 Bacteria 5924
273 Ga0395898_0135515 3300037466 Bacteria 2357
274 Ga0395905_0000431 3300037471 Bacteria 58717
275 Ga0395905_0002875 3300037471 Bacteria 18810
276 Ga0395905_0005832 3300037471 Bacteria 12515
277 Ga0395905_0016129 3300037471 Bacteria 7102
278 Ga0395905_0022443 3300037471 Bacteria 5968
279 Ga0395905_0045834 3300037471 Bacteria 4101
280 Ga0395905_0067410 3300037471 Bacteria 3352
281 Ga0395905_0200214 3300037471 Bacteria 1872
282 Ga0395905_0382765 3300037471 Bacteria 1301
283 Ga0395901_0005416 3300038443 Bacteria 12913
284 Ga0395901_0167448 3300038443 Bacteria 2307
285 Ga0395901_0206903 3300038443 Bacteria 2055
286 Ga0436361_0167979 3300039447 Bacteria 86419
287 Ga0436361_0296121 3300039447 Bacteria 160237
288 Ga0436361_0311557 3300039447 Bacteria 5807
289 Ga0436361_0383238 3300039447 Bacteria 5889
290 Ga0436361_0657686 3300039447 Bacteria 74387
291 Ga0436361_0932343 3300039447 Bacteria 25287
292 Ga0451800_1171317 3300041459 Bacteria 2388
293 Ga0451855_0341822 3300041511 Bacteria 1014
294 Ga0439445_0005530 3300042004 Bacteria 2880
295 Ga0439449_0023209 3300042007 Bacteria 2321
296 Ga0439462_0013555 3300042015 Bacteria 2090
297 Ga0450911_000167 3300042115 Bacteria 25715
298 Ga0450911_008451 3300042115 Bacteria 1464
299 Ga0450898_011237 3300042134 Bacteria 1463
300 Ga0466969_0003346 3300044656 Bacteria 8535
301 Ga0466969_0032542 3300044656 Bacteria 2650
302 Ga0466969_0081365 3300044656 Bacteria 1545
303 Ga0466969_0117311 3300044656 Bacteria 1241
304 Ga0466972_0000570 3300044658 Bacteria 17989
305 Ga0466972_0006707 3300044658 Bacteria 5778
306 Ga0453683_0007448 3300044673 Bacteria 7424
307 Ga0466966_0009505 3300044684 Bacteria 6437
308 Ga0466966_0015011 3300044684 Bacteria 5124
309 Ga0466966_0023128 3300044684 Bacteria 4070
310 Ga0466966_0050807 3300044684 Bacteria 2637
311 Ga0466961_0002458 3300044693 Bacteria 11494
312 Ga0466961_0011288 3300044693 Bacteria 5712
313 Ga0466961_0079331 3300044693 Bacteria 2079
314 Ga0466961_0090248 3300044693 Bacteria 1935
315 Ga0466963_0198886 3300044694 Bacteria 1401
316 Ga0466964_0142993 3300044706 Bacteria 1101
317 Ga0453684_0005559 3300044712 Bacteria 24865
318 Ga0453684_0034874 3300044712 Bacteria 6971
319 Ga0466971_0144551 3300044719 Bacteria 1108
320 Ga0466957_0060938 3300044842 Bacteria 2314
321 Ga0466960_0079342 3300044901 Bacteria 1650
322 Ga0466959_0107148 3300045049 Bacteria 1997
323 Ga0451576_0018197 3300045051 Bacteria 7707
324 Ga0451576_0278551 3300045051 Bacteria 1749
325 Ga0451576_0492033 3300045051 Bacteria 1288
326 Ga0466967_0067263 3300045976 Bacteria 3195
327 Ga0495603_0129504 3300046455 Bacteria 1470
328 Ga0495590_0010206 3300046457 Bacteria 3537
329 Ga0495629_0136822 3300046459 Bacteria 1705
330 Ga0495650_0008764 3300046471 Bacteria 5853
331 Ga0495582_0175817 3300046473 Bacteria 1219
332 Ga0495584_0000305 3300046491 Bacteria 34730
333 Ga0495584_0012779 3300046491 Bacteria 4285
334 Ga0495584_0014172 3300046491 Bacteria 4062
335 Ga0495584_0021124 3300046491 Bacteria 3306
336 Ga0495585_0016183 3300046492 Bacteria 4322
337 Ga0495594_0037877 3300046499 Bacteria 2632
338 Ga0495583_0000245 3300046506 Bacteria 89398
339 Ga0495606_0001063 3300046507 Bacteria 39705
340 Ga0495606_0010710 3300046507 Bacteria 7565
341 Ga0495610_0012793 3300046512 Bacteria 5021
342 Ga0495631_0039969 3300046518 Bacteria 2079
343 Ga0495632_0022945 3300046519 Bacteria 3339
344 Ga0495643_0060878 3300046522 Bacteria 2003
345 Ga0495648_0174900 3300046524 Bacteria 1097
346 Ga0495663_0040361 3300046525 Bacteria 1417
347 Ga0495642_0020056 3300046528 Bacteria 2622
348 Ga0495654_0022190 3300046530 Bacteria 3299
349 Ga0495665_0027919 3300046531 Bacteria 3029
350 Ga0495665_0129943 3300046531 Bacteria 1318
351 Ga0495586_0002903 3300046535 Bacteria 9249
352 Ga0495587_0012984 3300046536 Bacteria 5237
353 Ga0495609_0046155 3300046538 Bacteria 1951
354 Ga0495597_0009246 3300046542 Bacteria 4879
355 Ga0495597_0021198 3300046542 Bacteria 3022
356 Ga0495622_0006179 3300046557 Bacteria 5562
357 Ga0495622_0126778 3300046557 Bacteria 1164
358 Ga0495633_0010622 3300046558 Bacteria 5017
359 Ga0495668_0021998 3300046616 Bacteria 3649
360 Ga0495611_0005650 3300046648 Bacteria 5334
361 Ga0495625_0003938 3300046660 Bacteria 14272
362 Ga0495625_0022014 3300046660 Bacteria 4894
363 Ga0495661_0092396 3300046665 Bacteria 1719
364 Ga0495588_0086792 3300046674 Bacteria 1636
365 Ga0495623_0112362 3300046679 Bacteria 1649
366 Ga0495623_0127370 3300046679 Bacteria 1528
367 Ga0495646_0038034 3300046680 Bacteria 2973
368 Ga0495658_0126807 3300046683 Bacteria 1550
369 Ga0495669_0016980 3300046684 Bacteria 3122
370 Ga0495624_0070443 3300046690 Bacteria 2177
371 Ga0495670_0010748 3300046691 Bacteria 4498
372 Ga0495671_0031546 3300046692 Bacteria 2709
373 Ga0495671_0137014 3300046692 Bacteria 1193
