F449877

General Info

Members Datasets Scaffolds Average Seq Length
467 261 447 164

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10191839|Ga0265327_101918392
Length 174
Sequence MTRDLSHYRPNVGVVLFHPDGRVWLGRRANTSGPHNWQFPQGGVDPGEDLEAAARRELAEETGATRASLLSRTHDWVAYDFPPGHGGAKALRGWKGQKQVWFALRFEGEDSDFNLAAHGPPEFDAWRWAYLTEAAELIVPFKREAYERVVAAFGTFAAPRAQDGAQCSGRTEPA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
14 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2818991435 Caulobacter henricii 536 Isolate Unclassified
17 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
18 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
19 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
20 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
147 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
223 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
250 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
255 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
259 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.27
Nodule 0
Rhizoplane 5.35
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 8.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1007310 3300002741 Bacteria 1602
2 JGI25153J46596_10024213 3300003215 Bacteria 2193
3 Ga0055537_1010976 3300003773 Bacteria 1870
4 Ga0055537_1017926 3300003773 Bacteria 1148
5 Ga0055524_1008359 3300003775 Bacteria 4305
6 Ga0055524_1044452 3300003775 Bacteria 1079
7 Ga0055536_1004775 3300003781 Bacteria 6799
8 Ga0055536_1006298 3300003781 Bacteria 5581
9 Ga0055528_1029207 3300003790 Bacteria 1499
10 Ga0055530_10005997 3300003791 Bacteria 5578
11 Ga0055530_10007660 3300003791 Bacteria 4499
12 Ga0055530_10010666 3300003791 Bacteria 3370
13 Ga0055531_10000528 3300003794 Bacteria 34315
14 Ga0055531_10005057 3300003794 Bacteria 7814
15 Ga0055531_10031737 3300003794 Bacteria 1742
16 Ga0055543_1016202 3300004625 Bacteria 1421
17 Ga0065165_1000554 3300005262 Bacteria 56028
18 Ga0065165_1027189 3300005262 Bacteria 1870
19 Ga0070658_10018098 3300005327 Bacteria 5636
20 Ga0070658_10205260 3300005327 Bacteria 1664
21 Ga0070658_10462389 3300005327 Bacteria 1094
22 Ga0070658_10518068 3300005327 Bacteria 1031
23 Ga0070670_100810201 3300005331 Bacteria 846
24 Ga0070666_10459559 3300005335 Bacteria 920
25 Ga0070680_100001019 3300005336 Bacteria 20015
26 Ga0070680_100025991 3300005336 Bacteria 4682
27 Ga0070660_100005603 3300005339 Bacteria 8705
28 Ga0070660_100427251 3300005339 Bacteria 1097
29 Ga0070691_10016419 3300005341 Bacteria 3400
30 Ga0070661_100825365 3300005344 Bacteria 762
31 Ga0070661_101131949 3300005344 Bacteria 653
32 Ga0070669_100526414 3300005353 Bacteria 983
33 Ga0070669_100569116 3300005353 Bacteria 946
34 Ga0070671_100017977 3300005355 Bacteria 5735
35 Ga0070671_100119378 3300005355 Bacteria 2219
36 Ga0070671_100797413 3300005355 Bacteria 822
37 Ga0070659_100000399 3300005366 Bacteria 32898
38 Ga0070659_100019649 3300005366 Bacteria 5124
39 Ga0070667_100424017 3300005367 Bacteria 1213
40 Ga0070678_100506338 3300005456 Bacteria 1066
41 Ga0070681_10030836 3300005458 Bacteria 5382
42 Ga0070681_10061447 3300005458 Bacteria 3731
43 Ga0070681_10184968 3300005458 Bacteria 2004
44 Ga0070679_100011485 3300005530 Bacteria 8440
45 Ga0070679_100054681 3300005530 Bacteria 3975
46 Ga0070679_100494102 3300005530 Bacteria 1168
47 Ga0068853_100021697 3300005539 Bacteria 5358
48 Ga0068853_100024558 3300005539 Bacteria 5054
49 Ga0068853_100077326 3300005539 Bacteria 2907
50 Ga0068853_100297473 3300005539 Bacteria 1491
51 Ga0068853_100318651 3300005539 Bacteria 1441
52 Ga0070695_101118116 3300005545 Bacteria 645
53 Ga0070665_100000418 3300005548 Bacteria 62048
54 Ga0070665_100020455 3300005548 Bacteria 6647
55 Ga0070665_100327971 3300005548 Bacteria 1535
56 Ga0068855_100041023 3300005563 Bacteria 5488
57 Ga0068855_100151958 3300005563 Bacteria 2632
58 Ga0068855_100225932 3300005563 Bacteria 2098
59 Ga0068855_100390403 3300005563 Bacteria 1527
60 Ga0070664_100200076 3300005564 Bacteria 1783
61 Ga0068857_100071006 3300005577 Bacteria 3102
62 Ga0068856_100180801 3300005614 Bacteria 2122
63 Ga0068856_100741804 3300005614 Bacteria 1002
64 Ga0068864_100000993 3300005618 Bacteria 23722
65 Ga0068864_100075655 3300005618 Bacteria 2940
66 Ga0068864_100082886 3300005618 Bacteria 2815
67 Ga0068851_10215763 3300005834 Bacteria 1076
68 Ga0068863_100000066 3300005841 Bacteria 117816
69 Ga0068863_100177741 3300005841 Bacteria 2043
70 Ga0068863_101836107 3300005841 Bacteria 616
71 Ga0068858_100002124 3300005842 Bacteria 20089
72 Ga0068858_100678694 3300005842 Bacteria 1002
73 Ga0068860_101211825 3300005843 Bacteria 775
74 Ga0070717_10203489 3300006028 Bacteria 1735
75 Ga0075368_10010296 3300006042 Bacteria 3378
76 Ga0075364_10002819 3300006051 Bacteria 9788
77 Ga0075367_10012466 3300006178 Bacteria 4535
78 Ga0075369_10008315 3300006186 Bacteria 3991
79 Ga0075369_10118882 3300006186 Bacteria 1195
80 Ga0075366_10019491 3300006195 Bacteria 3926
81 Ga0075366_10078928 3300006195 Bacteria 1964
82 Ga0075370_10101272 3300006353 Bacteria 1667
83 Ga0075370_10114990 3300006353 Bacteria 1564
84 Ga0075370_10205487 3300006353 Bacteria 1162
85 Ga0075370_10313424 3300006353 Bacteria 934
86 Ga0075370_10455920 3300006353 Bacteria 770
87 Ga0068865_100003519 3300006881 Bacteria 9387
88 Ga0068865_100364571 3300006881 Bacteria 1174
89 Ga0105251_10122758 3300009011 Bacteria 1179
90 Ga0105250_10005952 3300009092 Bacteria 5390
91 Ga0105240_10003732 3300009093 Bacteria 23537
92 Ga0105240_10246852 3300009093 Bacteria 2067
93 Ga0105240_10296749 3300009093 Bacteria 1850
94 Ga0105240_10300674 3300009093 Bacteria 1836
95 Ga0105240_10916603 3300009093 Bacteria 942
96 Ga0105240_11244343 3300009093 Bacteria 787
97 Ga0105247_10453757 3300009101 Bacteria 925
98 Ga0105241_10335502 3300009174 Bacteria 1308
99 Ga0105248_10003646 3300009177 Bacteria 17096
100 Ga0105248_10017964 3300009177 Bacteria 7806
101 Ga0105248_10077036 3300009177 Bacteria 3748
102 Ga0105248_10186177 3300009177 Bacteria 2339
103 Ga0105237_11320464 3300009545 Bacteria 728
104 Ga0105238_10023706 3300009551 Bacteria 6254
105 Ga0105238_10026036 3300009551 Bacteria 5962
106 Ga0105238_10177985 3300009551 Bacteria 2104
107 Ga0105239_10036093 3300010375 Bacteria 5428
108 Ga0105239_10304635 3300010375 Bacteria 1794
109 Ga0105239_10312298 3300010375 Bacteria 1772
110 Ga0105239_10757150 3300010375 Bacteria 1112
111 Ga0105239_11338907 3300010375 Bacteria 826
112 Ga0105239_11703361 3300010375 Bacteria 730
