F449789

General Info

Members Datasets Scaffolds Average Seq Length
467 237 934 164

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10783541|Ga0070676_107835412
Length 174
Sequence MRIAGREGMTTPVSYATAVVKHPRIEGVKTKPLRLIPDERGWLMEILRADESELFTKFGQVYVSATYPGVVKAWHYHKVQVDNFACIAGMVKLVLVDTRDGSPTKGAINEFFLGTQNLTLVQVPNLVYHGWKCISTDVSLVINVPTEPYAYAQPDEYRLDPHDTLPYDWARKDG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 0.86
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10783541 3300005328 Bacteria 702
2 JGI24746J21847_1005512 3300001977 Bacteria 1973
3 JGI24033J26618_1008443 3300002155 Bacteria 1186
4 JGI24742J22300_10049492 3300002244 Unclassified 759
5 JGI24751J29686_10059579 3300002459 Bacteria 787
6 Ga0065714_10084915 3300005288 Bacteria 2173
7 Ga0065704_10018182 3300005289 Bacteria 1344
8 Ga0065704_10107652 3300005289 Unclassified 2050
9 Ga0065712_10009885 3300005290 Bacteria 3323
10 Ga0065712_10076461 3300005290 Bacteria 3642
11 Ga0065715_10001518 3300005293 Bacteria 7183
12 Ga0065715_10002245 3300005293 Bacteria 5682
13 Ga0065715_10033845 3300005293 Bacteria 1764
14 Ga0065715_10661170 3300005293 Bacteria 673
15 Ga0065715_10680780 3300005293 Bacteria 663
16 Ga0065707_10089688 3300005295 Bacteria 4303
17 Ga0065707_10096442 3300005295 Bacteria 3268
18 Ga0070676_10024203 3300005328 Bacteria 3418
19 Ga0070676_10136156 3300005328 Bacteria 1558
20 Ga0070690_100019969 3300005330 Bacteria 4077
21 Ga0070670_100002473 3300005331 Bacteria 15248
22 Ga0070670_100042695 3300005331 Bacteria 3899
23 Ga0070677_10001316 3300005333 Bacteria 7940
24 Ga0070677_10007665 3300005333 Bacteria 3612
25 Ga0068869_100026811 3300005334 Bacteria 4013
26 Ga0068869_100075185 3300005334 Bacteria 2509
27 Ga0070666_10007348 3300005335 Bacteria 6788
28 Ga0070666_10261984 3300005335 Bacteria 1226
29 Ga0070666_10548769 3300005335 Bacteria 840
30 Ga0070660_100691240 3300005339 Bacteria 855
31 Ga0070689_100003446 3300005340 Bacteria 10519
32 Ga0070689_100067082 3300005340 Bacteria 2796
33 Ga0070689_100343855 3300005340 Bacteria 1250
34 Ga0070691_10026552 3300005341 Bacteria 2700
35 Ga0070687_100001494 3300005343 Bacteria 8254
36 Ga0070687_100044162 3300005343 Bacteria 2269
37 Ga0070661_100016165 3300005344 Bacteria 5269
38 Ga0070661_100535697 3300005344 Bacteria 941
39 Ga0070668_100074963 3300005347 Bacteria 2640
40 Ga0070668_100569782 3300005347 Bacteria 987
41 Ga0070669_100021505 3300005353 Bacteria 4610
42 Ga0070669_100029064 3300005353 Bacteria 3983
43 Ga0070675_100156260 3300005354 Bacteria 1958
44 Ga0070671_100078871 3300005355 Bacteria 2752
45 Ga0070671_100182235 3300005355 Bacteria 1778
46 Ga0070674_100097669 3300005356 Bacteria 2133
47 Ga0070674_100150756 3300005356 Bacteria 1754
48 Ga0070674_100245648 3300005356 Bacteria 1403
49 Ga0070673_100004339 3300005364 Bacteria 8957
50 Ga0070673_100222733 3300005364 Bacteria 1633
51 Ga0070688_100001161 3300005365 Bacteria 13117
52 Ga0070688_100027374 3300005365 Bacteria 3396
53 Ga0070688_100751714 3300005365 Bacteria 759
54 Ga0070659_100609035 3300005366 Bacteria 939
55 Ga0070667_100029244 3300005367 Bacteria 4590
56 Ga0070667_100134676 3300005367 Bacteria 2160
57 Ga0070667_100740453 3300005367 Bacteria 911
58 Ga0070709_10165764 3300005434 Bacteria 1540
59 Ga0070713_100181641 3300005436 Bacteria 1891
60 Ga0070701_10450817 3300005438 Bacteria 826
61 Ga0070705_100055561 3300005440 Bacteria 2328
62 Ga0070700_100031677 3300005441 Bacteria 3171
63 Ga0070700_100068468 3300005441 Bacteria 2257
64 Ga0070700_100079801 3300005441 Bacteria 2110
65 Ga0070694_100066976 3300005444 Bacteria 2464
66 Ga0070694_100827613 3300005444 Bacteria 761
67 Ga0070708_100857978 3300005445 Unclassified 853
68 Ga0070663_100607517 3300005455 Bacteria 920
69 Ga0070678_100007102 3300005456 Bacteria 6623
70 Ga0070678_100113231 3300005456 Bacteria 2126
71 Ga0070678_100427962 3300005456 Bacteria 1155
72 Ga0070662_100006996 3300005457 Bacteria 7298
73 Ga0070662_100121742 3300005457 Bacteria 2001
74 Ga0070662_100379590 3300005457 Bacteria 1163
75 Ga0068867_100033776 3300005459 Bacteria 3706
76 Ga0068867_100115294 3300005459 Bacteria 2069
77 Ga0068867_100539945 3300005459 Unclassified 1008
78 Ga0070685_10003112 3300005466 Bacteria 8432
79 Ga0070706_100002440 3300005467 Bacteria 18742
