F449932

General Info

Members Datasets Scaffolds Average Seq Length
467 260 934 364

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0011254|Ga0500641_0011254_977_2149
Length 390
Sequence MSKHPAAHVAAGLCWTNFKFGSGGAMAAISLSKLNKHYGSLFHAVKDVDLEIADKEFVALVGPSGCGKSTTLRMIAGLEDISSGDIRIGGKVVNHLPPRDRDVAMVFQNYALYQHMSVYDNLAFGLRNKKTAEAEIKVAIDRAAGMLGLHDLLQRKPKQLSGGQQQRVALGRCIVRNPQVFLFDEPLSNLDAKLRAQMRIEIKRLHAEIPTTSVFVTHDQVEAMTLGDRVVIMRDGRIQQIGTPLQVYGKPANKFVAGFIGAPAMNFIDVTVRSEAGSVSVESEGLRLTVGLADASALAAHGGRRVILGVRPEHLVLGNGAPGLGFDARVEVVEQLGSEILLETRVGDASVTAARVPAETVIARGDRVRLSAQAGRLHFFDPETELPISS

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
247 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
250 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
251 2773857925 Microvirga vignae BR3299 Isolate Unclassified
252 2791355199
253 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
254 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
255 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
256 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
257 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
258 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
259 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
260 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.99
Nodule 0.86
Rhizoplane 10.49
Rhizosphere 70.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0011254 3300053096 Bacteria 3245
2 JGI25151J46595_10000203 3300003187 Bacteria 73276
3 JGI25406J46586_10000048 3300003203 Bacteria 54715
4 JGI25406J46586_10000461 3300003203 Bacteria 18989
5 JGI25153J46596_10005963 3300003215 Bacteria 6273
6 JGI25153J46596_10009530 3300003215 Bacteria 4499
7 Ga0055536_1001168 3300003781 Bacteria 16400
8 Ga0055530_10023438 3300003791 Bacteria 1773
9 Ga0055540_1001607 3300003792 Bacteria 13181
10 Ga0055531_10000714 3300003794 Bacteria 28350
11 Ga0070658_10012521 3300005327 Bacteria 6805
12 Ga0070690_100193751 3300005330 Bacteria 1410
13 Ga0068869_100079728 3300005334 Bacteria 2440
14 Ga0068868_100143582 3300005338 Bacteria 1961
15 Ga0070660_100299256 3300005339 Bacteria 1319
16 Ga0070689_100083844 3300005340 Bacteria 2505
17 Ga0070671_100069139 3300005355 Bacteria 2945
18 Ga0070671_100247907 3300005355 Bacteria 1513
19 Ga0070674_100185217 3300005356 Bacteria 1597
20 Ga0070659_100080385 3300005366 Bacteria 2603
21 Ga0070659_100279919 3300005366 Bacteria 1388
22 Ga0070709_10029267 3300005434 Bacteria 3293
23 Ga0070714_100262848 3300005435 Bacteria 1598
24 Ga0070713_100003568 3300005436 Bacteria 10278
25 Ga0070710_10003081 3300005437 Bacteria 7923
26 Ga0070710_10067748 3300005437 Bacteria 2049
27 Ga0070710_10153230 3300005437 Bacteria 1423
28 Ga0070711_100002743 3300005439 Bacteria 10096
29 Ga0070711_100018969 3300005439 Bacteria 4401
30 Ga0070700_100063859 3300005441 Bacteria 2330
31 Ga0070694_100081159 3300005444 Bacteria 2256
32 Ga0070694_100176449 3300005444 Bacteria 1578
33 Ga0070708_100140497 3300005445 Bacteria 2239
34 Ga0070663_100070354 3300005455 Bacteria 2544
35 Ga0070678_100094804 3300005456 Bacteria 2298
36 Ga0070662_100014725 3300005457 Bacteria 5227
37 Ga0070706_100151142 3300005467 Bacteria 2167
38 Ga0070706_100155750 3300005467 Bacteria 2133
39 Ga0070706_100194207 3300005467 Bacteria 1896
40 Ga0070707_100247056 3300005468 Bacteria 1736
41 Ga0070698_100003213 3300005471 Bacteria 18005
42 Ga0070698_100008935 3300005471 Bacteria 10780
43 Ga0070699_100002965 3300005518 Bacteria 15086
44 Ga0070699_100014135 3300005518 Bacteria 6867
45 Ga0070699_100121869 3300005518 Bacteria 2293
46 Ga0070699_100238756 3300005518 Bacteria 1622
47 Ga0070697_100024594 3300005536 Bacteria 4796
48 Ga0070697_100035671 3300005536 Bacteria 4014
49 Ga0070697_100074325 3300005536 Bacteria 2792
50 Ga0070697_100144489 3300005536 Bacteria 2002
51 Ga0068853_100041941 3300005539 Bacteria 3910
52 Ga0068853_100174295 3300005539 Bacteria 1947
53 Ga0068853_100287644 3300005539 Bacteria 1516
54 Ga0070672_100178918 3300005543 Bacteria 1767
55 Ga0070665_100030560 3300005548 Bacteria 5418
56 Ga0070665_100032084 3300005548 Bacteria 5287
57 Ga0070665_100079791 3300005548 Bacteria 3278
58 Ga0070665_100095337 3300005548 Bacteria 2980
59 Ga0070665_100328184 3300005548 Bacteria 1534
60 Ga0068855_100209724 3300005563 Bacteria 2190
61 Ga0068852_100009422 3300005616 Bacteria 7254
62 Ga0068859_100124147 3300005617 Bacteria 2650
63 Ga0068859_100129189 3300005617 Bacteria 2597
64 Ga0068859_100311233 3300005617 Bacteria 1668