374 Ga0495649_0001703 3300046694 Bacteria 16293
375 Ga0495600_0024235 3300046809 Bacteria 3905
376 Ga0495581_0104819 3300047315 Bacteria 1643
377 Ga0495604_0019008 3300047317 Bacteria 5502
378 Ga0495636_0004666 3300047318 Bacteria 5375
379 Ga0495674_0010832 3300047319 Bacteria 8625
380 Ga0495674_0298574 3300047319 Bacteria 1316
381 Ga0495676_0105869 3300047321 Bacteria 2073
382 Ga0495681_0037030 3300047470 Bacteria 2407
383 Ga0495686_0066112 3300047472 Bacteria 2235
384 Ga0495593_0140447 3300047673 Bacteria 1223
385 Ga0495593_0144659 3300047673 Bacteria 1203
386 Ga0495626_0004416 3300048091 Bacteria 8647
387 Ga0495626_0008978 3300048091 Bacteria 5423
388 Ga0496105_0150937 3300048908 Bacteria 1910
389 Ga0496115_0015563 3300048918 Bacteria 5772
390 Ga0496115_0043202 3300048918 Bacteria 3594
391 Ga0496115_0045583 3300048918 Bacteria 3501
392 Ga0496121_0026536 3300048924 Bacteria 5454
393 Ga0496122_0036349 3300048925 Bacteria 3984
394 Ga0496123_0038943 3300048926 Bacteria 3332
395 Ga0496123_0107472 3300048926 Bacteria 1605
396 Ga0496124_0000317 3300048927 Bacteria 89188
397 Ga0496124_0089694 3300048927 Bacteria 2510
398 Ga0496125_0000812 3300048928 Bacteria 50762
399 Ga0496125_0004097 3300048928 Bacteria 17057
400 Ga0496125_0007837 3300048928 Bacteria 11286
401 Ga0496125_0022403 3300048928 Bacteria 5867
402 Ga0496125_0079090 3300048928 Bacteria 2524
403 Ga0496126_0030775 3300048929 Bacteria 5081
404 Ga0496126_0044430 3300048929 Bacteria 4092
405 Ga0501034_0197322 3300049571 Bacteria 1972
406 Ga0501043_0022740 3300049579 Bacteria 4917
407 Ga0501046_0044252 3300049580 Bacteria 3541
408 Ga0501198_000005 3300049649 Bacteria 156657
409 Ga0501222_000003 3300049662 Bacteria 157406
410 Ga0501249_004687 3300049679 Bacteria 2782
411 Ga0501262_000342 3300049759 Bacteria 5654
412 Ga0501266_000446 3300049763 Bacteria 5442
413 Ga0501044_0074406 3300049823 Bacteria 3451
414 nmdc:mga03683_39112_c1 3300050489 Bacteria 1940
415 nmdc:mga00v17_41021_c1 3300050491 Bacteria 2778
416 nmdc:mga0k408_103242_c1 3300050493 Bacteria 1682
417 nmdc:mga0k408_182605_c1 3300050493 Bacteria 1251
418 nmdc:mga0k408_294133_c1 3300050493 Bacteria 969
419 nmdc:mga0k408_3614_c1 3300050493 Bacteria 8180
420 nmdc:mga0k408_42211_c1 3300050493 Bacteria 2627
421 nmdc:mga0k408_6608_c1 3300050493 Bacteria 6180
422 nmdc:mga06z11_30996_c1 3300050494 Bacteria 2593
423 nmdc:mga07m45_578_c1 3300050496 Bacteria 7656
424 nmdc:mga07m45_7805_c1 3300050496 Bacteria 5476
425 nmdc:mga07m45_8912_c1 3300050496 Bacteria 5181
426 nmdc:mga07m45_9857_c1 3300050496 Bacteria 4968
427 nmdc:mga05p37_87741_c1 3300050507 Bacteria 3834
428 Ga0500635_0000265 3300053080 Bacteria 20897
429 Ga0500635_0065489 3300053080 Bacteria 1278
430 Ga0500644_0013437 3300053088 Bacteria 2287
431 Ga0500644_0065044 3300053088 Bacteria 1297
432 Ga0500651_0018498 3300053093 Bacteria 4313
433 Ga0500651_0033728 3300053093 Bacteria 3227
434 Ga0500562_010037 3300053108 Bacteria 2396
435 Ga0500652_024600 3300053131 Bacteria 2300
436 Ga0500559_0000141 3300053136 Bacteria 56026
437 Ga0500559_0060991 3300053136 Bacteria 1681
438 Ga0500559_0137323 3300053136 Bacteria 1144
439 Ga0500622_0042102 3300053156 Bacteria 2374
440 Ga0500636_0023334 3300053177 Bacteria 3659
441 Ga0500587_000298 3300053739 Bacteria 5554
442 Ga0590071_011447 3300059421 Bacteria 2075
443 Ga0590075_017231 3300059424 Bacteria 1780
444 Ga0590077_026602 3300059426 Bacteria 1251
445 Ga0466962_0012970 3300061719 Bacteria 4009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0066112 Ga0495686_0066112_12_821 265
2 3300050493 nmdc:mga0k408_294133_c1 nmdc:mga0k408_294133_c1_130_957 266
3 3300009176 Ga0105242_10135941 Ga0105242_101359412 279
4 3300026121 Ga0207683_10163110 Ga0207683_101631102 283
5 3300025940 Ga0207691_10054596 Ga0207691_100545962 286
6 3300032005 Ga0307411_10164140 Ga0307411_101641402 292
7 3300014968 Ga0157379_10016805 Ga0157379_100168053 294
8 3300059421 Ga0590071_011447 Ga0590071_011447_866_1819 294
9 3300031507 Ga0307509_10095501 Ga0307509_100955012 295
10 3300031507 Ga0307509_10124868 Ga0307509_101248682 296
11 3300044656 Ga0466969_0117311 Ga0466969_0117311_108_1019 296
12 3300046522 Ga0495643_0060878 Ga0495643_0060878_947_1936 296
13 3300025972 Ga0207668_10204384 Ga0207668_102043842 297
14 3300046692 Ga0495671_0137014 Ga0495671_0137014_12_938 298
15 iso_pu_bacteria 2643221596 2643991216 298
16 iso_pu_bacteria 2643221609 2644059886 298
17 iso_pu_bacteria 2643221652 2644293910 298
18 3300027876 Ga0209974_10028570 Ga0209974_100285701 302
19 3300046455 Ga0495603_0129504 Ga0495603_0129504_32_988 302
20 3300046459 Ga0495629_0136822 Ga0495629_0136822_503_1459 302
21 3300046473 Ga0495582_0175817 Ga0495582_0175817_32_988 302
22 3300046491 Ga0495584_0000305 Ga0495584_0000305_22597_23553 302