80 Ga0070707_100078227 3300005468 Bacteria 3191
81 Ga0070707_101808874 3300005468 Unclassified 578
82 Ga0070699_100274000 3300005518 Bacteria 1511
83 Ga0070679_101474525 3300005530 Bacteria 627
84 Ga0070679_101518529 3300005530 Unclassified 617
85 Ga0070684_100040008 3300005535 Bacteria 4034
86 Ga0070697_100273334 3300005536 Bacteria 1449
87 Ga0070672_100008325 3300005543 Bacteria 7086
88 Ga0070672_100033973 3300005543 Bacteria 3866
89 Ga0070672_100096786 3300005543 Bacteria 2388
90 Ga0070686_100059006 3300005544 Bacteria 2471
91 Ga0070686_100059519 3300005544 Bacteria 2461
92 Ga0070695_100183869 3300005545 Bacteria 1483
93 Ga0070665_100065820 3300005548 Bacteria 3635
94 Ga0070665_100143425 3300005548 Bacteria 2391
95 Ga0070704_100058318 3300005549 Bacteria 2750
96 Ga0070704_101406017 3300005549 Bacteria 640
97 Ga0068855_100335740 3300005563 Bacteria 1667
98 Ga0070664_100000586 3300005564 Bacteria 27743
99 Ga0068857_100027261 3300005577 Bacteria 5038
100 Ga0068857_100043052 3300005577 Bacteria 4006
101 Ga0068857_100550564 3300005577 Bacteria 1087
102 Ga0068854_100162787 3300005578 Bacteria 1729
103 Ga0070702_100076228 3300005615 Bacteria 1995
104 Ga0070702_100131174 3300005615 Bacteria 1583
105 Ga0070702_100589745 3300005615 Bacteria 831
106 Ga0070702_100614152 3300005615 Bacteria 817
107 Ga0068852_100212342 3300005616 Bacteria 1836
108 Ga0068859_100021961 3300005617 Bacteria 6400
109 Ga0068859_100091490 3300005617 Bacteria 3093
110 Ga0068859_101471204 3300005617 Bacteria 752
111 Ga0068864_100044032 3300005618 Bacteria 3824
112 Ga0068864_100051361 3300005618 Bacteria 3552
113 Ga0068864_101673246 3300005618 Bacteria 641
114 Ga0068866_10150584 3300005718 Bacteria 1347
115 Ga0068866_10694693 3300005718 Bacteria 697
116 Ga0068861_100013019 3300005719 Bacteria 5814
117 Ga0068861_102002590 3300005719 Bacteria 578
118 Ga0068870_10001283 3300005840 Bacteria 10103
119 Ga0068870_10046734 3300005840 Bacteria 2272
120 Ga0068863_100140523 3300005841 Bacteria 2308
121 Ga0068858_100006876 3300005842 Bacteria 11055
122 Ga0068860_100094509 3300005843 Bacteria 2849
123 Ga0068860_100208867 3300005843 Bacteria 1893
124 Ga0068860_100555991 3300005843 Bacteria 1150
125 Ga0068860_101721601 3300005843 Unclassified 649
126 Ga0068862_100017554 3300005844 Bacteria 5960
127 Ga0068862_100176215 3300005844 Bacteria 1917
128 Ga0068862_100525356 3300005844 Bacteria 1127
129 Ga0081539_10005674 3300005985 Bacteria 12526
130 Ga0075363_100516876 3300006048 Bacteria 710
131 Ga0075364_10009031 3300006051 Bacteria 5971
132 Ga0075364_10068202 3300006051 Bacteria 2339
133 Ga0075367_10100863 3300006178 Bacteria 1765
134 Ga0075366_10011600 3300006195 Bacteria 4979
135 Ga0075366_10136039 3300006195 Bacteria 1484
136 Ga0097621_100214899 3300006237 Bacteria 1674
137 Ga0097621_100615707 3300006237 Bacteria 994
138 Ga0075370_10079507 3300006353 Bacteria 1883
139 Ga0068871_100048011 3300006358 Bacteria 3444
140 Ga0068871_100642569 3300006358 Bacteria 968
141 Ga0068871_100723431 3300006358 Unclassified 913
142 Ga0068871_101271186 3300006358 Unclassified 692
143 Ga0075428_100000284 3300006844 Bacteria 49693
144 Ga0075428_100001176 3300006844 Bacteria 28020
145 Ga0075428_100004676 3300006844 Bacteria 15157
146 Ga0075428_100462889 3300006844 Bacteria 1358
147 Ga0075428_101232143 3300006844 Unclassified 788
148 Ga0075430_100001139 3300006846 Bacteria 21210
149 Ga0075430_100006287 3300006846 Bacteria 10018
150 Ga0075431_100003423 3300006847 Bacteria 15391
151 Ga0075431_100005937 3300006847 Bacteria 12084
152 Ga0075431_100212836 3300006847 Bacteria 1974
153 Ga0075431_100629280 3300006847 Bacteria 1055
154 Ga0075433_10002236 3300006852 Bacteria 14692
155 Ga0075433_10002249 3300006852 Bacteria 14655
156 Ga0075433_10012091 3300006852 Bacteria 6963
157 Ga0075433_10373617 3300006852 Bacteria 1259
158 Ga0075433_11040660 3300006852 Bacteria 713
159 Ga0075434_100000728 3300006871 Bacteria 25807
160 Ga0075434_100008478 3300006871 Bacteria 9563
161 Ga0075434_100024144 3300006871 Bacteria 5941
162 Ga0075434_100684903 3300006871 Unclassified 1043
163 Ga0075429_100001309 3300006880 Bacteria 20298
164 Ga0075429_100004341 3300006880 Bacteria 12181
165 Ga0075429_100010172 3300006880 Bacteria 8143