113 Ga0157369_10310106 3300013105 Bacteria 1641
114 Ga0163162_10479558 3300013306 Bacteria 1375
115 Ga0157375_10277651 3300013308 Bacteria 1838
116 Ga0163163_10403688 3300014325 Bacteria 1425
117 Ga0163163_10552153 3300014325 Bacteria 1214
118 Ga0157379_10037451 3300014968 Bacteria 4325
119 Ga0157379_10678062 3300014968 Bacteria 966
120 Ga0182007_10030889 3300015262 Bacteria 1828
121 Ga0209026_1001029 3300025250 Bacteria 13706
122 Ga0209565_1000149 3300025263 Bacteria 96195
123 Ga0209673_1024934 3300025273 Bacteria 1999
124 Ga0209675_1045973 3300025291 Bacteria 925
125 Ga0209676_1000295 3300025292 Bacteria 100711
126 Ga0209676_1000414 3300025292 Bacteria 76877
127 Ga0209564_1002321 3300025295 Bacteria 15414
128 Ga0209564_1023106 3300025295 Bacteria 2172
129 Ga0209564_1038423 3300025295 Bacteria 1332
130 Ga0209758_1000936 3300025297 Bacteria 39430
131 Ga0209758_1002036 3300025297 Bacteria 21701
132 Ga0209758_1005596 3300025297 Bacteria 9558
133 Ga0209050_1000245 3300025298 Bacteria 116929
134 Ga0209050_1000362 3300025298 Bacteria 87030
135 Ga0209050_1005917 3300025298 Bacteria 7457
136 Ga0209050_1021187 3300025298 Bacteria 2380
137 Ga0209256_1004236 3300025299 Bacteria 9195
138 Ga0209256_1005495 3300025299 Bacteria 7253
139 Ga0209256_1014605 3300025299 Bacteria 2811
140 Ga0209051_1039949 3300025303 Bacteria 1688
141 Ga0209257_1000036 3300025304 Bacteria 616006
142 Ga0209257_1000282 3300025304 Bacteria 113789
143 Ga0209257_1001133 3300025304 Bacteria 34214
144 Ga0209257_1002271 3300025304 Bacteria 19599
145 Ga0209257_1005655 3300025304 Bacteria 8636
146 Ga0207710_10200566 3300025900 Bacteria 985
147 Ga0207680_10196613 3300025903 Bacteria 1372
148 Ga0207705_10002027 3300025909 Bacteria 15769
149 Ga0207705_10218341 3300025909 Bacteria 1447
150 Ga0207705_10285151 3300025909 Bacteria 1265
151 Ga0207654_10440548 3300025911 Bacteria 912
152 Ga0207707_10124352 3300025912 Bacteria 2256
153 Ga0207707_10147627 3300025912 Bacteria 2056
154 Ga0207695_10000837 3300025913 Bacteria 56634
155 Ga0207695_10007867 3300025913 Bacteria 13459
156 Ga0207695_10070511 3300025913 Bacteria 3572
157 Ga0207695_10217797 3300025913 Bacteria 1817
158 Ga0207695_10339878 3300025913 Bacteria 1389
159 Ga0207695_10406722 3300025913 Bacteria 1245
160 Ga0207671_10418603 3300025914 Bacteria 1066
161 Ga0207660_10007742 3300025917 Bacteria 6956
162 Ga0207660_10248832 3300025917 Bacteria 1403
163 Ga0207657_10017426 3300025919 Bacteria 6887
164 Ga0207657_10031047 3300025919 Bacteria 4844
165 Ga0207657_10031417 3300025919 Bacteria 4810
166 Ga0207649_10424762 3300025920 Bacteria 999
167 Ga0207649_10640944 3300025920 Bacteria 820
168 Ga0207652_10001554 3300025921 Bacteria 20200
169 Ga0207652_10048861 3300025921 Bacteria 3618
170 Ga0207652_10323755 3300025921 Bacteria 1392
171 Ga0207681_10531224 3300025923 Bacteria 966
172 Ga0207694_10155813 3300025924 Bacteria 1842
173 Ga0207694_10547185 3300025924 Bacteria 971
174 Ga0207644_10053491 3300025931 Bacteria 2905
175 Ga0207644_10087214 3300025931 Bacteria 2319
176 Ga0207644_10498551 3300025931 Bacteria 1004
177 Ga0207644_10714303 3300025931 Bacteria 836
178 Ga0207644_11501646 3300025931 Bacteria 565
179 Ga0207690_10000898 3300025932 Bacteria 18981
180 Ga0207690_10424663 3300025932 Bacteria 1064
181 Ga0207706_10727610 3300025933 Bacteria 846
182 Ga0207704_10002243 3300025938 Bacteria 8675
183 Ga0207711_10001468 3300025941 Bacteria 21987
184 Ga0207711_10031054 3300025941 Bacteria 4508
185 Ga0207711_10072257 3300025941 Bacteria 2997
186 Ga0207711_10353218 3300025941 Bacteria 1361
187 Ga0207711_10454912 3300025941 Bacteria 1192
188 Ga0207679_10314017 3300025945 Bacteria 1355
189 Ga0207667_10004404 3300025949 Bacteria 17251
190 Ga0207667_10034966 3300025949 Bacteria 5393
191 Ga0207667_10248508 3300025949 Bacteria 1820
192 Ga0207640_10629312 3300025981 Bacteria 912
193 Ga0207658_10394516 3300025986 Bacteria 1215
194 Ga0207677_11609049 3300026023 Bacteria 601
195 Ga0207703_10000065 3300026035 Bacteria 126087
196 Ga0207703_11174053 3300026035 Bacteria 738
197 Ga0207639_10027411 3300026041 Bacteria 4151
198 Ga0207639_10043924 3300026041 Bacteria 3358
199 Ga0207639_10256352 3300026041 Bacteria 1528
200 Ga0207639_10930017 3300026041 Bacteria 813
201 Ga0207678_10200869 3300026067 Bacteria 1704
202 Ga0207702_10590607 3300026078 Bacteria 1089
203 Ga0207702_10603078 3300026078 Bacteria 1077
204 Ga0207641_10000011 3300026088 Bacteria 384362
205 Ga0207641_10148183 3300026088 Bacteria 2124
206 Ga0207676_10007791 3300026095 Bacteria 7616
207 Ga0207676_10072958 3300026095 Bacteria 2761
208 Ga0207676_10503367 3300026095 Bacteria 1150
209 Ga0207676_11400195 3300026095 Bacteria 695
210 Ga0207683_10061054 3300026121 Bacteria 3316
211 Ga0209813_10111574 3300027866 Bacteria 943
212 Ga0268266_10000003 3300028379 Bacteria 1701703
213 Ga0268266_10022099 3300028379 Bacteria 5423
214 Ga0268266_10135188 3300028379 Bacteria 2208
215 Ga0268266_10310568 3300028379 Bacteria 1473
216 Ga0307517_10051053 3300028786 Bacteria 4186
217 Ga0307515_10018388 3300028794 Bacteria 12655
218 Ga0307515_10494507 3300028794 Bacteria 834
219 Ga0265327_10191839 3300031251 Bacteria 929
220 Ga0307513_10007022 3300031456 Bacteria 14647
221 Ga0307513_10010412 3300031456 Bacteria 11657
222 Ga0307408_101508285 3300031548 Bacteria 636
223 Ga0307508_10246600 3300031616 Bacteria 1383
224 Ga0307413_11411633 3300031824 Bacteria 613
225 Ga0307414_10314628 3300032004 Bacteria 1330
226 Ga0307414_10347727 3300032004 Bacteria 1271
227 Ga0307510_10017521 3300033180 Bacteria 8445
228 Ga0307510_10133511 3300033180 Bacteria 2147
229 Ga0373941_0171434 3300035115 Bacteria 809
230 Ga0373935_0573895 3300035692 Bacteria 823
231 Ga0395899_0000052 3300037312 Bacteria 221643
232 Ga0395899_0165759 3300037312 Bacteria 1559
233 Ga0395899_0299904 3300037312 Bacteria 1088
234 Ga0395899_0797915 3300037312 Bacteria 584
235 Ga0395900_0000002 3300037418 Bacteria 671103
236 Ga0395900_0021999 3300037418 Bacteria 6520
237 Ga0395900_0397166 3300037418 Bacteria 1344
238 Ga0395898_0016641 3300037466 Bacteria 7516
239 Ga0395898_0065978 3300037466 Bacteria 3508
240 Ga0395905_0003587 3300037471 Bacteria 16515
241 Ga0395905_0030066 3300037471 Bacteria 5120
242 Ga0395905_0193514 3300037471 Bacteria 1907
243 Ga0395905_0290654 3300037471 Bacteria 1521
244 Ga0395905_0431073 3300037471 Bacteria 1215
245 Ga0395905_0932298 3300037471 Bacteria 771
246 Ga0395901_0000013 3300038443 Bacteria 375733
247 Ga0395901_0263638 3300038443 Bacteria 1793
248 Ga0436365_0656099 3300039437 Bacteria 4996