65 Ga0068864_100119000 3300005618 Bacteria 2359
66 Ga0068864_100204723 3300005618 Bacteria 1815
67 Ga0068861_100034614 3300005719 Bacteria 3736
68 Ga0068863_100386649 3300005841 Bacteria 1367
69 Ga0068858_100046808 3300005842 Bacteria 4009
70 Ga0068858_100106009 3300005842 Bacteria 2623
71 Ga0068860_100197157 3300005843 Bacteria 1950
72 Ga0081455_10000034 3300005937 Bacteria 138695
73 Ga0081455_10001744 3300005937 Bacteria 26280
74 Ga0081455_10002109 3300005937 Bacteria 23709
75 Ga0081455_10007439 3300005937 Bacteria 11537
76 Ga0081455_10007610 3300005937 Bacteria 11385
77 Ga0081455_10013394 3300005937 Bacteria 8110
78 Ga0081455_10019764 3300005937 Bacteria 6363
79 Ga0081455_10022472 3300005937 Bacteria 5894
80 Ga0081455_10026178 3300005937 Bacteria 5373
81 Ga0081455_10028060 3300005937 Bacteria 5147
82 Ga0081455_10033161 3300005937 Bacteria 4644
83 Ga0081538_10028947 3300005981 Bacteria 3796
84 Ga0081540_1001148 3300005983 Bacteria 23385
85 Ga0081540_1003634 3300005983 Bacteria 12104
86 Ga0081540_1007513 3300005983 Bacteria 7761
87 Ga0081540_1009522 3300005983 Bacteria 6688
88 Ga0081540_1011388 3300005983 Bacteria 5947
89 Ga0081540_1011732 3300005983 Bacteria 5832
90 Ga0081540_1013285 3300005983 Bacteria 5361
91 Ga0081540_1028479 3300005983 Bacteria 3137
92 Ga0081539_10000008 3300005985 Bacteria 525071
93 Ga0081539_10000319 3300005985 Bacteria 106944
94 Ga0081539_10011055 3300005985 Bacteria 7214
95 Ga0070717_10018595 3300006028 Bacteria 5430
96 Ga0070717_10156193 3300006028 Bacteria 1977
97 Ga0070717_10176332 3300006028 Bacteria 1861
98 Ga0070717_10231015 3300006028 Bacteria 1629
99 Ga0075365_10047956 3300006038 Bacteria 2810
100 Ga0075365_10050882 3300006038 Bacteria 2734
101 Ga0075365_10130608 3300006038 Bacteria 1738
102 Ga0075368_10014685 3300006042 Bacteria 2897
103 Ga0075368_10036892 3300006042 Bacteria 1911
104 Ga0075368_10077878 3300006042 Bacteria 1346
105 Ga0075363_100008677 3300006048 Bacteria 4745
106 Ga0075432_10016254 3300006058 Bacteria 2540
107 Ga0070715_10004979 3300006163 Bacteria 4401
108 Ga0070715_10011865 3300006163 Bacteria 3150
109 Ga0070716_100019690 3300006173 Bacteria 3530
110 Ga0070712_100021141 3300006175 Bacteria 4268
111 Ga0075367_10055558 3300006178 Bacteria 2350
112 Ga0075367_10077898 3300006178 Bacteria 2001
113 Ga0075367_10080653 3300006178 Bacteria 1968
114 Ga0075369_10006751 3300006186 Bacteria 4352
115 Ga0075366_10016335 3300006195 Bacteria 4266
116 Ga0075366_10022235 3300006195 Bacteria 3688
117 Ga0075370_10135656 3300006353 Bacteria 1438
118 Ga0075428_100022142 3300006844 Bacteria 7036
119 Ga0075428_100024166 3300006844 Bacteria 6723
120 Ga0075428_100025163 3300006844 Bacteria 6586
121 Ga0075428_100211336 3300006844 Bacteria 2096
122 Ga0075430_100001330 3300006846 Bacteria 19963
123 Ga0075430_100020309 3300006846 Bacteria 5651
124 Ga0075431_100002452 3300006847 Bacteria 17855
125 Ga0075431_100014431 3300006847 Bacteria 7992
126 Ga0075433_10002201 3300006852 Bacteria 14781
127 Ga0075433_10032823 3300006852 Bacteria 4448
128 Ga0075433_10158850 3300006852 Bacteria 2012
129 Ga0075434_100004401 3300006871 Bacteria 12692
130 Ga0075434_100004406 3300006871 Bacteria 12682
131 Ga0075434_100100779 3300006871 Bacteria 2894
132 Ga0075429_100034563 3300006880 Bacteria 4393
133 Ga0075436_100082731 3300006914 Bacteria 2227
134 Ga0097620_100124151 3300006931 Bacteria 2650
135 Ga0097620_100129192 3300006931 Bacteria 2597
136 Ga0097620_100311263 3300006931 Bacteria 1668
137 Ga0075435_100032157 3300007076 Bacteria 4141
138 Ga0075435_100035262 3300007076 Bacteria 3970
139 Ga0075435_100240417 3300007076 Bacteria 1540
140 Ga0099795_10000975 3300007788 Bacteria 5837
141 Ga0099795_10009231 3300007788 Bacteria 2852
142 Ga0111539_10004846 3300009094 Bacteria 17535
143 Ga0111539_10007797 3300009094 Bacteria 13672
144 Ga0111539_10017814 3300009094 Bacteria 8794
145 Ga0111539_10032545 3300009094 Bacteria 6331
146 Ga0111539_10245743 3300009094 Bacteria 2083
147 Ga0111539_10515910 3300009094 Bacteria 1392
148 Ga0105245_10060907 3300009098 Bacteria 3401
149 Ga0105247_10103401 3300009101 Bacteria 1824
150 Ga0114129_10001297 3300009147 Bacteria 33328
151 Ga0114129_10032067 3300009147 Bacteria 7427
152 Ga0114129_10071467 3300009147 Bacteria 4839
153 Ga0105248_10257310 3300009177 Bacteria 1965
154 Ga0105238_10037187 3300009551 Bacteria 4949
155 Ga0105238_10092317 3300009551 Bacteria 3015
156 Ga0105249_10195777 3300009553 Bacteria 1975
157 Ga0105239_10139080 3300010375 Bacteria 2705