23 3300046491 Ga0495584_0012779 Ga0495584_0012779_1208_2164 302
24 3300046491 Ga0495584_0014172 Ga0495584_0014172_1561_2517 302
25 3300046491 Ga0495584_0021124 Ga0495584_0021124_2091_3047 302
26 3300046492 Ga0495585_0016183 Ga0495585_0016183_731_1687 302
27 3300046499 Ga0495594_0037877 Ga0495594_0037877_1040_1996 302
28 3300046507 Ga0495606_0010710 Ga0495606_0010710_534_1490 302
29 3300046518 Ga0495631_0039969 Ga0495631_0039969_208_1164 302
30 3300046525 Ga0495663_0040361 Ga0495663_0040361_446_1402 302
31 3300046528 Ga0495642_0020056 Ga0495642_0020056_359_1315 302
32 3300046531 Ga0495665_0027919 Ga0495665_0027919_700_1656 302
33 3300046531 Ga0495665_0129943 Ga0495665_0129943_114_1070 302
34 3300046535 Ga0495586_0002903 Ga0495586_0002903_7194_8150 302
35 3300046536 Ga0495587_0012984 Ga0495587_0012984_299_1255 302
36 3300046538 Ga0495609_0046155 Ga0495609_0046155_272_1228 302
37 3300046542 Ga0495597_0009246 Ga0495597_0009246_3803_4759 302
38 3300046542 Ga0495597_0021198 Ga0495597_0021198_438_1394 302
39 3300046557 Ga0495622_0006179 Ga0495622_0006179_3949_4905 302
40 3300046648 Ga0495611_0005650 Ga0495611_0005650_121_1077 302
41 3300046665 Ga0495661_0092396 Ga0495661_0092396_17_973 302
42 3300046674 Ga0495588_0086792 Ga0495588_0086792_404_1360 302
43 3300046679 Ga0495623_0112362 Ga0495623_0112362_503_1459 302
44 3300046679 Ga0495623_0127370 Ga0495623_0127370_426_1382 302
45 3300046691 Ga0495670_0010748 Ga0495670_0010748_3497_4453 302
46 3300046692 Ga0495671_0031546 Ga0495671_0031546_377_1333 302
47 3300046809 Ga0495600_0024235 Ga0495600_0024235_895_1851 302
48 3300047315 Ga0495581_0104819 Ga0495581_0104819_107_1063 302
49 3300047317 Ga0495604_0019008 Ga0495604_0019008_1283_2239 302
50 3300047318 Ga0495636_0004666 Ga0495636_0004666_4043_4999 302
51 3300047319 Ga0495674_0010832 Ga0495674_0010832_1089_2045 302
52 3300047319 Ga0495674_0298574 Ga0495674_0298574_245_1201 302
53 3300047321 Ga0495676_0105869 Ga0495676_0105869_23_979 302
54 3300047470 Ga0495681_0037030 Ga0495681_0037030_372_1328 302
55 3300047673 Ga0495593_0140447 Ga0495593_0140447_123_1079 302
56 3300047673 Ga0495593_0144659 Ga0495593_0144659_115_1071 302
57 3300048091 Ga0495626_0004416 Ga0495626_0004416_1240_2196 302
58 3300048091 Ga0495626_0008978 Ga0495626_0008978_505_1461 302
59 3300048918 Ga0496115_0015563 Ga0496115_0015563_2690_3646 302
60 3300048918 Ga0496115_0043202 Ga0496115_0043202_1954_2910 302
61 3300048918 Ga0496115_0045583 Ga0496115_0045583_452_1417 302
62 3300003578 Ga0006562J51391_1061276 Ga0006562J51391_10612762 304
63 3300025226 Ga0209674_101662 Ga0209674_1016626 304
64 3300037418 Ga0395900_0058546 Ga0395900_0058546_245_1258 304
65 3300031548 Ga0307408_100000079 Ga0307408_1000000798 307
66 3300031901 Ga0307406_10002089 Ga0307406_100020895 307
67 3300005563 Ga0068855_100095783 Ga0068855_1000957834 308
68 3300037418 Ga0395900_0015251 Ga0395900_0015251_1854_2798 308
69 3300037466 Ga0395898_0025754 Ga0395898_0025754_4403_5347 308
70 3300037471 Ga0395905_0016129 Ga0395905_0016129_3804_4748 308
71 3300044673 Ga0453683_0007448 Ga0453683_0007448_4156_5121 308
72 3300045051 Ga0451576_0018197 Ga0451576_0018197_2653_3618 308
73 iso_pu_bacteria 2643221660 2644337598 308
74 iso_pu_bacteria 2585428062 2587755589 309
75 iso_pu_bacteria 2643221639 2644221390 309
76 iso_pu_bacteria 2643221646 2644257853 309
77 iso_pu_bacteria 2904479285 2904479998 310
78 3300048924 Ga0496121_0026536 Ga0496121_0026536_3525_4505 311
79 3300048927 Ga0496124_0000317 Ga0496124_0000317_23360_24322 311
80 3300048928 Ga0496125_0022403 Ga0496125_0022403_1948_2910 311
81 3300005456 Ga0070678_100128147 Ga0070678_1001281473 312
82 3300009147 Ga0114129_10104062 Ga0114129_101040624 312
83 3300037471 Ga0395905_0002875 Ga0395905_0002875_6701_7657 312
84 3300046471 Ga0495650_0008764 Ga0495650_0008764_3985_4941 312
85 3300050507 nmdc:mga05p37_87741_c1 nmdc:mga05p37_87741_c1_1929_2885 312
86 3300003794 Ga0055531_10000051 Ga0055531_1000005164 313
87 3300005457 Ga0070662_100055941 Ga0070662_1000559414 313
88 3300006177 Ga0075362_10132251 Ga0075362_101322511 313
89 3300006177 Ga0075362_10152263 Ga0075362_101522632 313
90 3300006178 Ga0075367_10066519 Ga0075367_100665193 313
91 3300006195 Ga0075366_10001775 Ga0075366_100017758 313
92 3300006195 Ga0075366_10042380 Ga0075366_100423803 313
93 3300021361 Ga0213872_10000011 Ga0213872_1000001169 313
94 3300025298 Ga0209050_1003330 Ga0209050_10033308 313
95 3300025303 Ga0209051_1004802 Ga0209051_10048024 313
96 3300025304 Ga0209257_1000017 Ga0209257_1000017772 313
97 3300025933 Ga0207706_10017618 Ga0207706_100176186 313
98 3300026078 Ga0207702_10260757 Ga0207702_102607572 313
99 3300026142 Ga0207698_10391690 Ga0207698_103916902 313
100 3300028794 Ga0307515_10000020 Ga0307515_10000020235 313