166 Ga0075429_100032654 3300006880 Bacteria 4524
167 Ga0075429_100081400 3300006880 Bacteria 2823
168 Ga0097620_100021961 3300006931 Bacteria 6400
169 Ga0097620_100091486 3300006931 Bacteria 3093
170 Ga0097620_101471406 3300006931 Bacteria 752
171 Ga0075435_100013098 3300007076 Bacteria 6160
172 Ga0111539_10001803 3300009094 Bacteria 28500
173 Ga0111539_10022324 3300009094 Bacteria 7778
174 Ga0105245_10259769 3300009098 Bacteria 1690
175 Ga0105245_12114864 3300009098 Unclassified 617
176 Ga0105247_10029075 3300009101 Bacteria 3347
177 Ga0105247_10256541 3300009101 Bacteria 1197
178 Ga0114129_10002395 3300009147 Bacteria 26063
179 Ga0114129_10013641 3300009147 Bacteria 11577
180 Ga0114129_10044626 3300009147 Bacteria 6235
181 Ga0114129_10115665 3300009147 Bacteria 3697
182 Ga0114129_10135940 3300009147 Bacteria 3373
183 Ga0114129_10577158 3300009147 Bacteria 1460
184 Ga0114129_10693404 3300009147 Unclassified 1310
185 Ga0114129_11060716 3300009147 Unclassified 1017
186 Ga0114129_11535881 3300009147 Bacteria 817
187 Ga0105241_10036278 3300009174 Bacteria 3709
188 Ga0105242_10015762 3300009176 Bacteria 5871
189 Ga0105248_10030845 3300009177 Bacteria 5989
190 Ga0105248_10141649 3300009177 Bacteria 2713
191 Ga0105248_10631553 3300009177 Archaea 1208
192 Ga0105237_10292438 3300009545 Bacteria 1632
193 Ga0105249_10007475 3300009553 Bacteria 9533
194 Ga0105249_10448365 3300009553 Bacteria 1329
195 Ga0105249_11712117 3300009553 Bacteria 701
196 Ga0105239_10256517 3300010375 Bacteria 1965
197 Ga0105246_10008089 3300011119 Bacteria 6453
198 Ga0157371_10166734 3300013102 Unclassified 1573
199 Ga0157369_10072162 3300013105 Bacteria 3705
200 Ga0157369_10469273 3300013105 Unclassified 1303
201 Ga0157374_10187314 3300013296 Bacteria 2023
202 Ga0157374_10955962 3300013296 Bacteria 875
203 Ga0157374_11273593 3300013296 Unclassified 757
204 Ga0157378_11013497 3300013297 Bacteria 865
205 Ga0163162_10018689 3300013306 Bacteria 6790
206 Ga0163162_10079086 3300013306 Bacteria 3354
207 Ga0163162_10580683 3300013306 Bacteria 1248
208 Ga0163162_11930370 3300013306 Unclassified 676
209 Ga0157372_10579920 3300013307 Bacteria 1307
210 Ga0157375_10015819 3300013308 Bacteria 6761
211 Ga0157375_10065731 3300013308 Bacteria 3617
212 Ga0157375_10627058 3300013308 Bacteria 1233
213 Ga0163163_10075726 3300014325 Bacteria 3359
214 Ga0163163_10383518 3300014325 Bacteria 1463
215 Ga0163163_12273320 3300014325 Bacteria 601
216 Ga0157380_10037670 3300014326 Bacteria 3748
217 Ga0157380_10270024 3300014326 Bacteria 1550
218 Ga0157380_10453936 3300014326 Bacteria 1232
219 Ga0157377_10042154 3300014745 Bacteria 2534
220 Ga0157377_10253689 3300014745 Bacteria 1141
221 Ga0157379_10006450 3300014968 Bacteria 10112
222 Ga0157376_10037652 3300014969 Bacteria 3930
223 Ga0163161_10019875 3300017792 Bacteria 4710
224 Ga0207697_10018514 3300025315 Bacteria 2856
225 Ga0207653_10102803 3300025885 Unclassified 1012
226 Ga0207682_10005821 3300025893 Bacteria 4997
227 Ga0207682_10008287 3300025893 Bacteria 4116
228 Ga0207642_10165171 3300025899 Bacteria 1192
229 Ga0207710_10274807 3300025900 Unclassified 847
230 Ga0207688_10009700 3300025901 Bacteria 5239
231 Ga0207688_10013100 3300025901 Bacteria 4507
232 Ga0207688_10624111 3300025901 Bacteria 680
233 Ga0207680_10716452 3300025903 Bacteria 717
234 Ga0207699_10164950 3300025906 Bacteria 1478
235 Ga0207645_10004483 3300025907 Bacteria 10332
236 Ga0207645_10011778 3300025907 Bacteria 5956
237 Ga0207645_10023219 3300025907 Bacteria 4031
238 Ga0207643_10002443 3300025908 Bacteria 10040
239 Ga0207643_10135755 3300025908 Bacteria 1466
240 Ga0207705_11028766 3300025909 Bacteria 636
241 Ga0207684_10203574 3300025910 Bacteria 1707
242 Ga0207684_10295306 3300025910 Unclassified 1397
243 Ga0207654_10128155 3300025911 Bacteria 1603
244 Ga0207662_10002100 3300025918 Bacteria 9899
245 Ga0207662_10018752 3300025918 Bacteria 3930
246 Ga0207657_10254212 3300025919 Bacteria 1400
247 Ga0207657_10519296 3300025919 Bacteria 932
248 Ga0207649_10026865 3300025920 Bacteria 3371
249 Ga0207646_10035265 3300025922 Bacteria 4519
250 Ga0207681_10013756 3300025923 Bacteria 5011
251 Ga0207694_11124337 3300025924 Bacteria 665
252 Ga0207650_10025389 3300025925 Bacteria 4220