158 Ga0157369_10006355 3300013105 Bacteria 13713
159 Ga0157378_10093766 3300013297 Bacteria 2733
160 Ga0163162_10336234 3300013306 Bacteria 1642
161 Ga0157372_10003819 3300013307 Bacteria 16187
162 Ga0163163_10029399 3300014325 Bacteria 5286
163 Ga0157380_10257508 3300014326 Bacteria 1583
164 Ga0163161_10194155 3300017792 Bacteria 1562
165 Ga0213872_10106943 3300021361 Bacteria 1244
166 Ga0213874_10034828 3300021377 Bacteria 1476
167 Ga0213876_10048580 3300021384 Bacteria 2242
168 Ga0213875_10000347 3300021388 Bacteria 43646
169 Ga0213871_10000588 3300021441 Bacteria 5135
170 Ga0209025_1000003 3300025294 Bacteria 1366495
171 Ga0209758_1000684 3300025297 Bacteria 50528
172 Ga0209758_1013562 3300025297 Bacteria 4429
173 Ga0209758_1015722 3300025297 Bacteria 3897
174 Ga0209758_1034833 3300025297 Bacteria 1995
175 Ga0209051_1010181 3300025303 Bacteria 4779
176 Ga0209257_1001171 3300025304 Bacteria 33161
177 Ga0207692_10003849 3300025898 Bacteria 5897
178 Ga0207692_10083744 3300025898 Bacteria 1712
179 Ga0207710_10055594 3300025900 Bacteria 1784
180 Ga0207685_10009028 3300025905 Bacteria 2876
181 Ga0207685_10085534 3300025905 Bacteria 1316
182 Ga0207645_10127545 3300025907 Bacteria 1654
183 Ga0207645_10131487 3300025907 Bacteria 1629
184 Ga0207643_10011607 3300025908 Bacteria 4757
185 Ga0207643_10017358 3300025908 Bacteria 3934
186 Ga0207684_10076338 3300025910 Bacteria 2848
187 Ga0207684_10155471 3300025910 Bacteria 1968
188 Ga0207654_10026412 3300025911 Bacteria 3144
189 Ga0207695_10139167 3300025913 Bacteria 2378
190 Ga0207671_10056360 3300025914 Bacteria 2912
191 Ga0207693_10002819 3300025915 Bacteria 15061
192 Ga0207693_10015170 3300025915 Bacteria 6184
193 Ga0207693_10044751 3300025915 Bacteria 3479
194 Ga0207663_10013433 3300025916 Bacteria 4452
195 Ga0207663_10016857 3300025916 Bacteria 4062
196 Ga0207660_10100233 3300025917 Bacteria 2162
197 Ga0207649_10011255 3300025920 Bacteria 4928
198 Ga0207646_10173743 3300025922 Bacteria 1946
199 Ga0207681_10062640 3300025923 Bacteria 2562
200 Ga0207681_10089293 3300025923 Bacteria 2197
201 Ga0207694_10008365 3300025924 Bacteria 7818
202 Ga0207659_10151504 3300025926 Bacteria 1811
203 Ga0207659_10211399 3300025926 Bacteria 1555
204 Ga0207700_10013125 3300025928 Bacteria 5376
205 Ga0207664_10018927 3300025929 Bacteria 5079
206 Ga0207690_10058835 3300025932 Bacteria 2601
207 Ga0207706_10089012 3300025933 Bacteria 2714
208 Ga0207706_10102652 3300025933 Bacteria 2516
209 Ga0207709_10019985 3300025935 Bacteria 3774
210 Ga0207670_10116247 3300025936 Bacteria 1936
211 Ga0207670_10134902 3300025936 Bacteria 1813
212 Ga0207669_10065326 3300025937 Bacteria 2256
213 Ga0207669_10138016 3300025937 Bacteria 1688
214 Ga0207704_10141776 3300025938 Bacteria 1682
215 Ga0207665_10012989 3300025939 Bacteria 5475
216 Ga0207665_10018134 3300025939 Bacteria 4625
217 Ga0207665_10114656 3300025939 Bacteria 1897
218 Ga0207691_10009529 3300025940 Bacteria 9321
219 Ga0207689_10044606 3300025942 Bacteria 3666
220 Ga0207689_10067818 3300025942 Bacteria 2931
221 Ga0207667_10185427 3300025949 Bacteria 2136
222 Ga0207651_10055582 3300025960 Bacteria 2720
223 Ga0207712_10083922 3300025961 Bacteria 2326
224 Ga0207668_10072645 3300025972 Bacteria 2462
225 Ga0207668_10077216 3300025972 Bacteria 2400
226 Ga0207668_10090662 3300025972 Bacteria 2244
227 Ga0207640_10158552 3300025981 Bacteria 1671
228 Ga0207658_10185232 3300025986 Bacteria 1726
229 Ga0207677_10084122 3300026023 Bacteria 2292
230 Ga0207703_10362179 3300026035 Bacteria 1337
231 Ga0207639_10051054 3300026041 Bacteria 3144
232 Ga0207639_10159805 3300026041 Bacteria 1897
233 Ga0207678_10034617 3300026067 Bacteria 4399
234 Ga0207678_10052918 3300026067 Bacteria 3500
235 Ga0207678_10061409 3300026067 Bacteria 3232
236 Ga0207678_10069541 3300026067 Bacteria 3019
237 Ga0207678_10105163 3300026067 Bacteria 2408
238 Ga0207678_10177187 3300026067 Bacteria 1820
239 Ga0207708_10105156 3300026075 Bacteria 2188
240 Ga0207641_10236007 3300026088 Bacteria 1702
241 Ga0207648_10028707 3300026089 Bacteria 4932
242 Ga0207676_10045624 3300026095 Bacteria 3387
243 Ga0207676_10093856 3300026095 Bacteria 2471
244 Ga0207675_100072848 3300026118 Bacteria 3213
245 Ga0207683_10081653 3300026121 Bacteria 2870
246 Ga0207683_10098886 3300026121 Bacteria 2604
247 Ga0207683_10166654 3300026121 Bacteria 1994
248 Ga0209179_1002631 3300027512 Bacteria 2461
249 Ga0209813_10004469 3300027866 Bacteria 3343
250 Ga0209813_10045248 3300027866 Bacteria 1355
251 Ga0207428_10000114 3300027907 Bacteria 109533