101 3300028794 Ga0307515_10000051 Ga0307515_10000051266 313
102 3300028794 Ga0307515_10000991 Ga0307515_1000099151 313
103 3300028794 Ga0307515_10008378 Ga0307515_1000837812 313
104 3300030522 Ga0307512_10032669 Ga0307512_100326694 313
105 3300031239 Ga0265328_10005588 Ga0265328_100055886 313
106 3300031250 Ga0265331_10002981 Ga0265331_1000298111 313
107 3300031251 Ga0265327_10001098 Ga0265327_1000109825 313
108 3300031456 Ga0307513_10001123 Ga0307513_1000112329 313
109 3300031548 Ga0307408_100191962 Ga0307408_1001919623 313
110 3300031616 Ga0307508_10000007 Ga0307508_1000000739 313
111 3300031649 Ga0307514_10055368 Ga0307514_100553682 313
112 3300031730 Ga0307516_10004946 Ga0307516_1000494612 313
113 3300037466 Ga0395898_0000868 Ga0395898_0000868_39348_40319 313
114 3300037471 Ga0395905_0005832 Ga0395905_0005832_2561_3517 313
115 3300039447 Ga0436361_0296121 Ga0436361_0296121_18330_19301 313
116 3300041459 Ga0451800_1171317 Ga0451800_1171317_177_1133 313
117 3300041511 Ga0451855_0341822 Ga0451855_0341822_24_980 313
118 3300042134 Ga0450898_011237 Ga0450898_011237_130_1086 313
119 3300044656 Ga0466969_0032542 Ga0466969_0032542_1306_2280 313
120 3300044656 Ga0466969_0081365 Ga0466969_0081365_89_1048 313
121 3300044658 Ga0466972_0000570 Ga0466972_0000570_16944_17900 313
122 3300044658 Ga0466972_0006707 Ga0466972_0006707_2987_3943 313
123 3300044684 Ga0466966_0009505 Ga0466966_0009505_4165_5124 313
124 3300044684 Ga0466966_0023128 Ga0466966_0023128_187_1152 313
125 3300044693 Ga0466961_0002458 Ga0466961_0002458_7961_8920 313
126 3300044693 Ga0466961_0090248 Ga0466961_0090248_394_1359 313
127 3300044694 Ga0466963_0198886 Ga0466963_0198886_425_1384 313
128 3300044706 Ga0466964_0142993 Ga0466964_0142993_17_976 313
129 3300044712 Ga0453684_0005559 Ga0453684_0005559_18736_19704 313
130 3300044712 Ga0453684_0034874 Ga0453684_0034874_691_1647 313
131 3300044719 Ga0466971_0144551 Ga0466971_0144551_98_1072 313
132 3300044842 Ga0466957_0060938 Ga0466957_0060938_122_1081 313
133 3300044901 Ga0466960_0079342 Ga0466960_0079342_437_1405 313
134 3300045049 Ga0466959_0107148 Ga0466959_0107148_614_1573 313
135 3300045051 Ga0451576_0492033 Ga0451576_0492033_156_1112 313
136 3300045976 Ga0466967_0067263 Ga0466967_0067263_620_1579 313
137 3300046512 Ga0495610_0012793 Ga0495610_0012793_523_1479 313
138 3300046519 Ga0495632_0022945 Ga0495632_0022945_1535_2491 313
139 3300046524 Ga0495648_0174900 Ga0495648_0174900_32_988 313
140 3300046660 Ga0495625_0022014 Ga0495625_0022014_1200_2156 313
141 3300049649 Ga0501198_000005 Ga0501198_000005_130138_131106 313
142 3300049662 Ga0501222_000003 Ga0501222_000003_130887_131855 313
143 3300050489 nmdc:mga03683_39112_c1 nmdc:mga03683_39112_c1_26_994 313
144 3300050493 nmdc:mga0k408_182605_c1 nmdc:mga0k408_182605_c1_214_1182 313
145 3300050493 nmdc:mga0k408_3614_c1 nmdc:mga0k408_3614_c1_2648_3616 313
146 3300050493 nmdc:mga0k408_42211_c1 nmdc:mga0k408_42211_c1_1060_2016 313
147 3300053739 Ga0500587_000298 Ga0500587_000298_2327_3283 313
148 3300059424 Ga0590075_017231 Ga0590075_017231_271_1230 313
149 3300059426 Ga0590077_026602 Ga0590077_026602_201_1160 313
150 3300061719 Ga0466962_0012970 Ga0466962_0012970_2689_3663 313
151 3300003215 JGI25153J46596_10005247 JGI25153J46596_100052474 314
152 3300005331 Ga0070670_100049613 Ga0070670_1000496133 314
153 3300005334 Ga0068869_100013561 Ga0068869_1000135612 314
154 3300005338 Ga0068868_100018577 Ga0068868_1000185774 314
155 3300005354 Ga0070675_100005184 Ga0070675_1000051844 314
156 3300005355 Ga0070671_100049582 Ga0070671_1000495822 314
157 3300005364 Ga0070673_100031808 Ga0070673_1000318084 314
158 3300005367 Ga0070667_100175874 Ga0070667_1001758742 314
159 3300005457 Ga0070662_100273023 Ga0070662_1002730232 314
160 3300005459 Ga0068867_100002841 Ga0068867_10000284111 314
161 3300005543 Ga0070672_100100210 Ga0070672_1001002103 314
162 3300005577 Ga0068857_100176495 Ga0068857_1001764952 314
163 3300005840 Ga0068870_10031217 Ga0068870_100312173 314
164 3300005841 Ga0068863_100482481 Ga0068863_1004824812 314
165 3300005844 Ga0068862_100336055 Ga0068862_1003360552 314
166 3300006178 Ga0075367_10063374 Ga0075367_100633742 314
167 3300006195 Ga0075366_10012381 Ga0075366_100123814 314
168 3300006353 Ga0075370_10072478 Ga0075370_100724782 314
169 3300009098 Ga0105245_10030579 Ga0105245_100305793 314
170 3300009148 Ga0105243_10160714 Ga0105243_101607142 314
171 3300009545 Ga0105237_10036055 Ga0105237_100360556 314
172 3300021361 Ga0213872_10000172 Ga0213872_100001726 314
173 3300025297 Ga0209758_1000045 Ga0209758_1000045236 314
174 3300025907 Ga0207645_10021380 Ga0207645_100213804 314
175 3300025908 Ga0207643_10037250 Ga0207643_100372502 314
176 3300025925 Ga0207650_10069254 Ga0207650_100692543 314
177 3300025926 Ga0207659_10006295 Ga0207659_100062954 314