253 Ga0207650_10874792 3300025925 Unclassified 763
254 Ga0207659_10021607 3300025926 Bacteria 4275
255 Ga0207659_10023947 3300025926 Bacteria 4084
256 Ga0207659_11507087 3300025926 Unclassified 575
257 Ga0207687_11045640 3300025927 Bacteria 701
258 Ga0207700_10064869 3300025928 Bacteria 2784
259 Ga0207644_10147931 3300025931 Bacteria 1815
260 Ga0207690_10129751 3300025932 Bacteria 1843
261 Ga0207706_10003603 3300025933 Bacteria 14786
262 Ga0207706_10011411 3300025933 Bacteria 8094
263 Ga0207706_10381083 3300025933 Bacteria 1224
264 Ga0207670_10003021 3300025936 Bacteria 8882
265 Ga0207670_10115722 3300025936 Bacteria 1940
266 Ga0207669_10014909 3300025937 Bacteria 3908
267 Ga0207669_10187884 3300025937 Bacteria 1487
268 Ga0207669_10351144 3300025937 Bacteria 1139
269 Ga0207669_10365996 3300025937 Bacteria 1119
270 Ga0207691_10006028 3300025940 Bacteria 11700
271 Ga0207691_10016361 3300025940 Bacteria 7041
272 Ga0207691_10027666 3300025940 Bacteria 5315
273 Ga0207711_10021537 3300025941 Bacteria 5385
274 Ga0207689_10004753 3300025942 Bacteria 12249
275 Ga0207661_10167129 3300025944 Bacteria 1912
276 Ga0207679_10013411 3300025945 Bacteria 5373
277 Ga0207679_10393486 3300025945 Bacteria 1218
278 Ga0207667_10213801 3300025949 Bacteria 1976
279 Ga0207651_10001688 3300025960 Bacteria 10167
280 Ga0207651_10033104 3300025960 Bacteria 3329
281 Ga0207651_10205856 3300025960 Bacteria 1580
282 Ga0207712_10054753 3300025961 Bacteria 2803
283 Ga0207712_10723892 3300025961 Bacteria 870
284 Ga0207668_10021951 3300025972 Bacteria 4078
285 Ga0207668_10248274 3300025972 Bacteria 1444
286 Ga0207668_11133999 3300025972 Bacteria 702
287 Ga0207640_10267587 3300025981 Bacteria 1335
288 Ga0207658_10051857 3300025986 Bacteria 3025
289 Ga0207658_10202249 3300025986 Bacteria 1659
290 Ga0207677_10179384 3300026023 Bacteria 1664
291 Ga0207677_11583349 3300026023 Bacteria 606
292 Ga0207703_10105588 3300026035 Bacteria 2394
293 Ga0207708_10025631 3300026075 Bacteria 4462
294 Ga0207708_10168234 3300026075 Bacteria 1734
295 Ga0207641_10053186 3300026088 Bacteria 3431
296 Ga0207641_10064498 3300026088 Bacteria 3131
297 Ga0207641_10748543 3300026088 Bacteria 965
298 Ga0207648_10000959 3300026089 Bacteria 32621
299 Ga0207648_10033883 3300026089 Bacteria 4503
300 Ga0207648_10060982 3300026089 Bacteria 3289
301 Ga0207676_10428938 3300026095 Unclassified 1242
302 Ga0207676_10618949 3300026095 Bacteria 1042
303 Ga0207676_10707918 3300026095 Bacteria 976
304 Ga0207674_10014675 3300026116 Bacteria 8638
305 Ga0207674_10048327 3300026116 Bacteria 4355
306 Ga0207674_10342506 3300026116 Bacteria 1445
307 Ga0207675_100009826 3300026118 Bacteria 8956
308 Ga0207675_100062540 3300026118 Bacteria 3476
309 Ga0207675_100454278 3300026118 Bacteria 1270
310 Ga0207683_10013604 3300026121 Bacteria 6941
311 Ga0207683_10146113 3300026121 Bacteria 2132
312 Ga0207683_10345883 3300026121 Bacteria 1364
313 Ga0207698_10577761 3300026142 Bacteria 1105
314 Ga0209971_1065962 3300027682 Bacteria 877
315 Ga0209998_10037880 3300027717 Bacteria 1087
316 Ga0209974_10120254 3300027876 Bacteria 930
317 Ga0207428_10000690 3300027907 Bacteria 39183
318 Ga0207428_10007388 3300027907 Bacteria 10019
319 Ga0207428_10017650 3300027907 Bacteria 6119
320 Ga0268265_10109732 3300028380 Bacteria 2250
321 Ga0268265_10154416 3300028380 Bacteria 1940
322 Ga0268265_10244101 3300028380 Bacteria 1587
323 Ga0268265_10300992 3300028380 Bacteria 1444
324 Ga0268264_11570080 3300028381 Archaea 669
325 Ga0265327_10206715 3300031251 Unclassified 887
326 Ga0307408_100007765 3300031548 Bacteria 7090
327 Ga0307408_100089142 3300031548 Bacteria 2325
328 Ga0307408_100237311 3300031548 Bacteria 1497
329 Ga0307408_101080860 3300031548 Bacteria 743
330 Ga0316576_10652469 3300031727 Unclassified 765
331 Ga0307405_10047991 3300031731 Bacteria 2631
332 Ga0307413_10074962 3300031824 Bacteria 2145
333 Ga0307413_10528710 3300031824 Bacteria 952
334 Ga0307413_10803074 3300031824 Bacteria 791
335 Ga0307410_10008353 3300031852 Bacteria 5737
336 Ga0307410_10027641 3300031852 Bacteria 3587
337 Ga0307410_10060011 3300031852 Bacteria 2598
338 Ga0307410_10771984 3300031852 Bacteria 815
339 Ga0307406_10068548 3300031901 Bacteria 2316
340 Ga0307406_11265283 3300031901 Bacteria 643