252 Ga0207428_10020552 3300027907 Bacteria 5607
253 Ga0207428_10209385 3300027907 Bacteria 1465
254 Ga0268266_10031067 3300028379 Bacteria 4536
255 Ga0268266_10058086 3300028379 Bacteria 3330
256 Ga0268266_10059969 3300028379 Bacteria 3278
257 Ga0268266_10061611 3300028379 Bacteria 3236
258 Ga0268265_10001305 3300028380 Bacteria 21384
259 Ga0268265_10208650 3300028380 Bacteria 1700
260 Ga0265334_10022982 3300028573 Bacteria 2539
261 Ga0307515_10010300 3300028794 Bacteria 17945
262 Ga0307513_10132127 3300031456 Bacteria 2440
263 Ga0307513_10191528 3300031456 Bacteria 1896
264 Ga0307513_10220343 3300031456 Bacteria 1719
265 Ga0265314_10104074 3300031711 Bacteria 1818
266 Ga0316576_10007943 3300031727 Bacteria 6718
267 Ga0316576_10110408 3300031727 Bacteria 2061
268 Ga0307516_10026021 3300031730 Bacteria 5948
269 Ga0307516_10043199 3300031730 Bacteria 4467
270 Ga0316577_10059631 3300031733 Bacteria 2130
271 Ga0316583_10001259 3300032133 Bacteria 8360
272 Ga0307510_10037323 3300033180 Bacteria 5392
273 Ga0307510_10090208 3300033180 Bacteria 2913
274 Ga0373928_0016736 3300035084 Bacteria 1502
275 Ga0373949_0014624 3300035090 Bacteria 1749
276 Ga0373932_0002965 3300035112 Bacteria 4173
277 Ga0373936_0040819 3300035113 Bacteria 1860
278 Ga0373939_0040714 3300035114 Bacteria 1397
279 Ga0316574_0000070 3300035398 Bacteria 27753
280 Ga0373931_0004228 3300035691 Bacteria 6532
281 Ga0373931_0009630 3300035691 Bacteria 4625
282 Ga0373931_0010023 3300035691 Bacteria 4543
283 Ga0373927_0004757 3300035695 Bacteria 9451
284 Ga0373927_0006676 3300035695 Bacteria 7853
285 Ga0373927_0007742 3300035695 Bacteria 7267
286 Ga0373927_0149239 3300035695 Bacteria 1531
287 Ga0373947_0064319 3300035725 Bacteria 2237
288 Ga0373947_0105450 3300035725 Bacteria 1776
289 Ga0316582_0010500 3300036647 Bacteria 5076
290 Ga0316582_0057639 3300036647 Bacteria 2482
291 Ga0316582_0078167 3300036647 Bacteria 2155
292 Ga0373925_0266257 3300037068 Bacteria 1378
293 Ga0436364_0188162 3300037853 Bacteria 41313
294 Ga0395901_0118682 3300038443 Bacteria 2779
295 Ga0436365_1318019 3300039437 Bacteria 2746
296 Ga0436361_0102991 3300039447 Bacteria 10657
297 Ga0436361_0273974 3300039447 Bacteria 2273
298 Ga0451577_0054387 3300042876 Bacteria 3573
299 Ga0453683_0251529 3300044673 Bacteria 1126
300 Ga0466958_0027164 3300045836 Bacteria 3387
301 Ga0495617_018983 3300046452 Bacteria 2325
302 Ga0495603_0021190 3300046455 Bacteria 3935
303 Ga0495638_0024885 3300046460 Bacteria 3896
304 Ga0495638_0025949 3300046460 Bacteria 3803
305 Ga0495641_0089897 3300046461 Bacteria 1372
306 Ga0495639_0110309 3300046475 Bacteria 1305
307 Ga0495594_0162965 3300046499 Bacteria 1268
308 Ga0495607_0159472 3300046501 Bacteria 1147
309 Ga0495632_0015109 3300046519 Bacteria 4340
310 Ga0495637_0015213 3300046520 Bacteria 3611
311 Ga0495644_0055868 3300046523 Bacteria 1483
312 Ga0495663_0005891 3300046525 Bacteria 3393
313 Ga0495668_0008723 3300046616 Bacteria 6295
314 Ga0495659_0004327 3300046664 Bacteria 4471
315 Ga0495659_0038941 3300046664 Bacteria 1689
316 Ga0495661_0072335 3300046665 Bacteria 2012
317 Ga0495670_0011416 3300046691 Bacteria 4369
318 Ga0495676_0102303 3300047321 Bacteria 2117
319 Ga0495683_0080468 3300047323 Bacteria 1590
320 Ga0496100_0037939 3300048903 Bacteria 3050
321 Ga0496100_0077887 3300048903 Bacteria 2230
322 Ga0496101_0046142 3300048904 Bacteria 3124
323 Ga0496101_0050675 3300048904 Bacteria 2990
324 Ga0496101_0054532 3300048904 Bacteria 2886
325 Ga0496102_0049051 3300048905 Bacteria 3840
326 Ga0496102_0102830 3300048905 Bacteria 2656
327 Ga0496102_0136352 3300048905 Bacteria 2300
328 Ga0496102_0196149 3300048905 Bacteria 1903
329 Ga0496102_0267958 3300048905 Bacteria 1610
330 Ga0496104_0001605 3300048907 Bacteria 19474
331 Ga0496104_0014197 3300048907 Bacteria 7187
332 Ga0496104_0018487 3300048907 Bacteria 6359
333 Ga0496104_0018599 3300048907 Bacteria 6342
334 Ga0496104_0189486 3300048907 Bacteria 1968
335 Ga0496105_0004279 3300048908 Bacteria 10743
336 Ga0496105_0008006 3300048908 Bacteria 8212
337 Ga0496105_0077344 3300048908 Bacteria 2748
338 Ga0496105_0263826 3300048908 Bacteria 1392
339 Ga0496106_0009190 3300048909 Bacteria 7300
340 Ga0496106_0028829 3300048909 Bacteria 4137
341 Ga0496106_0053045 3300048909 Bacteria 3061
342 Ga0496107_0163016 3300048910 Bacteria 1653
343 Ga0496108_0018035 3300048911 Bacteria 5774
344 Ga0496108_0082645 3300048911 Bacteria 2724
345 Ga0496108_0386944 3300048911 Bacteria 1221