178 3300025927 Ga0207687_10246298 Ga0207687_102462982 314
179 3300025933 Ga0207706_10323890 Ga0207706_103238902 314
180 3300025935 Ga0207709_10151732 Ga0207709_101517322 314
181 3300025940 Ga0207691_10007915 Ga0207691_100079153 314
182 3300025942 Ga0207689_10014862 Ga0207689_100148624 314
183 3300025960 Ga0207651_10006687 Ga0207651_100066877 314
184 3300026023 Ga0207677_10020394 Ga0207677_100203942 314
185 3300026088 Ga0207641_10079866 Ga0207641_100798663 314
186 3300026089 Ga0207648_10010781 Ga0207648_100107814 314
187 3300026116 Ga0207674_10008218 Ga0207674_1000821810 314
188 3300028786 Ga0307517_10001871 Ga0307517_1000187111 314
189 3300031235 Ga0265330_10000033 Ga0265330_1000003368 314
190 3300031238 Ga0265332_10000001 Ga0265332_10000001192 314
191 3300031240 Ga0265320_10070162 Ga0265320_100701622 314
192 3300031247 Ga0265340_10015080 Ga0265340_100150803 314
193 3300031456 Ga0307513_10078229 Ga0307513_100782295 314
194 3300031507 Ga0307509_10014210 Ga0307509_100142108 314
195 3300031507 Ga0307509_10119740 Ga0307509_101197402 314
196 3300031616 Ga0307508_10000227 Ga0307508_1000022727 314
197 3300031616 Ga0307508_10000945 Ga0307508_1000094533 314
198 3300031616 Ga0307508_10174098 Ga0307508_101740982 314
199 3300031649 Ga0307514_10057028 Ga0307514_100570282 314
200 3300031711 Ga0265314_10000022 Ga0265314_10000022197 314
201 3300033179 Ga0307507_10154160 Ga0307507_101541601 314
202 3300033180 Ga0307510_10008187 Ga0307510_100081873 314
203 3300033180 Ga0307510_10020701 Ga0307510_100207014 314
204 3300039447 Ga0436361_0167979 Ga0436361_0167979_42583_43557 314
205 3300039447 Ga0436361_0383238 Ga0436361_0383238_4666_5640 314
206 3300046557 Ga0495622_0126778 Ga0495622_0126778_46_1020 314
207 3300046680 Ga0495646_0038034 Ga0495646_0038034_1918_2892 314
208 3300046683 Ga0495658_0126807 Ga0495658_0126807_278_1252 314
209 3300046690 Ga0495624_0070443 Ga0495624_0070443_668_1642 314
210 3300049579 Ga0501043_0022740 Ga0501043_0022740_2302_3264 314
211 3300049580 Ga0501046_0044252 Ga0501046_0044252_1611_2573 314
212 3300049823 Ga0501044_0074406 Ga0501044_0074406_115_1077 314
213 3300050493 nmdc:mga0k408_6608_c1 nmdc:mga0k408_6608_c1_1396_2406 314
214 3300050496 nmdc:mga07m45_9857_c1 nmdc:mga07m45_9857_c1_453_1427 314
215 3300053088 Ga0500644_0065044 Ga0500644_0065044_138_1112 314
216 3300053093 Ga0500651_0018498 Ga0500651_0018498_211_1185 314
217 3300053093 Ga0500651_0033728 Ga0500651_0033728_1383_2357 314
218 3300053131 Ga0500652_024600 Ga0500652_024600_144_1118 314
219 3300053136 Ga0500559_0000141 Ga0500559_0000141_53341_54315 314
220 3300053156 Ga0500622_0042102 Ga0500622_0042102_155_1129 314
221 iso_pu_bacteria 2547132374 2548500106 314
222 iso_pu_bacteria 2643221570 2643864854 314
223 iso_pu_bacteria 2643221717 2644644574 314
224 iso_pu_bacteria 2738543012 2739241411 314
225 iso_pu_bacteria 2816332133 2816473575 314
226 iso_pu_bacteria 2842718218 2842719019 314
227 iso_pu_bacteria 2974320154 2974324355 314
228 iso_pu_bacteria 2990710928 2990711701 314
229 3300006038 Ga0075365_10173261 Ga0075365_101732612 315
230 3300006353 Ga0075370_10022729 Ga0075370_100227292 315
231 3300025273 Ga0209673_1033474 Ga0209673_10334743 315
232 3300025303 Ga0209051_1000320 Ga0209051_100032038 315
233 3300025304 Ga0209257_1000161 Ga0209257_100016197 315
234 3300028794 Ga0307515_10007242 Ga0307515_1000724210 315
235 3300031730 Ga0307516_10005605 Ga0307516_100056055 315
236 3300042007 Ga0439449_0023209 Ga0439449_0023209_795_1811 315
237 3300042015 Ga0439462_0013555 Ga0439462_0013555_645_1667 315
238 3300042115 Ga0450911_008451 Ga0450911_008451_27_1001 315
239 3300050496 nmdc:mga07m45_7805_c1 nmdc:mga07m45_7805_c1_1593_2555 315
240 iso_pu_bacteria 2721755523 2722882378 315
241 iso_pu_bacteria 2839138175 2839142155 315
242 iso_pu_bacteria 2842677519 2842682601 315
243 iso_pu_bacteria 2919462493 2919464020 315
244 3300003759 Ga0055525_1000021 Ga0055525_10000217 316
245 3300003761 Ga0055535_1000167 Ga0055535_100016714 316
246 3300003763 Ga0055529_1000151 Ga0055529_100015122 316
247 3300021361 Ga0213872_10000359 Ga0213872_1000035920 316
248 3300025242 Ga0209258_100146 Ga0209258_10014630 316
249 3300025254 Ga0209148_1015030 Ga0209148_10150302 316
250 3300025256 Ga0209759_1000855 Ga0209759_100085515 316
251 3300025256 Ga0209759_1020127 Ga0209759_10201271 316
252 3300025272 Ga0209455_1000059 Ga0209455_100005930 316
253 3300025909 Ga0207705_10012186 Ga0207705_100121865 316
254 3300028666 Ga0265336_10000016 Ga0265336_10000016166 316
255 3300028794 Ga0307515_10001283 Ga0307515_1000128319 316
256 3300029957 Ga0265324_10000951 Ga0265324_100009516 316
257 3300037471 Ga0395905_0067410 Ga0395905_0067410_2108_3073 316
258 3300037471 Ga0395905_0200214 Ga0395905_0200214_397_1362 316