341 Ga0307407_10021181 3300031903 Bacteria 3347
342 Ga0307407_10031106 3300031903 Bacteria 2887
343 Ga0307407_10383825 3300031903 Bacteria 1004
344 Ga0307407_10463819 3300031903 Archaea 922
345 Ga0307412_10007700 3300031911 Bacteria 6121
346 Ga0307409_100003418 3300031995 Bacteria 8626
347 Ga0307409_100310463 3300031995 Bacteria 1471
348 Ga0307416_100026250 3300032002 Bacteria 4288
349 Ga0307416_100400546 3300032002 Bacteria 1410
350 Ga0307416_101021379 3300032002 Bacteria 930
351 Ga0307416_101304892 3300032002 Bacteria 832
352 Ga0307414_10058871 3300032004 Bacteria 2709
353 Ga0307411_10060818 3300032005 Bacteria 2511
354 Ga0307411_10129884 3300032005 Bacteria 1839
355 Ga0307411_10213599 3300032005 Bacteria 1491
356 Ga0307411_10290710 3300032005 Bacteria 1306
357 Ga0307411_10359194 3300032005 Bacteria 1190
358 Ga0307415_100141645 3300032126 Bacteria 1837
359 Ga0316593_10152135 3300032168 Unclassified 842
360 Ga0373950_0010182 3300034818 Bacteria 1515
361 Ga0373929_0097806 3300035085 Bacteria 736
362 Ga0373934_0290885 3300035086 Bacteria 677
363 Ga0373940_0117922 3300035088 Bacteria 821
364 Ga0373952_0027870 3300035092 Bacteria 1236
365 Ga0373931_0018252 3300035691 Bacteria 3487
366 Ga0373933_0025868 3300035724 Bacteria 3367
367 Ga0373933_0108248 3300035724 Bacteria 1731
368 Ga0373937_0001393 3300036401 Bacteria 20204
369 Ga0373937_0172047 3300036401 Bacteria 2032
370 Ga0316582_0139687 3300036647 Bacteria 1632
371 Ga0316582_0368457 3300036647 Bacteria 989
372 Ga0316582_0412661 3300036647 Unclassified 930
373 Ga0316582_0993191 3300036647 Bacteria 573
374 Ga0451791_1948895 3300041451 Bacteria 997
375 Ga0439450_047129 3300042008 Bacteria 1015
376 Ga0439446_0121682 3300042156 Bacteria 840
377 Ga0439446_0354601 3300042156 Unclassified 523
378 Ga0439460_0171893 3300042461 Unclassified 730
379 Ga0439440_0197527 3300042993 Bacteria 595
380 Ga0453684_0000363 3300044712 Bacteria 187174
381 Ga0453684_0000814 3300044712 Bacteria 105915
382 Ga0453684_0024986 3300044712 Bacteria 8693
383 Ga0453684_0060789 3300044712 Bacteria 4855
384 Ga0453684_0880774 3300044712 Bacteria 960
385 Ga0453684_1259295 3300044712 Bacteria 773
386 Ga0451576_0004938 3300045051 Bacteria 16984
387 Ga0451576_0061389 3300045051 Bacteria 3919
388 Ga0451576_0210695 3300045051 Unclassified 2029
389 Ga0451576_0464436 3300045051 Bacteria 1329
390 Ga0451576_1573634 3300045051 Unclassified 682
391 Ga0495651_0470578 3300046462 Bacteria 809
392 Ga0495662_0215520 3300046476 Bacteria 946
393 Ga0495608_0091011 3300046511 Bacteria 1973
394 Ga0495620_0112351 3300046515 Bacteria 1079
395 Ga0495643_0004518 3300046522 Bacteria 9698
396 Ga0495621_0050152 3300046539 Bacteria 1491
397 Ga0495621_0185077 3300046539 Bacteria 833
398 Ga0495656_0170938 3300046615 Bacteria 1063
399 Ga0495659_0032363 3300046664 Bacteria 1830
400 Ga0495613_0223737 3300046689 Bacteria 1320
401 Ga0495670_0062574 3300046691 Bacteria 1873
402 Ga0495684_0300929 3300047471 Bacteria 1152
403 Ga0496109_0109020 3300048912 Bacteria 2574
404 Ga0496110_0448913 3300048913 Bacteria 1175
405 Ga0496112_0783532 3300048915 Bacteria 879
406 Ga0501297_085038 3300049520 Bacteria 518
407 Ga0501300_036522 3300049523 Bacteria 734
408 Ga0501300_044174 3300049523 Bacteria 677
409 Ga0501072_0490445 3300049588 Bacteria 972
410 Ga0501217_171670 3300049661 Bacteria 660
411 Ga0501223_102188 3300049663 Unclassified 592
412 Ga0501227_054764 3300049665 Bacteria 1013
413 Ga0501248_042390 3300049678 Unclassified 561
414 Ga0501248_058588 3300049678 Bacteria 510
415 Ga0501249_006668 3300049679 Bacteria 2379
416 Ga0501249_029460 3300049679 Bacteria 1221
417 Ga0501225_0180879 3300049705 Bacteria 659
418 Ga0501081_0120230 3300049743 Bacteria 1870
419 Ga0501273_051298 3300049770 Bacteria 631
420 Ga0501212_026721 3300049851 Bacteria 916
421 nmdc:mga00v17_6520_c1 3300050491 Bacteria 6194
422 nmdc:mga0yw44_19795_c2 3300050492 Bacteria 2936
423 nmdc:mga0k408_52098_c1 3300050493 Bacteria 1879
424 nmdc:mga06z11_1004_c1 3300050494 Bacteria 10297
425 nmdc:mga06z11_114157_c1 3300050494 Bacteria 1499
426 nmdc:mga04h51_262666_c1 3300050495 Bacteria 695
427 nmdc:mga07m45_120999_c1 3300050496 Bacteria 1512
428 nmdc:mga05p37_1053689_c1 3300050507 Unclassified 857