346 Ga0496109_0117462 3300048912 Bacteria 2476
347 Ga0496109_0119576 3300048912 Bacteria 2453
348 Ga0496109_0203812 3300048912 Bacteria 1860
349 Ga0496109_0339691 3300048912 Bacteria 1418
350 Ga0496109_0419008 3300048912 Bacteria 1265
351 Ga0496109_0546149 3300048912 Bacteria 1093
352 Ga0496110_0001798 3300048913 Bacteria 15818
353 Ga0496110_0019331 3300048913 Bacteria 5730
354 Ga0496110_0096059 3300048913 Bacteria 2655
355 Ga0496110_0141128 3300048913 Bacteria 2178
356 Ga0496111_0022976 3300048914 Bacteria 4373
357 Ga0496111_0041270 3300048914 Bacteria 3311
358 Ga0496111_0041842 3300048914 Bacteria 3289
359 Ga0496111_0149167 3300048914 Bacteria 1734
360 Ga0496112_0000004 3300048915 Bacteria 553294
361 Ga0496112_0135330 3300048915 Bacteria 2435
362 Ga0496112_0185241 3300048915 Bacteria 2045
363 Ga0496113_0008797 3300048916 Bacteria 6596
364 Ga0496113_0023154 3300048916 Bacteria 4402
365 Ga0496113_0079950 3300048916 Bacteria 2503
366 Ga0496114_0024848 3300048917 Bacteria 4891
367 Ga0496115_0019844 3300048918 Bacteria 5179
368 Ga0496115_0153967 3300048918 Bacteria 1899
369 Ga0496120_0123577 3300048923 Bacteria 1335
370 Ga0496121_0108413 3300048924 Bacteria 2124
371 Ga0496122_0215077 3300048925 Bacteria 1109
372 Ga0496125_0005191 3300048928 Bacteria 14626
373 Ga0496126_0024679 3300048929 Bacteria 5802
374 Ga0501031_0186694 3300049568 Bacteria 1354
375 Ga0501034_0028426 3300049571 Bacteria 5690
376 Ga0501034_0329370 3300049571 Bacteria 1459
377 Ga0501036_0257207 3300049572 Bacteria 1463
378 Ga0501038_0003074 3300049574 Bacteria 15554
379 Ga0501047_0025585 3300049581 Bacteria 5674
380 Ga0501047_0039189 3300049581 Bacteria 4584
381 Ga0501047_0051371 3300049581 Bacteria 3983
382 Ga0501067_0077572 3300049583 Bacteria 1841
383 Ga0501069_0049206 3300049585 Bacteria 2342
384 Ga0501070_0005410 3300049586 Bacteria 10895
385 Ga0501070_0062968 3300049586 Bacteria 3073
386 Ga0501073_0001548 3300049589 Bacteria 17041
387 Ga0501074_0001537 3300049590 Bacteria 15604
388 Ga0501079_0001387 3300049741 Bacteria 17071
389 Ga0501080_0007140 3300049742 Bacteria 10079
390 Ga0501080_0110871 3300049742 Bacteria 2543
391 Ga0501083_0006285 3300049744 Bacteria 8428
392 Ga0501083_0010528 3300049744 Bacteria 6508
393 Ga0501044_0007362 3300049823 Bacteria 12103
394 Ga0501044_0054519 3300049823 Bacteria 4109
395 nmdc:mga03n38_1847_c1 3300050490 Bacteria 6313
396 nmdc:mga0yw44_15032_c1 3300050492 Bacteria 4132
397 nmdc:mga0yw44_24059_c1 3300050492 Bacteria 3441
398 nmdc:mga0yw44_70467_c1 3300050492 Bacteria 2168
399 nmdc:mga0yw44_93087_c1 3300050492 Bacteria 1908
400 nmdc:mga06z11_1051_c1 3300050494 Bacteria 10042
401 nmdc:mga04h51_17117_c1 3300050495 Bacteria 2115
402 nmdc:mga04h51_38908_c1 3300050495 Bacteria 1542
403 nmdc:mga07m45_84909_c1 3300050496 Bacteria 1810
404 nmdc:mga05p37_107709_c1 3300050507 Bacteria 3428
405 nmdc:mga05p37_335709_c1 3300050507 Bacteria 1784
406 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
407 nmdc:mga05p37_901_c1 3300050507 Bacteria 33493
408 nmdc:mga09592_11672_c1 3300050508 Bacteria 7146
409 nmdc:mga09592_12259_c1 3300050508 Bacteria 6978
410 nmdc:mga0qj67_14232_c1 3300050509 Bacteria 6013
411 nmdc:mga0qj67_192442_c1 3300050509 Bacteria 1657
412 nmdc:mga0qj67_7143_c1 3300050509 Bacteria 8239
413 nmdc:mga06r32_2589_c1 3300050510 Bacteria 16152
414 nmdc:mga06r32_806_c1 3300050510 Bacteria 27804
415 nmdc:mga08y16_1083_c1 3300050511 Bacteria 26813
416 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
417 nmdc:mga08y16_60561_c1 3300050511 Bacteria 3953
418 nmdc:mga08y16_82547_c1 3300050511 Bacteria 3350
419 nmdc:mga0n895_15238_c1 3300050512 Bacteria 7004
420 nmdc:mga0n895_19529_c1 3300050512 Bacteria 6301
421 nmdc:mga0n895_220034_c1 3300050512 Bacteria 1928
422 nmdc:mga0n895_256872_c1 3300050512 Bacteria 1773
423 nmdc:mga0n895_264268_c1 3300050512 Bacteria 1746
424 nmdc:mga0n895_310993_c1 3300050512 Bacteria 1597
425 nmdc:mga0n895_33431_c1 3300050512 Bacteria 4943
426 nmdc:mga0n895_45426_c1 3300050512 Bacteria 4287
427 nmdc:mga0rr50_206848_c1 3300050513 Bacteria 1615
428 nmdc:mga0rr50_22664_c1 3300050513 Bacteria 4315
429 nmdc:mga0rr50_228391_c1 3300050513 Bacteria 1539
430 nmdc:mga0rr50_28970_c1 3300050513 Bacteria 3212
431 nmdc:mga0rr50_37066_c1 3300050513 Bacteria 3517
432 nmdc:mga0a205_10132_c2 3300050515 Bacteria 5857
433 nmdc:mga0a205_16755_c1 3300050515 Bacteria 6863
434 nmdc:mga0a205_196640_c1 3300050515 Bacteria 1907
435 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