259 3300037471 Ga0395905_0382765 Ga0395905_0382765_269_1219 316
260 3300039447 Ga0436361_0311557 Ga0436361_0311557_4632_5582 316
261 3300039447 Ga0436361_0657686 Ga0436361_0657686_10551_11516 316
262 3300045051 Ga0451576_0278551 Ga0451576_0278551_689_1675 316
263 3300046457 Ga0495590_0010206 Ga0495590_0010206_160_1125 316
264 3300046530 Ga0495654_0022190 Ga0495654_0022190_351_1334 316
265 3300053080 Ga0500635_0000265 Ga0500635_0000265_9457_10407 316
266 3300053136 Ga0500559_0060991 Ga0500559_0060991_61_1011 316
267 3300053136 Ga0500559_0137323 Ga0500559_0137323_82_1065 316
268 3300005290 Ga0065712_10127186 Ga0065712_101271861 317
269 3300005328 Ga0070676_10035705 Ga0070676_100357053 317
270 3300005328 Ga0070676_10051762 Ga0070676_100517622 317
271 3300005331 Ga0070670_100049753 Ga0070670_1000497532 317
272 3300005333 Ga0070677_10005435 Ga0070677_100054352 317
273 3300005338 Ga0068868_100065930 Ga0068868_1000659303 317
274 3300005347 Ga0070668_100279471 Ga0070668_1002794711 317
275 3300005353 Ga0070669_100006105 Ga0070669_1000061058 317
276 3300005354 Ga0070675_100001535 Ga0070675_10000153511 317
277 3300005355 Ga0070671_100028948 Ga0070671_1000289482 317
278 3300005355 Ga0070671_100130598 Ga0070671_1001305982 317
279 3300005356 Ga0070674_100009036 Ga0070674_1000090361 317
280 3300005356 Ga0070674_100014666 Ga0070674_1000146665 317
281 3300005364 Ga0070673_100013924 Ga0070673_1000139244 317
282 3300005459 Ga0068867_100002971 Ga0068867_10000297111 317
283 3300005459 Ga0068867_100035680 Ga0068867_1000356802 317
284 3300005543 Ga0070672_100002062 Ga0070672_1000020623 317
285 3300005564 Ga0070664_100169409 Ga0070664_1001694092 317
286 3300005578 Ga0068854_100175533 Ga0068854_1001755332 317
287 3300005840 Ga0068870_10034692 Ga0068870_100346922 317
288 3300006358 Ga0068871_100007609 Ga0068871_1000076093 317
289 3300006881 Ga0068865_100039848 Ga0068865_1000398482 317
290 3300013308 Ga0157375_10220662 Ga0157375_102206622 317
291 3300017792 Ga0163161_10053518 Ga0163161_100535182 317
292 3300025303 Ga0209051_1004347 Ga0209051_10043475 317
293 3300025893 Ga0207682_10001523 Ga0207682_100015233 317
294 3300025907 Ga0207645_10008686 Ga0207645_100086867 317
295 3300025907 Ga0207645_10050483 Ga0207645_100504832 317
296 3300025923 Ga0207681_10071740 Ga0207681_100717402 317
297 3300025925 Ga0207650_10002460 Ga0207650_1000246011 317
298 3300025926 Ga0207659_10001118 Ga0207659_1000111811 317
299 3300025931 Ga0207644_10034911 Ga0207644_100349113 317
300 3300025938 Ga0207704_10039057 Ga0207704_100390572 317
301 3300025940 Ga0207691_10006082 Ga0207691_1000608211 317
302 3300025945 Ga0207679_10013263 Ga0207679_100132633 317
303 3300025945 Ga0207679_10145579 Ga0207679_101455792 317
304 3300025960 Ga0207651_10008923 Ga0207651_100089233 317
305 3300026023 Ga0207677_10085330 Ga0207677_100853302 317
306 3300026023 Ga0207677_10086774 Ga0207677_100867742 317
307 3300026041 Ga0207639_10163917 Ga0207639_101639173 317
308 3300026089 Ga0207648_10002848 Ga0207648_100028488 317
309 3300026089 Ga0207648_10026360 Ga0207648_100263606 317
310 3300026121 Ga0207683_10006663 Ga0207683_100066633 317
311 3300027614 Ga0209970_1001451 Ga0209970_10014512 317
312 3300031344 Ga0265316_10000115 Ga0265316_1000011576 317
313 3300031548 Ga0307408_100072360 Ga0307408_1000723602 317
314 3300031731 Ga0307405_10056697 Ga0307405_100566972 317
315 3300031731 Ga0307405_10072245 Ga0307405_100722453 317
316 3300031824 Ga0307413_10081974 Ga0307413_100819741 317
317 3300031852 Ga0307410_10037721 Ga0307410_100377212 317
318 3300031852 Ga0307410_10054826 Ga0307410_100548262 317
319 3300031901 Ga0307406_10028793 Ga0307406_100287931 317
320 3300032005 Ga0307411_10023852 Ga0307411_100238523 317
321 3300044656 Ga0466969_0003346 Ga0466969_0003346_335_1306 317
322 3300044684 Ga0466966_0015011 Ga0466966_0015011_3548_4519 317
323 3300044693 Ga0466961_0011288 Ga0466961_0011288_1529_2500 317
324 3300049571 Ga0501034_0197322 Ga0501034_0197322_570_1556 317
325 3300003784 Ga0055534_1002844 Ga0055534_10028444 318
326 3300005327 Ga0070658_10071311 Ga0070658_100713112 318
327 3300005331 Ga0070670_100060956 Ga0070670_1000609563 318
328 3300005338 Ga0068868_100005383 Ga0068868_1000053835 318
329 3300005456 Ga0070678_100100359 Ga0070678_1001003593 318
330 3300005548 Ga0070665_100008010 Ga0070665_10000801011 318
331 3300005563 Ga0068855_100097233 Ga0068855_1000972333 318
332 3300005844 Ga0068862_100312604 Ga0068862_1003126042 318
333 3300006048 Ga0075363_100053323 Ga0075363_1000533232 318
334 3300006195 Ga0075366_10010236 Ga0075366_100102366 318
335 3300006195 Ga0075366_10014071 Ga0075366_100140715 318
336 3300006353 Ga0075370_10012283 Ga0075370_100122835 318
337 3300009093 Ga0105240_10003241 Ga0105240_1000324116 318
338 3300009176 Ga0105242_10000656 Ga0105242_1000065619 318