429 nmdc:mga05p37_18347_c1 3300050507 Bacteria 8449
430 nmdc:mga05p37_22990_c1 3300050507 Bacteria 7562
431 nmdc:mga05p37_46104_c1 3300050507 Bacteria 5360
432 nmdc:mga05p37_5136_c1 3300050507 Bacteria 15351
433 nmdc:mga05p37_63154_c1 3300050507 Bacteria 4557
434 nmdc:mga05p37_640713_c1 3300050507 Bacteria 1192
435 nmdc:mga05p37_728657_c1 3300050507 Unclassified 1097
436 nmdc:mga05p37_85739_c1 3300050507 Bacteria 3881
437 nmdc:mga05p37_9691_c1 3300050507 Bacteria 11418
438 nmdc:mga09592_44593_c1 3300050508 Bacteria 3734
439 nmdc:mga09592_45053_c1 3300050508 Bacteria 3715
440 nmdc:mga09592_912226_c1 3300050508 Bacteria 738
441 nmdc:mga09592_953_c1 3300050508 Bacteria 22761
442 nmdc:mga0qj67_3037_c1 3300050509 Bacteria 12063
443 nmdc:mga0qj67_51739_c1 3300050509 Bacteria 3249
444 nmdc:mga06r32_167641_c1 3300050510 Bacteria 2179
445 nmdc:mga06r32_22831_c1 3300050510 Bacteria 5787
446 nmdc:mga06r32_29763_c1 3300050510 Bacteria 5122
447 nmdc:mga06r32_34430_c1 3300050510 Bacteria 4775
448 nmdc:mga08y16_1992_c1 3300050511 Bacteria 20862
449 nmdc:mga08y16_41112_c1 3300050511 Bacteria 4844
450 nmdc:mga08y16_512786_c1 3300050511 Bacteria 1217
451 nmdc:mga0n895_159010_c1 3300050512 Bacteria 2290
452 nmdc:mga0n895_27076_c1 3300050512 Bacteria 5442
453 nmdc:mga0n895_4954_c1 3300050512 Bacteria 11048
454 nmdc:mga0n895_8364_c1 3300050512 Bacteria 8954
455 nmdc:mga0rr50_32433_c1 3300050513 Bacteria 3722
456 nmdc:mga0rr50_428421_c1 3300050513 Bacteria 1120
457 nmdc:mga0a205_10290_c1 3300050515 Bacteria 8594
458 nmdc:mga0a205_249636_c1 3300050515 Bacteria 1654
459 nmdc:mga0a205_297992_c2 3300050515 Bacteria 1193
460 nmdc:mga0a205_452022_c1 3300050515 Bacteria 1145
461 nmdc:mga0a205_530_c1 3300050515 Bacteria 30025
462 nmdc:mga0a205_644_c1 3300050515 Bacteria 27689
463 nmdc:mga0a205_72467_c1 3300050515 Bacteria 3328
464 nmdc:mga0sz30_152252_c1 3300050516 Bacteria 1023
465 Ga0590071_003982 3300059421 Bacteria 3610
466 Ga0590075_000064 3300059424 Bacteria 26016
467 Ga0590077_000154 3300059426 Bacteria 19232
468 Ga0070676_10783541
469 JGI24746J21847_1005512
470 JGI24033J26618_1008443
471 JGI24742J22300_10049492
472 JGI24751J29686_10059579
473 Ga0065714_10084915
474 Ga0065704_10018182
475 Ga0065704_10107652
476 Ga0065712_10009885
477 Ga0065712_10076461
478 Ga0065715_10001518
479 Ga0065715_10002245
480 Ga0065715_10033845
481 Ga0065715_10661170
482 Ga0065715_10680780
483 Ga0065707_10089688
484 Ga0065707_10096442
485 Ga0070676_10024203
486 Ga0070676_10136156
487 Ga0070690_100019969
488 Ga0070670_100002473
489 Ga0070670_100042695
490 Ga0070677_10001316
491 Ga0070677_10007665
492 Ga0068869_100026811
493 Ga0068869_100075185
494 Ga0070666_10007348
495 Ga0070666_10261984
496 Ga0070666_10548769
497 Ga0070660_100691240
498 Ga0070689_100003446
499 Ga0070689_100067082
500 Ga0070689_100343855
501 Ga0070691_10026552
502 Ga0070687_100001494
503 Ga0070687_100044162
504 Ga0070661_100016165
505 Ga0070661_100535697
506 Ga0070668_100074963
507 Ga0070668_100569782
508 Ga0070669_100021505
509 Ga0070669_100029064
510 Ga0070675_100156260
511 Ga0070671_100078871
512 Ga0070671_100182235
513 Ga0070674_100097669
514 Ga0070674_100150756
515 Ga0070674_100245648
516 Ga0070673_100004339
517 Ga0070673_100222733
518 Ga0070688_100001161
519 Ga0070688_100027374
520 Ga0070688_100751714
521 Ga0070659_100609035
522 Ga0070667_100029244
523 Ga0070667_100134676
524 Ga0070667_100740453
525 Ga0070709_10165764
526 Ga0070713_100181641
527 Ga0070701_10450817
528 Ga0070705_100055561
529 Ga0070700_100031677
530 Ga0070700_100068468
531 Ga0070700_100079801
532 Ga0070694_100066976
533 Ga0070694_100827613
534 Ga0070708_100857978
535 Ga0070663_100607517
536 Ga0070678_100007102
537 Ga0070678_100113231
538 Ga0070678_100427962
539 Ga0070662_100006996
540 Ga0070662_100121742
541 Ga0070662_100379590
542 Ga0068867_100033776
543 Ga0068867_100115294
544 Ga0068867_100539945
545 Ga0070685_10003112
546 Ga0070706_100002440
547 Ga0070707_100078227
548 Ga0070707_101808874
549 Ga0070699_100274000
550 Ga0070679_101474525
551 Ga0070679_101518529
552 Ga0070684_100040008
553 Ga0070697_100273334
554 Ga0070672_100008325
555 Ga0070672_100033973
556 Ga0070672_100096786
557 Ga0070686_100059006
558 Ga0070686_100059519
559 Ga0070695_100183869