249 Ga0451795_1448789 3300041456 Bacteria 640
250 Ga0451849_1264467 3300041505 Bacteria 729
251 Ga0451853_0522904 3300041512 Bacteria 651
252 Ga0451853_1090863 3300041512 Bacteria 874
253 Ga0439437_021924 3300042000 Bacteria 776
254 Ga0439441_024682 3300042001 Bacteria 1130
255 Ga0439435_0008278 3300042436 Bacteria 2409
256 Ga0439459_0014759 3300042438 Bacteria 1424
257 Ga0450893_0012212 3300042532 Bacteria 1426
258 Ga0466966_0296641 3300044684 Bacteria 972
259 Ga0466964_0147613 3300044706 Bacteria 1087
260 Ga0453684_0371582 3300044712 Bacteria 1607
261 Ga0495627_000879 3300046453 Bacteria 21159
262 Ga0495629_0025481 3300046459 Bacteria 4203
263 Ga0495638_0001712 3300046460 Bacteria 19316
264 Ga0495638_0002843 3300046460 Bacteria 13873
265 Ga0495638_0003079 3300046460 Bacteria 13234
266 Ga0495638_0043752 3300046460 Bacteria 2823
267 Ga0495638_0291407 3300046460 Bacteria 883
268 Ga0495638_0291775 3300046460 Bacteria 882
269 Ga0495638_0439362 3300046460 Bacteria 668
270 Ga0495650_0000046 3300046471 Bacteria 342987
271 Ga0495580_0481675 3300046472 Bacteria 830
272 Ga0495585_0253622 3300046492 Bacteria 877
273 Ga0495607_0084419 3300046501 Bacteria 1737
274 Ga0495583_0000003 3300046506 Bacteria 709273
275 Ga0495583_0044584 3300046506 Bacteria 2056
276 Ga0495583_0140861 3300046506 Bacteria 1004
277 Ga0495583_0161898 3300046506 Bacteria 923
278 Ga0495606_0138636 3300046507 Bacteria 1438
279 Ga0495610_0006369 3300046512 Bacteria 8144
280 Ga0495616_0003030 3300046513 Bacteria 10891
281 Ga0495620_0015405 3300046515 Bacteria 3862
282 Ga0495620_0031642 3300046515 Bacteria 2422
283 Ga0495628_0305569 3300046516 Bacteria 1177
284 Ga0495628_0675873 3300046516 Bacteria 731
285 Ga0495631_0102411 3300046518 Bacteria 1232
286 Ga0495632_0201346 3300046519 Bacteria 906
287 Ga0495632_0235841 3300046519 Bacteria 824
288 Ga0495637_0002096 3300046520 Bacteria 11216
289 Ga0495643_0022556 3300046522 Bacteria 3591
290 Ga0495643_0218096 3300046522 Bacteria 906
291 Ga0495643_0221209 3300046522 Bacteria 898
292 Ga0495648_0070267 3300046524 Bacteria 2035
293 Ga0495648_0160648 3300046524 Bacteria 1162
294 Ga0495648_0269659 3300046524 Bacteria 812
295 Ga0495663_0159255 3300046525 Bacteria 774
296 Ga0495642_0002737 3300046528 Bacteria 7073
297 Ga0495654_0000039 3300046530 Bacteria 185363
298 Ga0495654_0051498 3300046530 Bacteria 2009
299 Ga0495609_0007443 3300046538 Bacteria 5468
300 Ga0495609_0242237 3300046538 Bacteria 744
301 Ga0495609_0287331 3300046538 Bacteria 672
302 Ga0495621_0224647 3300046539 Bacteria 761
303 Ga0495597_0025085 3300046542 Bacteria 2746
304 Ga0495597_0103535 3300046542 Bacteria 1198
305 Ga0495622_0014157 3300046557 Bacteria 3703
306 Ga0495633_0034208 3300046558 Bacteria 2445
307 Ga0495668_0000141 3300046616 Bacteria 108840
308 Ga0495668_0040182 3300046616 Bacteria 2609
309 Ga0495668_0074551 3300046616 Bacteria 1863
310 Ga0495668_0078391 3300046616 Bacteria 1814
311 Ga0495668_0080193 3300046616 Bacteria 1791
312 Ga0495668_0156107 3300046616 Bacteria 1250
313 Ga0495668_0179458 3300046616 Bacteria 1160
314 Ga0495668_0282844 3300046616 Bacteria 909
315 Ga0495668_0294350 3300046616 Bacteria 889
316 Ga0495668_0312689 3300046616 Bacteria 861
317 Ga0495668_0669645 3300046616 Bacteria 574
318 Ga0495611_0031395 3300046648 Bacteria 2338
319 Ga0495625_0000854 3300046660 Bacteria 41503
320 Ga0495625_0002619 3300046660 Bacteria 19256
321 Ga0495625_0007259 3300046660 Bacteria 9692
322 Ga0495625_0017757 3300046660 Bacteria 5563
323 Ga0495659_0035152 3300046664 Bacteria 1765
324 Ga0495659_0152166 3300046664 Bacteria 929
325 Ga0495588_0029606 3300046674 Bacteria 2748
326 Ga0495669_0000014 3300046684 Bacteria 140832
327 Ga0495669_0000081 3300046684 Bacteria 63806
328 Ga0495669_0013682 3300046684 Bacteria 3463
329 Ga0495669_0029160 3300046684 Bacteria 2419
330 Ga0495670_0403578 3300046691 Bacteria 738
331 Ga0495671_0575851 3300046692 Bacteria 536
332 Ga0495589_0030741 3300046794 Bacteria 2704
333 Ga0495660_0045926 3300046810 Bacteria 2396
334 Ga0495660_0139227 3300046810 Bacteria 1209
335 Ga0495636_0058432 3300047318 Bacteria 1626
336 Ga0495672_0006648 3300047320 Bacteria 8884
337 Ga0495672_0282875 3300047320 Bacteria 792
338 Ga0495683_0218075 3300047323 Bacteria 852
339 Ga0495687_038352 3300047443 Bacteria 2127
340 Ga0495677_0030910 3300047445 Bacteria 1949
341 Ga0495677_0062756 3300047445 Bacteria 1379
342 Ga0495677_0107685 3300047445 Bacteria 1058
343 Ga0495679_002625 3300047446 Bacteria 9023
344 Ga0495685_118899 3300047447 Bacteria 868
345 Ga0495681_0036503 3300047470 Bacteria 2429
346 Ga0495681_0243884 3300047470 Bacteria 712
347 Ga0495686_0009073 3300047472 Bacteria 7214
348 Ga0495686_0018149 3300047472 Bacteria 4726
349 Ga0495686_0135332 3300047472 Bacteria 1457
350 Ga0495686_0400882 3300047472 Bacteria 736
351 Ga0495602_0607602 3300048088 Bacteria 751
352 Ga0496100_0762107 3300048903 Bacteria 757
353 Ga0496102_0239731 3300048905 Bacteria 1710
354 Ga0496102_0331500 3300048905 Bacteria 1433
355 Ga0496103_0226534 3300048906 Bacteria 1202
356 Ga0496103_0346684 3300048906 Bacteria 955
357 Ga0496105_1096389 3300048908 Bacteria 591
358 Ga0496106_0009305 3300048909 Bacteria 7262
359 Ga0496107_0001541 3300048910 Bacteria 14314
360 Ga0496107_0115720 3300048910 Bacteria 1973
361 Ga0496108_0227007 3300048911 Bacteria 1623
362 Ga0496109_0143752 3300048912 Bacteria 2231
363 Ga0496110_1373854 3300048913 Bacteria 616
364 Ga0496111_0200943 3300048914 Bacteria 1482
365 Ga0496112_0017526 3300048915 Bacteria 6730
366 Ga0496112_0236290 3300048915 Bacteria 1781
367 Ga0496112_0273335 3300048915 Bacteria 1638
368 Ga0496113_0382773 3300048916 Bacteria 1129
369 Ga0496114_0924746 3300048917 Bacteria 754
370 Ga0496115_0000398 3300048918 Bacteria 35876
371 Ga0496115_0002868 3300048918 Bacteria 12420
372 Ga0496115_0016458 3300048918 Bacteria 5632
373 Ga0496115_0171223 3300048918 Bacteria 1796
374 Ga0496115_0471326 3300048918 Bacteria 1012
375 Ga0496115_0605548 3300048918 Bacteria 871
376 Ga0496117_0023814 3300048920 Bacteria 4863
377 Ga0496118_0064356 3300048921 Bacteria 2691
378 Ga0496119_0022659 3300048922 Bacteria 4487
379 Ga0496120_0121346 3300048923 Bacteria 1351
380 Ga0496121_0000035 3300048924 Bacteria 374316
381 Ga0496121_0001011 3300048924 Bacteria 50244
382 Ga0496121_0567876 3300048924 Bacteria 706
383 Ga0496124_0024169 3300048927 Bacteria 5531
384 Ga0496125_0058592 3300048928 Bacteria 3110
385 Ga0496125_0324733 3300048928 Bacteria 931
386 Ga0496126_0006901 3300048929 Bacteria 12578
387 Ga0496126_0414550 3300048929 Bacteria 1090