339 3300009176 Ga0105242_10600316 Ga0105242_106003161 318
340 3300009177 Ga0105248_10443335 Ga0105248_104433351 318
341 3300013306 Ga0163162_10108773 Ga0163162_101087734 318
342 3300025284 Ga0209130_1001702 Ga0209130_100170216 318
343 3300025291 Ga0209675_1002145 Ga0209675_10021459 318
344 3300025292 Ga0209676_1034220 Ga0209676_10342202 318
345 3300025294 Ga0209025_1028509 Ga0209025_10285094 318
346 3300025298 Ga0209050_1027799 Ga0209050_10277992 318
347 3300025303 Ga0209051_1003268 Ga0209051_10032684 318
348 3300025909 Ga0207705_10084335 Ga0207705_100843352 318
349 3300025913 Ga0207695_10242082 Ga0207695_102420822 318
350 3300025921 Ga0207652_10171367 Ga0207652_101713672 318
351 3300025934 Ga0207686_10024745 Ga0207686_100247454 318
352 3300025937 Ga0207669_10078565 Ga0207669_100785652 318
353 3300025949 Ga0207667_10025190 Ga0207667_100251906 318
354 3300026023 Ga0207677_10002779 Ga0207677_100027796 318
355 3300026121 Ga0207683_10098567 Ga0207683_100985673 318
356 3300028379 Ga0268266_10048458 Ga0268266_100484583 318
357 3300028380 Ga0268265_10343402 Ga0268265_103434022 318
358 3300028794 Ga0307515_10206057 Ga0307515_102060572 318
359 3300031238 Ga0265332_10000009 Ga0265332_10000009191 318
360 3300031238 Ga0265332_10086402 Ga0265332_100864021 318
361 3300031711 Ga0265314_10012971 Ga0265314_100129717 318
362 3300035691 Ga0373931_0105899 Ga0373931_0105899_221_1210 318
363 3300037312 Ga0395899_0016898 Ga0395899_0016898_1090_2064 318
364 3300037418 Ga0395900_0126397 Ga0395900_0126397_1072_2046 318
365 3300037418 Ga0395900_0147136 Ga0395900_0147136_485_1462 318
366 3300037466 Ga0395898_0135515 Ga0395898_0135515_885_1859 318
367 3300037471 Ga0395905_0000431 Ga0395905_0000431_49968_50942 318
368 3300037471 Ga0395905_0022443 Ga0395905_0022443_4157_5131 318
369 3300037471 Ga0395905_0045834 Ga0395905_0045834_2070_3044 318
370 3300038443 Ga0395901_0167448 Ga0395901_0167448_1152_2129 318
371 3300038443 Ga0395901_0206903 Ga0395901_0206903_568_1542 318
372 3300039447 Ga0436361_0932343 Ga0436361_0932343_13540_14541 318
373 3300044684 Ga0466966_0050807 Ga0466966_0050807_500_1474 318
374 3300044693 Ga0466961_0079331 Ga0466961_0079331_816_1790 318
375 3300046558 Ga0495633_0010622 Ga0495633_0010622_1111_2100 318
376 3300048926 Ga0496123_0107472 Ga0496123_0107472_21_1010 318
377 3300048928 Ga0496125_0079090 Ga0496125_0079090_684_1673 318
378 3300049763 Ga0501266_000446 Ga0501266_000446_2447_3439 318
379 3300050491 nmdc:mga00v17_41021_c1 nmdc:mga00v17_41021_c1_1377_2366 318
380 3300050493 nmdc:mga0k408_103242_c1 nmdc:mga0k408_103242_c1_24_1013 318
381 3300050494 nmdc:mga06z11_30996_c1 nmdc:mga06z11_30996_c1_479_1468 318
382 3300050496 nmdc:mga07m45_8912_c1 nmdc:mga07m45_8912_c1_1099_2088 318
383 iso_pu_bacteria 2643221611 2644074493 318
384 iso_pu_bacteria 2738543013 2739249872 318
385 iso_pu_bacteria 2932422444 2932425095 318
386 3300005289 Ga0065704_10123419 Ga0065704_101234192 319
387 3300006946 Ga0079104_1000002 Ga0079104_1000002172 319
388 3300009092 Ga0105250_10001691 Ga0105250_100016915 319
389 3300009148 Ga0105243_10004780 Ga0105243_100047804 319
390 3300025935 Ga0207709_10000015 Ga0207709_10000015165 319
391 3300026041 Ga0207639_10139682 Ga0207639_101396822 319
392 3300027111 Ga0209281_1000007 Ga0209281_1000007390 319
393 3300028794 Ga0307515_10246446 Ga0307515_102464462 319
394 3300030733 Ga0314311_1144639 Ga0314311_11446394 319
395 3300030734 Ga0316179_1070123 Ga0316179_10701232 319
396 3300030742 Ga0316183_1037305 Ga0316183_10373052 319
397 3300042004 Ga0439445_0005530 Ga0439445_0005530_336_1343 319
398 3300042115 Ga0450911_000167 Ga0450911_000167_21013_22020 319
399 3300048925 Ga0496122_0036349 Ga0496122_0036349_2014_3009 319
400 3300048926 Ga0496123_0038943 Ga0496123_0038943_726_1721 319
401 3300048927 Ga0496124_0089694 Ga0496124_0089694_535_1530 319
402 3300048928 Ga0496125_0000812 Ga0496125_0000812_48054_49049 319
403 3300048928 Ga0496125_0004097 Ga0496125_0004097_13767_14774 319
404 3300048928 Ga0496125_0007837 Ga0496125_0007837_1933_2940 319
405 3300048929 Ga0496126_0030775 Ga0496126_0030775_2364_3359 319
406 3300048929 Ga0496126_0044430 Ga0496126_0044430_299_1306 319
407 3300049679 Ga0501249_004687 Ga0501249_004687_1224_2234 319
408 3300049759 Ga0501262_000342 Ga0501262_000342_4435_5445 319
409 3300053088 Ga0500644_0013437 Ga0500644_0013437_1106_2125 319
410 3300053108 Ga0500562_010037 Ga0500562_010037_615_1634 319
411 3300002705 JGI25156J39149_1000107 JGI25156J39149_100010745 320
412 3300002705 JGI25156J39149_1000421 JGI25156J39149_100042111 320
413 3300002738 JGI25154J39366_1000529 JGI25154J39366_10005293 320
414 3300002741 JGI25157J39369_1000020 JGI25157J39369_1000020101 320
415 3300003316 rootH1_10014123 rootH1_100141236 320
416 3300003323 rootH1_10001754 rootH1_100017544 320