560 Ga0070665_100065820
561 Ga0070665_100143425
562 Ga0070704_100058318
563 Ga0070704_101406017
564 Ga0068855_100335740
565 Ga0070664_100000586
566 Ga0068857_100027261
567 Ga0068857_100043052
568 Ga0068857_100550564
569 Ga0068854_100162787
570 Ga0070702_100076228
571 Ga0070702_100131174
572 Ga0070702_100589745
573 Ga0070702_100614152
574 Ga0068852_100212342
575 Ga0068859_100021961
576 Ga0068859_100091490
577 Ga0068859_101471204
578 Ga0068864_100044032
579 Ga0068864_100051361
580 Ga0068864_101673246
581 Ga0068866_10150584
582 Ga0068866_10694693
583 Ga0068861_100013019
584 Ga0068861_102002590
585 Ga0068870_10001283
586 Ga0068870_10046734
587 Ga0068863_100140523
588 Ga0068858_100006876
589 Ga0068860_100094509
590 Ga0068860_100208867
591 Ga0068860_100555991
592 Ga0068860_101721601
593 Ga0068862_100017554
594 Ga0068862_100176215
595 Ga0068862_100525356
596 Ga0081539_10005674
597 Ga0075363_100516876
598 Ga0075364_10009031
599 Ga0075364_10068202
600 Ga0075367_10100863
601 Ga0075366_10011600
602 Ga0075366_10136039
603 Ga0097621_100214899
604 Ga0097621_100615707
605 Ga0075370_10079507
606 Ga0068871_100048011
607 Ga0068871_100642569
608 Ga0068871_100723431
609 Ga0068871_101271186
610 Ga0075428_100000284
611 Ga0075428_100001176
612 Ga0075428_100004676
613 Ga0075428_100462889
614 Ga0075428_101232143
615 Ga0075430_100001139
616 Ga0075430_100006287
617 Ga0075431_100003423
618 Ga0075431_100005937
619 Ga0075431_100212836
620 Ga0075431_100629280
621 Ga0075433_10002236
622 Ga0075433_10002249
623 Ga0075433_10012091
624 Ga0075433_10373617
625 Ga0075433_11040660
626 Ga0075434_100000728
627 Ga0075434_100008478
628 Ga0075434_100024144
629 Ga0075434_100684903
630 Ga0075429_100001309
631 Ga0075429_100004341
632 Ga0075429_100010172
633 Ga0075429_100032654
634 Ga0075429_100081400
635 Ga0097620_100021961
636 Ga0097620_100091486
637 Ga0097620_101471406
638 Ga0075435_100013098
639 Ga0111539_10001803
640 Ga0111539_10022324
641 Ga0105245_10259769
642 Ga0105245_12114864
643 Ga0105247_10029075
644 Ga0105247_10256541
645 Ga0114129_10002395
646 Ga0114129_10013641
647 Ga0114129_10044626
648 Ga0114129_10115665
649 Ga0114129_10135940
650 Ga0114129_10577158
651 Ga0114129_10693404
652 Ga0114129_11060716
653 Ga0114129_11535881
654 Ga0105241_10036278
655 Ga0105242_10015762
656 Ga0105248_10030845
657 Ga0105248_10141649
658 Ga0105248_10631553
659 Ga0105237_10292438
660 Ga0105249_10007475
661 Ga0105249_10448365
662 Ga0105249_11712117
663 Ga0105239_10256517
664 Ga0105246_10008089
665 Ga0157371_10166734
666 Ga0157369_10072162
667 Ga0157369_10469273
668 Ga0157374_10187314
669 Ga0157374_10955962
670 Ga0157374_11273593
671 Ga0157378_11013497
672 Ga0163162_10018689
673 Ga0163162_10079086
674 Ga0163162_10580683
675 Ga0163162_11930370
676 Ga0157372_10579920
677 Ga0157375_10015819
678 Ga0157375_10065731
679 Ga0157375_10627058
680 Ga0163163_10075726
681 Ga0163163_10383518
682 Ga0163163_12273320
683 Ga0157380_10037670
684 Ga0157380_10270024
685 Ga0157380_10453936
686 Ga0157377_10042154
687 Ga0157377_10253689
688 Ga0157379_10006450
689 Ga0157376_10037652
690 Ga0163161_10019875
691 Ga0207697_10018514
692 Ga0207653_10102803
693 Ga0207682_10005821
694 Ga0207682_10008287
695 Ga0207642_10165171
696 Ga0207710_10274807
697 Ga0207688_10009700
698 Ga0207688_10013100
699 Ga0207688_10624111
700 Ga0207680_10716452
701 Ga0207699_10164950
702 Ga0207645_10004483
703 Ga0207645_10011778
704 Ga0207645_10023219
705 Ga0207643_10002443
706 Ga0207643_10135755
707 Ga0207705_11028766
708 Ga0207684_10203574
709 Ga0207684_10295306
710 Ga0207654_10128155
711 Ga0207662_10002100
712 Ga0207662_10018752
713 Ga0207657_10254212
714 Ga0207657_10519296
715 Ga0207649_10026865
716 Ga0207646_10035265
717 Ga0207681_10013756
718 Ga0207694_11124337
719 Ga0207650_10025389
720 Ga0207650_10874792
721 Ga0207659_10021607
722 Ga0207659_10023947
723 Ga0207659_11507087
724 Ga0207687_11045640
725 Ga0207700_10064869
726 Ga0207644_10147931
727 Ga0207690_10129751
728 Ga0207706_10003603
729 Ga0207706_10011411
730 Ga0207706_10381083
731 Ga0207670_10003021
732 Ga0207670_10115722
733 Ga0207669_10014909
734 Ga0207669_10187884
735 Ga0207669_10351144
736 Ga0207669_10365996
737 Ga0207691_10006028
738 Ga0207691_10016361
739 Ga0207691_10027666
740 Ga0207711_10021537