388 Ga0501033_0577329 3300049570 Bacteria 773
389 Ga0501047_0074385 3300049581 Bacteria 3271
390 Ga0501047_0176605 3300049581 Bacteria 2003
391 Ga0501047_0241684 3300049581 Bacteria 1656
392 Ga0501048_0051955 3300049582 Bacteria 2916
393 Ga0501238_002490 3300049671 Bacteria 2208
394 Ga0501270_155009 3300049767 Bacteria 525
395 Ga0501044_0023385 3300049823 Bacteria 6572
396 Ga0501044_0485937 3300049823 Bacteria 1137
397 nmdc:mga03683_210511_c1 3300050489 Bacteria 894
398 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
399 nmdc:mga0k408_442091_c1 3300050493 Bacteria 772
400 nmdc:mga0k408_79911_c1 3300050493 Bacteria 1914
401 nmdc:mga0k408_86891_c1 3300050493 Bacteria 1836
402 nmdc:mga07m45_110765_c1 3300050496 Bacteria 1581
403 nmdc:mga07m45_24930_c1 3300050496 Bacteria 3279
404 nmdc:mga07m45_73793_c1 3300050496 Bacteria 1943
405 nmdc:mga0sz30_7952_c1 3300050516 Bacteria 3991
406 Ga0500635_0002320 3300053080 Bacteria 4699
407 Ga0495655_0274291 3300053083 Bacteria 573
408 Ga0500647_0048756 3300053091 Bacteria 2036
409 Ga0500651_0092001 3300053093 Bacteria 1866
410 Ga0500554_018147 3300053102 Bacteria 1894
411 Ga0500555_034484 3300053103 Bacteria 1425
412 Ga0500556_0001380 3300053104 Bacteria 10608
413 Ga0500569_011330 3300053109 Bacteria 2126
414 Ga0500595_009155 3300053119 Bacteria 4010
415 Ga0500595_011477 3300053119 Bacteria 3468
416 Ga0500595_076701 3300053119 Bacteria 984
417 Ga0500607_021263 3300053121 Bacteria 3659
418 Ga0500607_051845 3300053121 Bacteria 2181
419 Ga0500608_034867 3300053122 Bacteria 2398
420 Ga0500614_025968 3300053123 Bacteria 1397
421 Ga0500618_000189 3300053125 Bacteria 50500
422 Ga0500642_0186204 3300053130 Bacteria 970
423 Ga0500655_037586 3300053133 Bacteria 944
424 Ga0500658_0034183 3300053134 Bacteria 2004
425 Ga0500658_0175160 3300053134 Bacteria 975
426 Ga0500559_0000221 3300053136 Bacteria 45774
427 Ga0500559_0007592 3300053136 Bacteria 4790
428 Ga0500559_0029052 3300053136 Bacteria 2365
429 Ga0500559_0120666 3300053136 Bacteria 1219
430 Ga0500577_0026301 3300053142 Bacteria 1980
431 Ga0500590_025425 3300053148 Bacteria 3075
432 Ga0500603_010535 3300053150 Bacteria 2090
433 Ga0500619_037981 3300053154 Bacteria 1507
434 Ga0500622_0179240 3300053156 Bacteria 980
435 Ga0500624_004418 3300053157 Unclassified 1851
436 Ga0500627_0112372 3300053158 Bacteria 1226
437 Ga0500638_101236 3300053162 Unclassified 1343
438 Ga0500639_252577 3300053163 Bacteria 705
439 Ga0500636_0016186 3300053177 Bacteria 4397
440 Ga0500637_0019922 3300053178 Bacteria 3625
441 Ga0500637_0054248 3300053178 Bacteria 2288
442 Ga0500576_222010 3300053725 Bacteria 619
443 Ga0500625_049621 3300053729 Bacteria 1944
444 Ga0500645_015649 3300053730 Bacteria 2400
445 Ga0500645_016287 3300053730 Bacteria 2342
446 Ga0500645_042933 3300053730 Bacteria 1332
447 Ga0500609_004607 3300053731 Bacteria 1901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049767 Ga0501270_155009 Ga0501270_155009_52_495 146
2 3300053156 Ga0500622_0179240 Ga0500622_0179240_207_695 147
3 3300053163 Ga0500639_252577 Ga0500639_252577_15_479 150
4 3300053136 Ga0500559_0120666 Ga0500559_0120666_20_535 152
5 3300003773 Ga0055537_1017926 Ga0055537_10179262 155
6 3300005458 Ga0070681_10184968 Ga0070681_101849682 156
7 3300005530 Ga0070679_100494102 Ga0070679_1004941021 156
8 3300005539 Ga0068853_100077326 Ga0068853_1000773262 156
9 3300025912 Ga0207707_10147627 Ga0207707_101476272 156
10 3300025921 Ga0207652_10323755 Ga0207652_103237552 156
11 3300026041 Ga0207639_10043924 Ga0207639_100439242 156
12 3300037418 Ga0395900_0021999 Ga0395900_0021999_5102_5575 156
13 3300037466 Ga0395898_0065978 Ga0395898_0065978_448_921 156
14 3300037471 Ga0395905_0193514 Ga0395905_0193514_466_939 156
15 3300038443 Ga0395901_0263638 Ga0395901_0263638_276_749 156
16 iso_pu_bacteria 2510917020 2511123173 156
17 iso_pu_bacteria 2582581280 2585153502 156
18 iso_pu_bacteria 2582581293 2585196875 156
19 iso_pu_bacteria 2585428106 2587919096 156
20 iso_pu_bacteria 2643221552 2643783111 156
21 iso_pu_bacteria 2643221583 2643927020 156
22 iso_pu_bacteria 2643221584 2643930289 156
23 iso_pu_bacteria 2643221640 2644227494 156
24 iso_pu_bacteria 2643221642 2644236988 156
25 iso_pu_bacteria 2818991435 2819537669 156
26 iso_pu_bacteria 2818991454 2819647446 156
27 iso_pu_bacteria 2857504554 2857508486 156
28 iso_pu_bacteria 2884960567 2884961283 156
29 iso_pu_bacteria 2928531327 2928531794 156
30 3300005335 Ga0070666_10459559 Ga0070666_104595592 157
31 3300005548 Ga0070665_100020455 Ga0070665_1000204555 157
32 3300028379 Ga0268266_10022099 Ga0268266_100220993 157
33 3300035692 Ga0373935_0573895 Ga0373935_0573895_204_680 157
34 3300037312 Ga0395899_0165759 Ga0395899_0165759_205_681 157
35 3300037312 Ga0395899_0797915 Ga0395899_0797915_83_559 157
36 3300037418 Ga0395900_0397166 Ga0395900_0397166_307_783 157
37 3300037471 Ga0395905_0030066 Ga0395905_0030066_2916_3392 157
38 3300046524 Ga0495648_0269659 Ga0495648_0269659_232_747 157
39 3300049581 Ga0501047_0241684 Ga0501047_0241684_332_808 157
40 3300053136 Ga0500559_0000221 Ga0500559_0000221_9207_9698 157
41 3300003773 Ga0055537_1010976 Ga0055537_10109762 158
42 3300003775 Ga0055524_1008359 Ga0055524_10083593 158
43 3300003775 Ga0055524_1044452 Ga0055524_10444522 158
44 3300003781 Ga0055536_1004775 Ga0055536_10047755 158
45 3300003781 Ga0055536_1006298 Ga0055536_10062985 158
46 3300003790 Ga0055528_1029207 Ga0055528_10292072 158
47 3300003791 Ga0055530_10005997 Ga0055530_100059975 158
48 3300003791 Ga0055530_10007660 Ga0055530_100076605 158
49 3300003794 Ga0055531_10000528 Ga0055531_100005285 158
50 3300003794 Ga0055531_10031737 Ga0055531_100317372 158
51 3300005353 Ga0070669_100526414 Ga0070669_1005264142 158
52 3300006186 Ga0075369_10008315 Ga0075369_100083153 158
53 3300006195 Ga0075366_10019491 Ga0075366_100194912 158
54 3300006353 Ga0075370_10114990 Ga0075370_101149902 158
55 3300006353 Ga0075370_10313424 Ga0075370_103134242 158
56 3300025263 Ga0209565_1000149 Ga0209565_100014930 158
57 3300025273 Ga0209673_1024934 Ga0209673_10249342 158
58 3300025291 Ga0209675_1045973 Ga0209675_10459732 158
59 3300025292 Ga0209676_1000295 Ga0209676_100029586 158
60 3300025292 Ga0209676_1000414 Ga0209676_10004149 158
61 3300025295 Ga0209564_1002321 Ga0209564_100232110 158
62 3300025295 Ga0209564_1023106 Ga0209564_10231062 158
63 3300025295 Ga0209564_1038423 Ga0209564_10384232 158
64 3300025297 Ga0209758_1002036 Ga0209758_100203612 158
65 3300025297 Ga0209758_1005596 Ga0209758_10055966 158
66 3300025298 Ga0209050_1000362 Ga0209050_100036278 158