436 nmdc:mga0sz30_147_c1 3300050516 Bacteria 26410
437 nmdc:mga0sz30_15009_c1 3300050516 Bacteria 3057
438 Ga0495595_0088886 3300053084 Bacteria 1480
439 Ga0500641_0002234 3300053096 Bacteria 6851
440 Ga0500595_000539 3300053119 Bacteria 22758
441 Ga0500595_000659 3300053119 Bacteria 20724
442 Ga0500642_0103570 3300053130 Bacteria 1325
443 Ga0500559_0019405 3300053136 Bacteria 2873
444 Ga0500577_0066849 3300053142 Bacteria 1399
445 Ga0500616_0000962 3300053153 Bacteria 31215
446 Ga0500634_0077432 3300053161 Bacteria 1724
447 Ga0500638_012290 3300053162 Bacteria 3833
448 Ga0500638_015731 3300053162 Bacteria 3478
449 Ga0500637_0046608 3300053178 Bacteria 2460
450 Ga0500645_007753 3300053730 Bacteria 3713
451 Ga0500609_000220 3300053731 Bacteria 8198
452 Ga0500552_000488 3300053733 Bacteria 3667
453 Ga0501082_0024177 3300060353 Bacteria 5240
454 Ga0501082_0171815 3300060353 Bacteria 1884
455 2643772202 2643221550 Bacteria 4619371
456 2643840474 2643221564 Bacteria 4193379
457 2774873191 2773857925 Bacteria 6472445
458 2793079657
459 2793081845
460 2874605737 2874604998 Bacteria 7834745
461 2876808954 2876808645 Bacteria 8824342
462 2879110258 2879110137 Bacteria 8907982
463 2889040694 2889033259 Bacteria 9099371
464 2922365919 2922361189 Bacteria 7436256
465 2922393048 2922386360 Bacteria 7017218
466 2995394601 2995392953 Bacteria 4539380
467 8006990391 8006984368 Bacteria 9651211
468 Ga0500641_0011254
469 JGI25151J46595_10000203
470 JGI25406J46586_10000048
471 JGI25406J46586_10000461
472 JGI25153J46596_10005963
473 JGI25153J46596_10009530
474 Ga0055536_1001168
475 Ga0055530_10023438
476 Ga0055540_1001607
477 Ga0055531_10000714
478 Ga0070658_10012521
479 Ga0070690_100193751
480 Ga0068869_100079728
481 Ga0068868_100143582
482 Ga0070660_100299256
483 Ga0070689_100083844
484 Ga0070671_100069139
485 Ga0070671_100247907
486 Ga0070674_100185217
487 Ga0070659_100080385
488 Ga0070659_100279919
489 Ga0070709_10029267
490 Ga0070714_100262848
491 Ga0070713_100003568
492 Ga0070710_10003081
493 Ga0070710_10067748
494 Ga0070710_10153230
495 Ga0070711_100002743
496 Ga0070711_100018969
497 Ga0070700_100063859
498 Ga0070694_100081159
499 Ga0070694_100176449
500 Ga0070708_100140497
501 Ga0070663_100070354
502 Ga0070678_100094804
503 Ga0070662_100014725
504 Ga0070706_100151142
505 Ga0070706_100155750
506 Ga0070706_100194207
507 Ga0070707_100247056
508 Ga0070698_100003213
509 Ga0070698_100008935
510 Ga0070699_100002965
511 Ga0070699_100014135
512 Ga0070699_100121869
513 Ga0070699_100238756
514 Ga0070697_100024594
515 Ga0070697_100035671
516 Ga0070697_100074325
517 Ga0070697_100144489
518 Ga0068853_100041941
519 Ga0068853_100174295
520 Ga0068853_100287644
521 Ga0070672_100178918
522 Ga0070665_100030560
523 Ga0070665_100032084
524 Ga0070665_100079791
525 Ga0070665_100095337
526 Ga0070665_100328184
527 Ga0068855_100209724
528 Ga0068852_100009422
529 Ga0068859_100124147
530 Ga0068859_100129189
531 Ga0068859_100311233
532 Ga0068864_100119000
533 Ga0068864_100204723
534 Ga0068861_100034614
535 Ga0068863_100386649
536 Ga0068858_100046808
537 Ga0068858_100106009
538 Ga0068860_100197157
539 Ga0081455_10000034
540 Ga0081455_10001744
541 Ga0081455_10002109
542 Ga0081455_10007439
543 Ga0081455_10007610
544 Ga0081455_10013394
545 Ga0081455_10019764
546 Ga0081455_10022472
547 Ga0081455_10026178
548 Ga0081455_10028060
549 Ga0081455_10033161
550 Ga0081538_10028947
551 Ga0081540_1001148
552 Ga0081540_1003634
553 Ga0081540_1007513
554 Ga0081540_1009522
555 Ga0081540_1011388
556 Ga0081540_1011732
557 Ga0081540_1013285
558 Ga0081540_1028479
559 Ga0081539_10000008
560 Ga0081539_10000319
561 Ga0081539_10011055
562 Ga0070717_10018595
563 Ga0070717_10156193
564 Ga0070717_10176332
565 Ga0070717_10231015
566 Ga0075365_10047956
567 Ga0075365_10050882
568 Ga0075365_10130608
569 Ga0075368_10014685
570 Ga0075368_10036892
571 Ga0075368_10077878
572 Ga0075363_100008677
573 Ga0075432_10016254
574 Ga0070715_10004979
575 Ga0070715_10011865
576 Ga0070716_100019690
577 Ga0070712_100021141
578 Ga0075367_10055558
579 Ga0075367_10077898
580 Ga0075367_10080653
581 Ga0075369_10006751
582 Ga0075366_10016335
583 Ga0075366_10022235
584 Ga0075370_10135656
585 Ga0075428_100022142
586 Ga0075428_100024166
587 Ga0075428_100025163
588 Ga0075428_100211336
589 Ga0075430_100001330
590 Ga0075430_100020309
591 Ga0075431_100002452
592 Ga0075431_100014431
593 Ga0075433_10002201
594 Ga0075433_10032823
595 Ga0075433_10158850
596 Ga0075434_100004401
597 Ga0075434_100004406
598 Ga0075434_100100779