417 3300003752 Ga0055539_1000155 Ga0055539_100015512 320
418 3300003756 Ga0055533_1000028 Ga0055533_100002897 320
419 3300003759 Ga0055525_1000795 Ga0055525_10007956 320
420 3300005327 Ga0070658_10012989 Ga0070658_100129893 320
421 3300005329 Ga0070683_100122677 Ga0070683_1001226772 320
422 3300005330 Ga0070690_100105241 Ga0070690_1001052411 320
423 3300005334 Ga0068869_100127021 Ga0068869_1001270212 320
424 3300005356 Ga0070674_100198646 Ga0070674_1001986462 320
425 3300005563 Ga0068855_100000405 Ga0068855_10000040512 320
426 3300005577 Ga0068857_100079157 Ga0068857_1000791573 320
427 3300005614 Ga0068856_100107056 Ga0068856_1001070562 320
428 3300006195 Ga0075366_10011230 Ga0075366_100112303 320
429 3300006353 Ga0075370_10005894 Ga0075370_100058945 320
430 3300009174 Ga0105241_10201009 Ga0105241_102010092 320
431 3300009545 Ga0105237_10103686 Ga0105237_101036863 320
432 3300009551 Ga0105238_10095358 Ga0105238_100953582 320
433 3300010375 Ga0105239_10012269 Ga0105239_100122696 320
434 3300011119 Ga0105246_10305681 Ga0105246_103056811 320
435 3300013105 Ga0157369_10039806 Ga0157369_100398062 320
436 3300013307 Ga0157372_10287117 Ga0157372_102871172 320
437 3300025226 Ga0209674_100007 Ga0209674_100007945 320
438 3300025230 Ga0209563_100033 Ga0209563_10003396 320
439 3300025231 Ga0207427_100912 Ga0207427_10091213 320
440 3300025242 Ga0209258_100499 Ga0209258_10049915 320
441 3300025246 Ga0209646_1000062 Ga0209646_100006290 320
442 3300025250 Ga0209026_1000026 Ga0209026_1000026122 320
443 3300025253 Ga0209677_100082 Ga0209677_10008293 320
444 3300025253 Ga0209677_100116 Ga0209677_10011612 320
445 3300025256 Ga0209759_1000050 Ga0209759_100005059 320
446 3300025256 Ga0209759_1012293 Ga0209759_10122932 320
447 3300025911 Ga0207654_10020266 Ga0207654_100202664 320
448 3300025913 Ga0207695_10075501 Ga0207695_100755013 320
449 3300025924 Ga0207694_10065552 Ga0207694_100655524 320
450 3300025927 Ga0207687_10506932 Ga0207687_105069321 320
451 3300025942 Ga0207689_10041667 Ga0207689_100416673 320
452 3300025949 Ga0207667_10002900 Ga0207667_100029007 320
453 3300025981 Ga0207640_10015753 Ga0207640_100157534 320
454 3300026078 Ga0207702_10000225 Ga0207702_100002252 320
455 3300026116 Ga0207674_10006381 Ga0207674_100063815 320
456 3300026118 Ga0207675_100239110 Ga0207675_1002391102 320
457 3300038443 Ga0395901_0005416 Ga0395901_0005416_9623_10585 320
458 3300046506 Ga0495583_0000245 Ga0495583_0000245_13490_14452 320
459 3300046507 Ga0495606_0001063 Ga0495606_0001063_11153_12115 320
460 3300046616 Ga0495668_0021998 Ga0495668_0021998_206_1168 320
461 3300046660 Ga0495625_0003938 Ga0495625_0003938_5366_6328 320
462 3300046684 Ga0495669_0016980 Ga0495669_0016980_39_1001 320
463 3300046694 Ga0495649_0001703 Ga0495649_0001703_12224_13186 320
464 3300048908 Ga0496105_0150937 Ga0496105_0150937_796_1758 320
465 3300050496 nmdc:mga07m45_578_c1 nmdc:mga07m45_578_c1_1019_1981 320
466 3300053080 Ga0500635_0065489 Ga0500635_0065489_119_1081 320
467 3300053177 Ga0500636_0023334 Ga0500636_0023334_97_1059 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01430

HSP33

Hsp33 protein

35

340

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.8903 2 255
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.8685 2 255
1vq0-assembly1.cif.gz_B crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution 0.8176 1 305
1vzy-assembly1.cif.gz_A crystal structure of the bacillus subtilis hsp33 0.8136 1 305
1vzy-assembly1.cif.gz_A crystal structure of the bacillus subtilis hsp33 0.798 1 305
ID Description Score Start End Superfamily
af_P0A6Y5_226_285_3.90.1280.10 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.9664 252 305 3.90.1280.10
1vzyA02 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.9206 255 305 3.90.1280.10
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.8961 1 186 3.55.30.10
1vzyB02 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.8916 255 304 3.90.1280.10
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.891 1 186 3.55.30.10
ID Description Score Start End GO Terms
AF-A0A520G6E7-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9799 1 161 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A2M8BKY5-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9797 1 123 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A5C7A8U2-F1-model_v4 Hsp33 family molecular chaperone HslO 0.9767 4 142 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A520G6E7-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.974 1 161 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A2M8BKY5-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9493 1 123 GO:0005737
GO:0042026
GO:0044183
GO:0051082

Feature Viewer

pLDDT pTM Quality
89.8 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map