67 3300025298 Ga0209050_1005917 Ga0209050_10059173 158
68 3300025298 Ga0209050_1021187 Ga0209050_10211873 158
69 3300025299 Ga0209256_1004236 Ga0209256_10042362 158
70 3300025299 Ga0209256_1005495 Ga0209256_10054953 158
71 3300025299 Ga0209256_1014605 Ga0209256_10146053 158
72 3300025303 Ga0209051_1039949 Ga0209051_10399491 158
73 3300025304 Ga0209257_1000036 Ga0209257_100003644 158
74 3300025304 Ga0209257_1000282 Ga0209257_100028276 158
75 3300025304 Ga0209257_1005655 Ga0209257_10056557 158
76 3300025903 Ga0207680_10196613 Ga0207680_101966132 158
77 3300028794 Ga0307515_10018388 Ga0307515_100183889 158
78 3300028794 Ga0307515_10494507 Ga0307515_104945072 158
79 3300037471 Ga0395905_0431073 Ga0395905_0431073_557_1036 158
80 3300041456 Ga0451795_1448789 Ga0451795_1448789_84_596 158
81 3300041505 Ga0451849_1264467 Ga0451849_1264467_189_701 158
82 3300041512 Ga0451853_1090863 Ga0451853_1090863_315_812 158
83 3300042000 Ga0439437_021924 Ga0439437_021924_138_635 158
84 3300042001 Ga0439441_024682 Ga0439441_024682_230_718 158
85 3300042436 Ga0439435_0008278 Ga0439435_0008278_924_1421 158
86 3300042438 Ga0439459_0014759 Ga0439459_0014759_535_1023 158
87 3300042532 Ga0450893_0012212 Ga0450893_0012212_382_879 158
88 3300044706 Ga0466964_0147613 Ga0466964_0147613_277_765 158
89 3300046453 Ga0495627_000879 Ga0495627_000879_8479_8976 158
90 3300046460 Ga0495638_0001712 Ga0495638_0001712_8972_9469 158
91 3300046460 Ga0495638_0002843 Ga0495638_0002843_8402_8899 158
92 3300046460 Ga0495638_0003079 Ga0495638_0003079_10505_10999 158
93 3300046460 Ga0495638_0043752 Ga0495638_0043752_1968_2456 158
94 3300046460 Ga0495638_0291407 Ga0495638_0291407_41_538 158
95 3300046460 Ga0495638_0291775 Ga0495638_0291775_297_788 158
96 3300046460 Ga0495638_0439362 Ga0495638_0439362_20_517 158
97 3300046471 Ga0495650_0000046 Ga0495650_0000046_102931_103428 158
98 3300046501 Ga0495607_0084419 Ga0495607_0084419_768_1265 158
99 3300046506 Ga0495583_0000003 Ga0495583_0000003_202472_202969 158
100 3300046506 Ga0495583_0161898 Ga0495583_0161898_38_535 158
101 3300046507 Ga0495606_0138636 Ga0495606_0138636_626_1114 158
102 3300046512 Ga0495610_0006369 Ga0495610_0006369_233_727 158
103 3300046513 Ga0495616_0003030 Ga0495616_0003030_9077_9574 158
104 3300046515 Ga0495620_0015405 Ga0495620_0015405_404_901 158
105 3300046518 Ga0495631_0102411 Ga0495631_0102411_635_1132 158
106 3300046519 Ga0495632_0201346 Ga0495632_0201346_230_727 158
107 3300046519 Ga0495632_0235841 Ga0495632_0235841_126_623 158
108 3300046520 Ga0495637_0002096 Ga0495637_0002096_3183_3680 158
109 3300046522 Ga0495643_0218096 Ga0495643_0218096_26_520 158
110 3300046522 Ga0495643_0221209 Ga0495643_0221209_306_794 158
111 3300046524 Ga0495648_0070267 Ga0495648_0070267_254_751 158
112 3300046524 Ga0495648_0160648 Ga0495648_0160648_475_963 158
113 3300046530 Ga0495654_0000039 Ga0495654_0000039_10025_10522 158
114 3300046538 Ga0495609_0242237 Ga0495609_0242237_171_659 158
115 3300046538 Ga0495609_0287331 Ga0495609_0287331_151_660 158
116 3300046542 Ga0495597_0103535 Ga0495597_0103535_427_921 158
117 3300046558 Ga0495633_0034208 Ga0495633_0034208_1101_1598 158
118 3300046616 Ga0495668_0000141 Ga0495668_0000141_100093_100581 158
119 3300046616 Ga0495668_0040182 Ga0495668_0040182_684_1172 158
120 3300046616 Ga0495668_0294350 Ga0495668_0294350_225_737 158
121 3300046660 Ga0495625_0000854 Ga0495625_0000854_31467_31964 158
122 3300046660 Ga0495625_0002619 Ga0495625_0002619_10183_10680 158
123 3300046660 Ga0495625_0007259 Ga0495625_0007259_9036_9533 158
124 3300046660 Ga0495625_0017757 Ga0495625_0017757_3414_3908 158
125 3300046664 Ga0495659_0035152 Ga0495659_0035152_1253_1750 158
126 3300046691 Ga0495670_0403578 Ga0495670_0403578_203_700 158
127 3300046692 Ga0495671_0575851 Ga0495671_0575851_26_523 158
128 3300046794 Ga0495589_0030741 Ga0495589_0030741_852_1361 158
129 3300046810 Ga0495660_0045926 Ga0495660_0045926_1139_1633 158
130 3300046810 Ga0495660_0139227 Ga0495660_0139227_212_724 158
131 3300047320 Ga0495672_0006648 Ga0495672_0006648_7885_8379 158
132 3300047323 Ga0495683_0218075 Ga0495683_0218075_233_730 158
133 3300047446 Ga0495679_002625 Ga0495679_002625_4562_5059 158
134 3300047470 Ga0495681_0036503 Ga0495681_0036503_1371_1868 158
135 3300047472 Ga0495686_0009073 Ga0495686_0009073_5193_5687 158
136 3300047472 Ga0495686_0135332 Ga0495686_0135332_461_952 158
137 3300048909 Ga0496106_0009305 Ga0496106_0009305_3954_4448 158
138 3300048910 Ga0496107_0001541 Ga0496107_0001541_9381_9875 158
139 3300048915 Ga0496112_0273335 Ga0496112_0273335_1099_1578 158
140 3300048917 Ga0496114_0924746 Ga0496114_0924746_161_649 158
141 3300048918 Ga0496115_0002868 Ga0496115_0002868_4373_4870 158
142 3300048918 Ga0496115_0171223 Ga0496115_0171223_732_1220 158
143 3300048918 Ga0496115_0605548 Ga0496115_0605548_256_735 158
144 3300048924 Ga0496121_0001011 Ga0496121_0001011_31564_32058 158
145 3300048924 Ga0496121_0567876 Ga0496121_0567876_152_649 158
146 3300048927 Ga0496124_0024169 Ga0496124_0024169_4463_4951 158
147 3300048928 Ga0496125_0058592 Ga0496125_0058592_1864_2352 158
148 3300048929 Ga0496126_0006901 Ga0496126_0006901_4711_5199 158
149 3300048929 Ga0496126_0414550 Ga0496126_0414550_415_903 158
150 3300049671 Ga0501238_002490 Ga0501238_002490_844_1341 158
151 3300050493 nmdc:mga0k408_79911_c1 nmdc:mga0k408_79911_c1_525_1013 158
152 3300050496 nmdc:mga07m45_110765_c1 nmdc:mga07m45_110765_c1_972_1460 158
153 3300050516 nmdc:mga0sz30_7952_c1 nmdc:mga0sz30_7952_c1_826_1314 158
154 3300053083 Ga0495655_0274291 Ga0495655_0274291_17_496 158
155 3300053102 Ga0500554_018147 Ga0500554_018147_925_1422 158
156 3300053104 Ga0500556_0001380 Ga0500556_0001380_9252_9749 158
157 3300053123 Ga0500614_025968 Ga0500614_025968_628_1125 158
158 3300053125 Ga0500618_000189 Ga0500618_000189_18099_18596 158
159 3300053134 Ga0500658_0034183 Ga0500658_0034183_1280_1774 158
160 3300053136 Ga0500559_0007592 Ga0500559_0007592_3420_3917 158
161 3300053142 Ga0500577_0026301 Ga0500577_0026301_498_1007 158
162 3300053158 Ga0500627_0112372 Ga0500627_0112372_130_627 158
163 3300053730 Ga0500645_016287 Ga0500645_016287_262_759 158
164 3300053730 Ga0500645_042933 Ga0500645_042933_659_1153 158
165 3300053731 Ga0500609_004607 Ga0500609_004607_85_582 158
166 iso_pu_bacteria 2643221545 2643748926 158
167 iso_pu_bacteria 2643221598 2643998751 158
168 iso_pu_bacteria 2643221614 2644087292 158
169 iso_pu_bacteria 2643221661 2644344664 158
170 iso_pu_bacteria 2643221666 2644366652 158