599 Ga0075429_100034563
600 Ga0075436_100082731
601 Ga0097620_100124151
602 Ga0097620_100129192
603 Ga0097620_100311263
604 Ga0075435_100032157
605 Ga0075435_100035262
606 Ga0075435_100240417
607 Ga0099795_10000975
608 Ga0099795_10009231
609 Ga0111539_10004846
610 Ga0111539_10007797
611 Ga0111539_10017814
612 Ga0111539_10032545
613 Ga0111539_10245743
614 Ga0111539_10515910
615 Ga0105245_10060907
616 Ga0105247_10103401
617 Ga0114129_10001297
618 Ga0114129_10032067
619 Ga0114129_10071467
620 Ga0105248_10257310
621 Ga0105238_10037187
622 Ga0105238_10092317
623 Ga0105249_10195777
624 Ga0105239_10139080
625 Ga0157369_10006355
626 Ga0157378_10093766
627 Ga0163162_10336234
628 Ga0157372_10003819
629 Ga0163163_10029399
630 Ga0157380_10257508
631 Ga0163161_10194155
632 Ga0213872_10106943
633 Ga0213874_10034828
634 Ga0213876_10048580
635 Ga0213875_10000347
636 Ga0213871_10000588
637 Ga0209025_1000003
638 Ga0209758_1000684
639 Ga0209758_1013562
640 Ga0209758_1015722
641 Ga0209758_1034833
642 Ga0209051_1010181
643 Ga0209257_1001171
644 Ga0207692_10003849
645 Ga0207692_10083744
646 Ga0207710_10055594
647 Ga0207685_10009028
648 Ga0207685_10085534
649 Ga0207645_10127545
650 Ga0207645_10131487
651 Ga0207643_10011607
652 Ga0207643_10017358
653 Ga0207684_10076338
654 Ga0207684_10155471
655 Ga0207654_10026412
656 Ga0207695_10139167
657 Ga0207671_10056360
658 Ga0207693_10002819
659 Ga0207693_10015170
660 Ga0207693_10044751
661 Ga0207663_10013433
662 Ga0207663_10016857
663 Ga0207660_10100233
664 Ga0207649_10011255
665 Ga0207646_10173743
666 Ga0207681_10062640
667 Ga0207681_10089293
668 Ga0207694_10008365
669 Ga0207659_10151504
670 Ga0207659_10211399
671 Ga0207700_10013125
672 Ga0207664_10018927
673 Ga0207690_10058835
674 Ga0207706_10089012
675 Ga0207706_10102652
676 Ga0207709_10019985
677 Ga0207670_10116247
678 Ga0207670_10134902
679 Ga0207669_10065326
680 Ga0207669_10138016
681 Ga0207704_10141776
682 Ga0207665_10012989
683 Ga0207665_10018134
684 Ga0207665_10114656
685 Ga0207691_10009529
686 Ga0207689_10044606
687 Ga0207689_10067818
688 Ga0207667_10185427
689 Ga0207651_10055582
690 Ga0207712_10083922
691 Ga0207668_10072645
692 Ga0207668_10077216
693 Ga0207668_10090662
694 Ga0207640_10158552
695 Ga0207658_10185232
696 Ga0207677_10084122
697 Ga0207703_10362179
698 Ga0207639_10051054
699 Ga0207639_10159805
700 Ga0207678_10034617
701 Ga0207678_10052918
702 Ga0207678_10061409
703 Ga0207678_10069541
704 Ga0207678_10105163
705 Ga0207678_10177187
706 Ga0207708_10105156
707 Ga0207641_10236007
708 Ga0207648_10028707
709 Ga0207676_10045624
710 Ga0207676_10093856
711 Ga0207675_100072848
712 Ga0207683_10081653
713 Ga0207683_10098886
714 Ga0207683_10166654
715 Ga0209179_1002631
716 Ga0209813_10004469
717 Ga0209813_10045248
718 Ga0207428_10000114
719 Ga0207428_10020552
720 Ga0207428_10209385
721 Ga0268266_10031067
722 Ga0268266_10058086
723 Ga0268266_10059969
724 Ga0268266_10061611
725 Ga0268265_10001305
726 Ga0268265_10208650
727 Ga0265334_10022982
728 Ga0307515_10010300
729 Ga0307513_10132127
730 Ga0307513_10191528
731 Ga0307513_10220343
732 Ga0265314_10104074
733 Ga0316576_10007943
734 Ga0316576_10110408
735 Ga0307516_10026021
736 Ga0307516_10043199
737 Ga0316577_10059631
738 Ga0316583_10001259
739 Ga0307510_10037323
740 Ga0307510_10090208
741 Ga0373928_0016736
742 Ga0373949_0014624
743 Ga0373932_0002965
744 Ga0373936_0040819
745 Ga0373939_0040714
746 Ga0316574_0000070
747 Ga0373931_0004228
748 Ga0373931_0009630
749 Ga0373931_0010023
750 Ga0373927_0004757
751 Ga0373927_0006676
752 Ga0373927_0007742
753 Ga0373927_0149239
754 Ga0373947_0064319
755 Ga0373947_0105450
756 Ga0316582_0010500
757 Ga0316582_0057639
758 Ga0316582_0078167
759 Ga0373925_0266257
760 Ga0436364_0188162
761 Ga0395901_0118682
762 Ga0436365_1318019
763 Ga0436361_0102991
764 Ga0436361_0273974
765 Ga0451577_0054387
766 Ga0453683_0251529
767 Ga0466958_0027164
768 Ga0495617_018983
769 Ga0495603_0021190
770 Ga0495638_0024885
771 Ga0495638_0025949
772 Ga0495641_0089897
773 Ga0495639_0110309
774 Ga0495594_0162965
775 Ga0495607_0159472
776 Ga0495632_0015109
777 Ga0495637_0015213
778 Ga0495644_0055868
779 Ga0495663_0005891
780 Ga0495668_0008723
781 Ga0495659_0004327
782 Ga0495659_0038941
783 Ga0495661_0072335
784 Ga0495670_0011416
785 Ga0495676_0102303
786 Ga0495683_0080468
787 Ga0496100_0037939
788 Ga0496100_0077887
789 Ga0496101_0046142
790 Ga0496101_0050675
791 Ga0496101_0054532
792 Ga0496102_0049051
793 Ga0496102_0102830
794 Ga0496102_0136352