171 iso_pu_bacteria 2643221691 2644509315 158
172 3300005327 Ga0070658_10462389 Ga0070658_104623892 159
173 3300005355 Ga0070671_100119378 Ga0070671_1001193782 159
174 3300005456 Ga0070678_100506338 Ga0070678_1005063381 159
175 3300005564 Ga0070664_100200076 Ga0070664_1002000762 159
176 3300005618 Ga0068864_100075655 Ga0068864_1000756553 159
177 3300005841 Ga0068863_100177741 Ga0068863_1001777412 159
178 3300005842 Ga0068858_100678694 Ga0068858_1006786941 159
179 3300005843 Ga0068860_101211825 Ga0068860_1012118251 159
180 3300009177 Ga0105248_10186177 Ga0105248_101861772 159
181 3300013308 Ga0157375_10277651 Ga0157375_102776512 159
182 3300014968 Ga0157379_10678062 Ga0157379_106780621 159
183 3300025931 Ga0207644_10087214 Ga0207644_100872142 159
184 3300025931 Ga0207644_11501646 Ga0207644_115016461 159
185 3300025941 Ga0207711_10353218 Ga0207711_103532182 159
186 3300025945 Ga0207679_10314017 Ga0207679_103140172 159
187 3300025981 Ga0207640_10629312 Ga0207640_106293122 159
188 3300026035 Ga0207703_11174053 Ga0207703_111740531 159
189 3300026095 Ga0207676_10503367 Ga0207676_105033672 159
190 3300026121 Ga0207683_10061054 Ga0207683_100610545 159
191 3300033180 Ga0307510_10017521 Ga0307510_100175214 159
192 3300044684 Ga0466966_0296641 Ga0466966_0296641_473_955 159
193 3300046528 Ga0495642_0002737 Ga0495642_0002737_1938_2423 159
194 3300046616 Ga0495668_0156107 Ga0495668_0156107_458_943 159
195 3300047445 Ga0495677_0107685 Ga0495677_0107685_150_635 159
196 3300047472 Ga0495686_0400882 Ga0495686_0400882_232_723 159
197 3300048905 Ga0496102_0239731 Ga0496102_0239731_579_1064 159
198 3300048906 Ga0496103_0346684 Ga0496103_0346684_433_918 159
199 3300048908 Ga0496105_1096389 Ga0496105_1096389_95_580 159
200 3300048910 Ga0496107_0115720 Ga0496107_0115720_1021_1506 159
201 3300048911 Ga0496108_0227007 Ga0496108_0227007_947_1432 159
202 3300048912 Ga0496109_0143752 Ga0496109_0143752_1461_1946 159
203 3300048913 Ga0496110_1373854 Ga0496110_1373854_30_515 159
204 3300048914 Ga0496111_0200943 Ga0496111_0200943_984_1469 159
205 3300048915 Ga0496112_0236290 Ga0496112_0236290_212_697 159
206 3300048916 Ga0496113_0382773 Ga0496113_0382773_66_551 159
207 3300049582 Ga0501048_0051955 Ga0501048_0051955_1388_1870 159
208 3300046506 Ga0495583_0044584 Ga0495583_0044584_1170_1658 160
209 3300048903 Ga0496100_0762107 Ga0496100_0762107_77_565 160
210 3300048918 Ga0496115_0000398 Ga0496115_0000398_26574_27062 160
211 3300049570 Ga0501033_0577329 Ga0501033_0577329_46_537 160
212 3300049581 Ga0501047_0074385 Ga0501047_0074385_161_643 160
213 3300049581 Ga0501047_0176605 Ga0501047_0176605_1034_1519 160
214 3300049823 Ga0501044_0023385 Ga0501044_0023385_573_1055 160
215 3300049823 Ga0501044_0485937 Ga0501044_0485937_607_1092 160
216 3300053103 Ga0500555_034484 Ga0500555_034484_757_1245 160
217 3300005327 Ga0070658_10205260 Ga0070658_102052602 161
218 3300005336 Ga0070680_100025991 Ga0070680_1000259915 161
219 3300005341 Ga0070691_10016419 Ga0070691_100164196 161
220 3300005344 Ga0070661_100825365 Ga0070661_1008253652 161
221 3300005458 Ga0070681_10061447 Ga0070681_100614472 161
222 3300005530 Ga0070679_100054681 Ga0070679_1000546812 161
223 3300005539 Ga0068853_100024558 Ga0068853_1000245583 161
224 3300005563 Ga0068855_100041023 Ga0068855_1000410236 161
225 3300005563 Ga0068855_100390403 Ga0068855_1003904032 161
226 3300005614 Ga0068856_100741804 Ga0068856_1007418042 161
227 3300006028 Ga0070717_10203489 Ga0070717_102034892 161
228 3300009093 Ga0105240_10003732 Ga0105240_100037329 161
229 3300009093 Ga0105240_10300674 Ga0105240_103006742 161
230 3300009174 Ga0105241_10335502 Ga0105241_103355022 161
231 3300009551 Ga0105238_10023706 Ga0105238_100237064 161
232 3300010375 Ga0105239_11338907 Ga0105239_113389071 161
233 3300013105 Ga0157369_10310106 Ga0157369_103101062 161
234 3300025909 Ga0207705_10285151 Ga0207705_102851512 161
235 3300025911 Ga0207654_10440548 Ga0207654_104405482 161
236 3300025913 Ga0207695_10000837 Ga0207695_1000083732 161
237 3300025913 Ga0207695_10007867 Ga0207695_100078679 161
238 3300025913 Ga0207695_10217797 Ga0207695_102177972 161
239 3300025917 Ga0207660_10248832 Ga0207660_102488322 161
240 3300025920 Ga0207649_10640944 Ga0207649_106409441 161
241 3300025921 Ga0207652_10048861 Ga0207652_100488612 161
242 3300025949 Ga0207667_10034966 Ga0207667_100349666 161
243 3300026078 Ga0207702_10590607 Ga0207702_105906072 161
244 3300037312 Ga0395899_0000052 Ga0395899_0000052_90312_90803 161
245 3300037418 Ga0395900_0000002 Ga0395900_0000002_611664_612155 161
246 3300037466 Ga0395898_0016641 Ga0395898_0016641_567_1058 161
247 3300037471 Ga0395905_0003587 Ga0395905_0003587_6221_6712 161
248 3300038443 Ga0395901_0000013 Ga0395901_0000013_91630_92121 161
249 3300039437 Ga0436365_0656099 Ga0436365_0656099_549_1040 161
250 3300046472 Ga0495580_0481675 Ga0495580_0481675_34_525 161
251 3300046616 Ga0495668_0282844 Ga0495668_0282844_406_894 161
252 3300048918 Ga0496115_0471326 Ga0496115_0471326_65_556 161
253 3300002741 JGI25157J39369_1007310 JGI25157J39369_10073102 162
254 3300003215 JGI25153J46596_10024213 JGI25153J46596_100242132 162
255 3300003791 Ga0055530_10010666 Ga0055530_100106665 162
256 3300003794 Ga0055531_10005057 Ga0055531_100050574 162
257 3300004625 Ga0055543_1016202 Ga0055543_10162022 162
258 3300005262 Ga0065165_1000554 Ga0065165_10005546 162
259 3300005262 Ga0065165_1027189 Ga0065165_10271892 162
260 3300005327 Ga0070658_10018098 Ga0070658_100180983 162
261 3300005327 Ga0070658_10518068 Ga0070658_105180682 162
262 3300005331 Ga0070670_100810201 Ga0070670_1008102012 162
263 3300005336 Ga0070680_100001019 Ga0070680_10000101913 162
264 3300005339 Ga0070660_100005603 Ga0070660_1000056036 162
265 3300005339 Ga0070660_100427251 Ga0070660_1004272512 162
266 3300005344 Ga0070661_101131949 Ga0070661_1011319491 162
267 3300005353 Ga0070669_100569116 Ga0070669_1005691161 162
268 3300005355 Ga0070671_100017977 Ga0070671_1000179776 162
269 3300005355 Ga0070671_100797413 Ga0070671_1007974132 162
270 3300005366 Ga0070659_100000399 Ga0070659_10000039926 162
271 3300005366 Ga0070659_100019649 Ga0070659_1000196496 162
272 3300005367 Ga0070667_100424017 Ga0070667_1004240172 162
273 3300005458 Ga0070681_10030836 Ga0070681_100308366 162
274 3300005530 Ga0070679_100011485 Ga0070679_1000114856 162
275 3300005539 Ga0068853_100021697 Ga0068853_1000216976 162
276 3300005539 Ga0068853_100297473 Ga0068853_1002974732 162
277 3300005539 Ga0068853_100318651 Ga0068853_1003186512 162
278 3300005545 Ga0070695_101118116 Ga0070695_1011181161 162
279 3300005548 Ga0070665_100000418 Ga0070665_10000041846 162
280 3300005548 Ga0070665_100327971 Ga0070665_1003279712 162
281 3300005563 Ga0068855_100151958 Ga0068855_1001519582 162
282 3300005563 Ga0068855_100225932 Ga0068855_1002259322 162
283 3300005577 Ga0068857_100071006 Ga0068857_1000710062 162
284 3300005614 Ga0068856_100180801 Ga0068856_1001808012 162
285 3300005618 Ga0068864_100000993 Ga0068864_1000009935 162
286 3300005618 Ga0068864_100082886 Ga0068864_1000828862 162
287 3300005834 Ga0068851_10215763 Ga0068851_102157632 162
288 3300005841 Ga0068863_100000066 Ga0068863_100000066100 162
289 3300005841 Ga0068863_101836107 Ga0068863_1018361072 162
290 3300005842 Ga0068858_100002124 Ga0068858_10000212417 162
291 3300006042 Ga0075368_10010296 Ga0075368_100102963 162
292 3300006051 Ga0075364_10002819 Ga0075364_100028199 162
293 3300006178 Ga0075367_10012466 Ga0075367_100124663 162
294 3300006186 Ga0075369_10118882 Ga0075369_101188822 162
295 3300006195 Ga0075366_10078928 Ga0075366_100789282 162
296 3300006353 Ga0075370_10101272 Ga0075370_101012721 162
297 3300006353 Ga0075370_10205487 Ga0075370_102054872 162
298 3300006353 Ga0075370_10455920 Ga0075370_104559202 162
299 3300006881 Ga0068865_100003519 Ga0068865_1000035198 162
300 3300006881 Ga0068865_100364571 Ga0068865_1003645712 162
301 3300009011 Ga0105251_10122758 Ga0105251_101227582 162
302 3300009092 Ga0105250_10005952 Ga0105250_100059524 162
303 3300009093 Ga0105240_10246852 Ga0105240_102468523 162
304 3300009093 Ga0105240_10296749 Ga0105240_102967492 162
305 3300009093 Ga0105240_10916603 Ga0105240_109166031 162
306 3300009093 Ga0105240_11244343 Ga0105240_112443431 162
307 3300009101 Ga0105247_10453757 Ga0105247_104537572 162
308 3300009177 Ga0105248_10003646 Ga0105248_100036468 162
309 3300009177 Ga0105248_10017964 Ga0105248_100179645 162
310 3300009177 Ga0105248_10077036 Ga0105248_100770365 162
311 3300009545 Ga0105237_11320464 Ga0105237_113204642 162
312 3300009551 Ga0105238_10026036 Ga0105238_100260366 162
313 3300009551 Ga0105238_10177985 Ga0105238_101779853 162
314 3300010375 Ga0105239_10036093 Ga0105239_100360933 162
315 3300010375 Ga0105239_10304635 Ga0105239_103046352 162
316 3300010375 Ga0105239_10312298 Ga0105239_103122982 162
317 3300010375 Ga0105239_10757150 Ga0105239_107571501 162
318 3300010375 Ga0105239_11703361 Ga0105239_117033612 162
319 3300013306 Ga0163162_10479558 Ga0163162_104795582 162
320 3300014325 Ga0163163_10403688 Ga0163163_104036881 162
321 3300014325 Ga0163163_10552153 Ga0163163_105521532 162
322 3300014968 Ga0157379_10037451 Ga0157379_100374514 162
323 3300015262 Ga0182007_10030889 Ga0182007_100308892 162
324 3300025250 Ga0209026_1001029 Ga0209026_100102911 162
325 3300025297 Ga0209758_1000936 Ga0209758_100093627 162
326 3300025298 Ga0209050_1000245 Ga0209050_100024577 162
327 3300025304 Ga0209257_1001133 Ga0209257_100113322 162
328 3300025304 Ga0209257_1002271 Ga0209257_100227115 162
329 3300025900 Ga0207710_10200566 Ga0207710_102005662 162
330 3300025909 Ga0207705_10002027 Ga0207705_1000202712 162
331 3300025909 Ga0207705_10218341 Ga0207705_102183412 162
332 3300025912 Ga0207707_10124352 Ga0207707_101243524 162
333 3300025913 Ga0207695_10070511 Ga0207695_100705112 162
334 3300025913 Ga0207695_10339878 Ga0207695_103398782 162
335 3300025913 Ga0207695_10406722 Ga0207695_104067222 162
336 3300025914 Ga0207671_10418603 Ga0207671_104186032 162
337 3300025917 Ga0207660_10007742 Ga0207660_100077427 162
338 3300025919 Ga0207657_10017426 Ga0207657_100174263 162
339 3300025919 Ga0207657_10031047 Ga0207657_100310474 162
340 3300025919 Ga0207657_10031417 Ga0207657_100314177 162
341 3300025920 Ga0207649_10424762 Ga0207649_104247622 162
342 3300025921 Ga0207652_10001554 Ga0207652_1000155416 162
343 3300025923 Ga0207681_10531224 Ga0207681_105312242 162
344 3300025924 Ga0207694_10155813 Ga0207694_101558132 162
345 3300025924 Ga0207694_10547185 Ga0207694_105471852 162
346 3300025931 Ga0207644_10053491 Ga0207644_100534912 162
347 3300025931 Ga0207644_10498551 Ga0207644_104985512 162
348 3300025931 Ga0207644_10714303 Ga0207644_107143032 162
349 3300025932 Ga0207690_10000898 Ga0207690_1000089822 162
350 3300025932 Ga0207690_10424663 Ga0207690_104246632 162
351 3300025933 Ga0207706_10727610 Ga0207706_107276102 162
352 3300025938 Ga0207704_10002243 Ga0207704_100022439 162
353 3300025941 Ga0207711_10001468 Ga0207711_1000146819 162
354 3300025941 Ga0207711_10031054 Ga0207711_100310542 162
355 3300025941 Ga0207711_10072257 Ga0207711_100722575 162
356 3300025941 Ga0207711_10454912 Ga0207711_104549122 162
357 3300025949 Ga0207667_10004404 Ga0207667_100044048 162
358 3300025949 Ga0207667_10248508 Ga0207667_102485082 162
359 3300025986 Ga0207658_10394516 Ga0207658_103945162 162
360 3300026023 Ga0207677_11609049 Ga0207677_116090491 162
361 3300026035 Ga0207703_10000065 Ga0207703_100000652 162
362 3300026041 Ga0207639_10027411 Ga0207639_100274114 162
363 3300026041 Ga0207639_10256352 Ga0207639_102563521 162
364 3300026041 Ga0207639_10930017 Ga0207639_109300171 162
365 3300026067 Ga0207678_10200869 Ga0207678_102008692 162
366 3300026078 Ga0207702_10603078 Ga0207702_106030781 162
367 3300026088 Ga0207641_10000011 Ga0207641_10000011289 162
368 3300026088 Ga0207641_10148183 Ga0207641_101481833 162
369 3300026095 Ga0207676_10007791 Ga0207676_100077917 162
370 3300026095 Ga0207676_10072958 Ga0207676_100729585 162
371 3300026095 Ga0207676_11400195 Ga0207676_114001951 162
372 3300027866 Ga0209813_10111574 Ga0209813_101115742 162
373 3300028379 Ga0268266_10000003 Ga0268266_100000031139 162
374 3300028379 Ga0268266_10135188 Ga0268266_101351882 162
375 3300028379 Ga0268266_10310568 Ga0268266_103105682 162
376 3300028786 Ga0307517_10051053 Ga0307517_100510536 162
377 3300031251 Ga0265327_10191839 Ga0265327_101918392 162
378 3300031456 Ga0307513_10007022 Ga0307513_1000702215 162
379 3300031456 Ga0307513_10010412 Ga0307513_100104124 162
380 3300031548 Ga0307408_101508285 Ga0307408_1015082851 162
381 3300031616 Ga0307508_10246600 Ga0307508_102466001 162
382 3300031824 Ga0307413_11411633 Ga0307413_114116331 162
383 3300032004 Ga0307414_10314628 Ga0307414_103146282 162
384 3300032004 Ga0307414_10347727 Ga0307414_103477272 162
385 3300033180 Ga0307510_10133511 Ga0307510_101335114 162
386 3300035115 Ga0373941_0171434 Ga0373941_0171434_68_568 162
387 3300037312 Ga0395899_0299904 Ga0395899_0299904_550_1053 162
388 3300037471 Ga0395905_0290654 Ga0395905_0290654_253_744 162
389 3300037471 Ga0395905_0932298 Ga0395905_0932298_176_664 162