795 Ga0496102_0196149
796 Ga0496102_0267958
797 Ga0496104_0001605
798 Ga0496104_0014197
799 Ga0496104_0018487
800 Ga0496104_0018599
801 Ga0496104_0189486
802 Ga0496105_0004279
803 Ga0496105_0008006
804 Ga0496105_0077344
805 Ga0496105_0263826
806 Ga0496106_0009190
807 Ga0496106_0028829
808 Ga0496106_0053045
809 Ga0496107_0163016
810 Ga0496108_0018035
811 Ga0496108_0082645
812 Ga0496108_0386944
813 Ga0496109_0117462
814 Ga0496109_0119576
815 Ga0496109_0203812
816 Ga0496109_0339691
817 Ga0496109_0419008
818 Ga0496109_0546149
819 Ga0496110_0001798
820 Ga0496110_0019331
821 Ga0496110_0096059
822 Ga0496110_0141128
823 Ga0496111_0022976
824 Ga0496111_0041270
825 Ga0496111_0041842
826 Ga0496111_0149167
827 Ga0496112_0000004
828 Ga0496112_0135330
829 Ga0496112_0185241
830 Ga0496113_0008797
831 Ga0496113_0023154
832 Ga0496113_0079950
833 Ga0496114_0024848
834 Ga0496115_0019844
835 Ga0496115_0153967
836 Ga0496120_0123577
837 Ga0496121_0108413
838 Ga0496122_0215077
839 Ga0496125_0005191
840 Ga0496126_0024679
841 Ga0501031_0186694
842 Ga0501034_0028426
843 Ga0501034_0329370
844 Ga0501036_0257207
845 Ga0501038_0003074
846 Ga0501047_0025585
847 Ga0501047_0039189
848 Ga0501047_0051371
849 Ga0501067_0077572
850 Ga0501069_0049206
851 Ga0501070_0005410
852 Ga0501070_0062968
853 Ga0501073_0001548
854 Ga0501074_0001537
855 Ga0501079_0001387
856 Ga0501080_0007140
857 Ga0501080_0110871
858 Ga0501083_0006285
859 Ga0501083_0010528
860 Ga0501044_0007362
861 Ga0501044_0054519
862 nmdc:mga03n38_1847_c1
863 nmdc:mga0yw44_15032_c1
864 nmdc:mga0yw44_24059_c1
865 nmdc:mga0yw44_70467_c1
866 nmdc:mga0yw44_93087_c1
867 nmdc:mga06z11_1051_c1
868 nmdc:mga04h51_17117_c1
869 nmdc:mga04h51_38908_c1
870 nmdc:mga07m45_84909_c1
871 nmdc:mga05p37_107709_c1
872 nmdc:mga05p37_335709_c1
873 nmdc:mga05p37_56_c3
874 nmdc:mga05p37_901_c1
875 nmdc:mga09592_11672_c1
876 nmdc:mga09592_12259_c1
877 nmdc:mga0qj67_14232_c1
878 nmdc:mga0qj67_192442_c1
879 nmdc:mga0qj67_7143_c1
880 nmdc:mga06r32_2589_c1
881 nmdc:mga06r32_806_c1
882 nmdc:mga08y16_1083_c1
883 nmdc:mga08y16_206_c1
884 nmdc:mga08y16_60561_c1
885 nmdc:mga08y16_82547_c1
886 nmdc:mga0n895_15238_c1
887 nmdc:mga0n895_19529_c1
888 nmdc:mga0n895_220034_c1
889 nmdc:mga0n895_256872_c1
890 nmdc:mga0n895_264268_c1
891 nmdc:mga0n895_310993_c1
892 nmdc:mga0n895_33431_c1
893 nmdc:mga0n895_45426_c1
894 nmdc:mga0rr50_206848_c1
895 nmdc:mga0rr50_22664_c1
896 nmdc:mga0rr50_228391_c1
897 nmdc:mga0rr50_28970_c1
898 nmdc:mga0rr50_37066_c1
899 nmdc:mga0a205_10132_c2
900 nmdc:mga0a205_16755_c1
901 nmdc:mga0a205_196640_c1
902 nmdc:mga0a205_80_c1
903 nmdc:mga0sz30_147_c1
904 nmdc:mga0sz30_15009_c1
905 Ga0495595_0088886
906 Ga0500641_0002234
907 Ga0500595_000539
908 Ga0500595_000659
909 Ga0500642_0103570
910 Ga0500559_0019405
911 Ga0500577_0066849
912 Ga0500616_0000962
913 Ga0500634_0077432
914 Ga0500638_012290
915 Ga0500638_015731
916 Ga0500637_0046608
917 Ga0500645_007753
918 Ga0500609_000220
919 Ga0500552_000488
920 Ga0501082_0024177
921 Ga0501082_0171815
922 2643772202
923 2643840474
924 2774873191
925 2793079657
926 2793081845
927 2874605737
928 2876808954
929 2879110258
930 2889040694
931 2922365919
932 2922393048
933 2995394601
934 8006990391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17912

OB_MalK

MalK OB fold domain

261

315

0.96

PF08402

TOBE_2

TOBE domain

308

380

0.95

PF00005

ABC_tran

ABC transporter

45

188

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v43-assembly1.cif.gz_A crystal structure of atpase subunit of abc sugar transporter 0.9567 1 373
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9488 4 234
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9482 4 373
1v43-assembly1.cif.gz_A crystal structure of atpase subunit of abc sugar transporter 0.9462 1 373
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9448 3 234
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9867 3 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9737 1 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9731 3 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 1 218 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.984 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9792 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A379D261-F1-model_v4 deleted 0.9757 1 231
AF-Q92ZS1-F1-model_v4 ABC transporter, ATP-binding protein, amino terminus 0.9748 1 167 GO:0005524
GO:0016887
GO:0055052
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.968 4 160 GO:0005524
GO:0016887

Map