390 3300041512 Ga0451853_0522904 Ga0451853_0522904_94_585 162
391 3300044712 Ga0453684_0371582 Ga0453684_0371582_331_819 162
392 3300046459 Ga0495629_0025481 Ga0495629_0025481_3108_3608 162
393 3300046492 Ga0495585_0253622 Ga0495585_0253622_285_785 162
394 3300046506 Ga0495583_0140861 Ga0495583_0140861_321_821 162
395 3300046515 Ga0495620_0031642 Ga0495620_0031642_51_551 162
396 3300046516 Ga0495628_0305569 Ga0495628_0305569_339_839 162
397 3300046516 Ga0495628_0675873 Ga0495628_0675873_60_554 162
398 3300046522 Ga0495643_0022556 Ga0495643_0022556_1588_2088 162
399 3300046525 Ga0495663_0159255 Ga0495663_0159255_150_644 162
400 3300046530 Ga0495654_0051498 Ga0495654_0051498_904_1404 162
401 3300046538 Ga0495609_0007443 Ga0495609_0007443_1481_1981 162
402 3300046539 Ga0495621_0224647 Ga0495621_0224647_195_686 162
403 3300046542 Ga0495597_0025085 Ga0495597_0025085_2137_2637 162
404 3300046557 Ga0495622_0014157 Ga0495622_0014157_2668_3168 162
405 3300046616 Ga0495668_0074551 Ga0495668_0074551_16_516 162
406 3300046616 Ga0495668_0078391 Ga0495668_0078391_673_1167 162
407 3300046616 Ga0495668_0080193 Ga0495668_0080193_573_1067 162
408 3300046616 Ga0495668_0179458 Ga0495668_0179458_38_526 162
409 3300046616 Ga0495668_0312689 Ga0495668_0312689_265_753 162
410 3300046616 Ga0495668_0669645 Ga0495668_0669645_14_508 162
411 3300046648 Ga0495611_0031395 Ga0495611_0031395_929_1423 162
412 3300046664 Ga0495659_0152166 Ga0495659_0152166_419_919 162
413 3300046674 Ga0495588_0029606 Ga0495588_0029606_728_1228 162
414 3300046684 Ga0495669_0000014 Ga0495669_0000014_38031_38531 162
415 3300046684 Ga0495669_0000081 Ga0495669_0000081_60919_61419 162
416 3300046684 Ga0495669_0013682 Ga0495669_0013682_2753_3253 162
417 3300046684 Ga0495669_0029160 Ga0495669_0029160_388_882 162
418 3300047318 Ga0495636_0058432 Ga0495636_0058432_604_1098 162
419 3300047320 Ga0495672_0282875 Ga0495672_0282875_28_522 162
420 3300047443 Ga0495687_038352 Ga0495687_038352_838_1338 162
421 3300047445 Ga0495677_0030910 Ga0495677_0030910_1357_1857 162
422 3300047445 Ga0495677_0062756 Ga0495677_0062756_382_882 162
423 3300047447 Ga0495685_118899 Ga0495685_118899_188_682 162
424 3300047470 Ga0495681_0243884 Ga0495681_0243884_102_596 162
425 3300047472 Ga0495686_0018149 Ga0495686_0018149_3277_3771 162
426 3300048088 Ga0495602_0607602 Ga0495602_0607602_213_713 162
427 3300048905 Ga0496102_0331500 Ga0496102_0331500_675_1175 162
428 3300048906 Ga0496103_0226534 Ga0496103_0226534_623_1123 162
429 3300048915 Ga0496112_0017526 Ga0496112_0017526_1142_1645 162
430 3300048918 Ga0496115_0016458 Ga0496115_0016458_2631_3137 162
431 3300048920 Ga0496117_0023814 Ga0496117_0023814_1451_1951 162
432 3300048921 Ga0496118_0064356 Ga0496118_0064356_251_751 162
433 3300048922 Ga0496119_0022659 Ga0496119_0022659_848_1348 162
434 3300048923 Ga0496120_0121346 Ga0496120_0121346_435_935 162
435 3300048924 Ga0496121_0000035 Ga0496121_0000035_255422_255922 162
436 3300048928 Ga0496125_0324733 Ga0496125_0324733_221_712 162
437 3300050489 nmdc:mga03683_210511_c1 nmdc:mga03683_210511_c1_11_499 162
438 3300050491 nmdc:mga00v17_725_c1 nmdc:mga00v17_725_c1_1424_1924 162
439 3300050493 nmdc:mga0k408_442091_c1 nmdc:mga0k408_442091_c1_182_670 162
440 3300050493 nmdc:mga0k408_86891_c1 nmdc:mga0k408_86891_c1_385_885 162
441 3300050496 nmdc:mga07m45_24930_c1 nmdc:mga07m45_24930_c1_1383_1883 162
442 3300050496 nmdc:mga07m45_73793_c1 nmdc:mga07m45_73793_c1_1366_1866 162
443 3300053080 Ga0500635_0002320 Ga0500635_0002320_1394_1894 162
444 3300053091 Ga0500647_0048756 Ga0500647_0048756_1048_1548 162
445 3300053093 Ga0500651_0092001 Ga0500651_0092001_593_1093 162
446 3300053109 Ga0500569_011330 Ga0500569_011330_698_1198 162
447 3300053119 Ga0500595_009155 Ga0500595_009155_2692_3192 162
448 3300053119 Ga0500595_011477 Ga0500595_011477_1339_1827 162
449 3300053119 Ga0500595_076701 Ga0500595_076701_411_905 162
450 3300053121 Ga0500607_021263 Ga0500607_021263_1828_2328 162
451 3300053121 Ga0500607_051845 Ga0500607_051845_468_968 162
452 3300053122 Ga0500608_034867 Ga0500608_034867_769_1269 162
453 3300053130 Ga0500642_0186204 Ga0500642_0186204_279_779 162
454 3300053133 Ga0500655_037586 Ga0500655_037586_252_752 162
455 3300053134 Ga0500658_0175160 Ga0500658_0175160_39_539 162
456 3300053136 Ga0500559_0029052 Ga0500559_0029052_571_1071 162
457 3300053148 Ga0500590_025425 Ga0500590_025425_1873_2373 162
458 3300053150 Ga0500603_010535 Ga0500603_010535_519_1019 162
459 3300053154 Ga0500619_037981 Ga0500619_037981_740_1240 162
460 3300053157 Ga0500624_004418 Ga0500624_004418_1327_1827 162
461 3300053162 Ga0500638_101236 Ga0500638_101236_734_1234 162
462 3300053177 Ga0500636_0016186 Ga0500636_0016186_2556_3056 162
463 3300053178 Ga0500637_0019922 Ga0500637_0019922_851_1351 162
464 3300053178 Ga0500637_0054248 Ga0500637_0054248_439_939 162
465 3300053725 Ga0500576_222010 Ga0500576_222010_50_550 162
466 3300053729 Ga0500625_049621 Ga0500625_049621_857_1357 162
467 3300053730 Ga0500645_015649 Ga0500645_015649_1376_1867 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

7

149

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9262 1 153
6vcn-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpg 0.9198 6 153
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9185 1 153
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9173 1 153
6vco-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpa 0.907 1 153
ID Description Score Start End Superfamily
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9251 1 154 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9185 1 153 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9122 21 154 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8915 1 154 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.873 1 153 3.90.79.10
ID Description Score Start End GO Terms
AF-B4RD52-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9852 1 158 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A258FPN9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9813 7 156 GO:0005975
GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A539D0F2-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.975 2 156 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-V4P1R3-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9704 1 153 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A3D5ZYZ9-F1-model_v4 deleted 0.9692 4 156

Feature Viewer

pLDDT pTM Quality
91.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map