741 Ga0207689_10004753
742 Ga0207661_10167129
743 Ga0207679_10013411
744 Ga0207679_10393486
745 Ga0207667_10213801
746 Ga0207651_10001688
747 Ga0207651_10033104
748 Ga0207651_10205856
749 Ga0207712_10054753
750 Ga0207712_10723892
751 Ga0207668_10021951
752 Ga0207668_10248274
753 Ga0207668_11133999
754 Ga0207640_10267587
755 Ga0207658_10051857
756 Ga0207658_10202249
757 Ga0207677_10179384
758 Ga0207677_11583349
759 Ga0207703_10105588
760 Ga0207708_10025631
761 Ga0207708_10168234
762 Ga0207641_10053186
763 Ga0207641_10064498
764 Ga0207641_10748543
765 Ga0207648_10000959
766 Ga0207648_10033883
767 Ga0207648_10060982
768 Ga0207676_10428938
769 Ga0207676_10618949
770 Ga0207676_10707918
771 Ga0207674_10014675
772 Ga0207674_10048327
773 Ga0207674_10342506
774 Ga0207675_100009826
775 Ga0207675_100062540
776 Ga0207675_100454278
777 Ga0207683_10013604
778 Ga0207683_10146113
779 Ga0207683_10345883
780 Ga0207698_10577761
781 Ga0209971_1065962
782 Ga0209998_10037880
783 Ga0209974_10120254
784 Ga0207428_10000690
785 Ga0207428_10007388
786 Ga0207428_10017650
787 Ga0268265_10109732
788 Ga0268265_10154416
789 Ga0268265_10244101
790 Ga0268265_10300992
791 Ga0268264_11570080
792 Ga0265327_10206715
793 Ga0307408_100007765
794 Ga0307408_100089142
795 Ga0307408_100237311
796 Ga0307408_101080860
797 Ga0316576_10652469
798 Ga0307405_10047991
799 Ga0307413_10074962
800 Ga0307413_10528710
801 Ga0307413_10803074
802 Ga0307410_10008353
803 Ga0307410_10027641
804 Ga0307410_10060011
805 Ga0307410_10771984
806 Ga0307406_10068548
807 Ga0307406_11265283
808 Ga0307407_10021181
809 Ga0307407_10031106
810 Ga0307407_10383825
811 Ga0307407_10463819
812 Ga0307412_10007700
813 Ga0307409_100003418
814 Ga0307409_100310463
815 Ga0307416_100026250
816 Ga0307416_100400546
817 Ga0307416_101021379
818 Ga0307416_101304892
819 Ga0307414_10058871
820 Ga0307411_10060818
821 Ga0307411_10129884
822 Ga0307411_10213599
823 Ga0307411_10290710
824 Ga0307411_10359194
825 Ga0307415_100141645
826 Ga0316593_10152135
827 Ga0373950_0010182
828 Ga0373929_0097806
829 Ga0373934_0290885
830 Ga0373940_0117922
831 Ga0373952_0027870
832 Ga0373931_0018252
833 Ga0373933_0025868
834 Ga0373933_0108248
835 Ga0373937_0001393
836 Ga0373937_0172047
837 Ga0316582_0139687
838 Ga0316582_0368457
839 Ga0316582_0412661
840 Ga0316582_0993191
841 Ga0451791_1948895
842 Ga0439450_047129
843 Ga0439446_0121682
844 Ga0439446_0354601
845 Ga0439460_0171893
846 Ga0439440_0197527
847 Ga0453684_0000363
848 Ga0453684_0000814
849 Ga0453684_0024986
850 Ga0453684_0060789
851 Ga0453684_0880774
852 Ga0453684_1259295
853 Ga0451576_0004938
854 Ga0451576_0061389
855 Ga0451576_0210695
856 Ga0451576_0464436
857 Ga0451576_1573634
858 Ga0495651_0470578
859 Ga0495662_0215520
860 Ga0495608_0091011
861 Ga0495620_0112351
862 Ga0495643_0004518
863 Ga0495621_0050152
864 Ga0495621_0185077
865 Ga0495656_0170938
866 Ga0495659_0032363
867 Ga0495613_0223737
868 Ga0495670_0062574
869 Ga0495684_0300929
870 Ga0496109_0109020
871 Ga0496110_0448913
872 Ga0496112_0783532
873 Ga0501297_085038
874 Ga0501300_036522
875 Ga0501300_044174
876 Ga0501072_0490445
877 Ga0501217_171670
878 Ga0501223_102188
879 Ga0501227_054764
880 Ga0501248_042390
881 Ga0501248_058588
882 Ga0501249_006668
883 Ga0501249_029460
884 Ga0501225_0180879
885 Ga0501081_0120230
886 Ga0501273_051298
887 Ga0501212_026721
888 nmdc:mga00v17_6520_c1
889 nmdc:mga0yw44_19795_c2
890 nmdc:mga0k408_52098_c1
891 nmdc:mga06z11_1004_c1
892 nmdc:mga06z11_114157_c1
893 nmdc:mga04h51_262666_c1
894 nmdc:mga07m45_120999_c1
895 nmdc:mga05p37_1053689_c1
896 nmdc:mga05p37_18347_c1
897 nmdc:mga05p37_22990_c1
898 nmdc:mga05p37_46104_c1
899 nmdc:mga05p37_5136_c1
900 nmdc:mga05p37_63154_c1
901 nmdc:mga05p37_640713_c1
902 nmdc:mga05p37_728657_c1
903 nmdc:mga05p37_85739_c1
904 nmdc:mga05p37_9691_c1
905 nmdc:mga09592_44593_c1
906 nmdc:mga09592_45053_c1
907 nmdc:mga09592_912226_c1
908 nmdc:mga09592_953_c1
909 nmdc:mga0qj67_3037_c1
910 nmdc:mga0qj67_51739_c1
911 nmdc:mga06r32_167641_c1
912 nmdc:mga06r32_22831_c1
913 nmdc:mga06r32_29763_c1
914 nmdc:mga06r32_34430_c1
915 nmdc:mga08y16_1992_c1
916 nmdc:mga08y16_41112_c1
917 nmdc:mga08y16_512786_c1
918 nmdc:mga0n895_159010_c1
919 nmdc:mga0n895_27076_c1
920 nmdc:mga0n895_4954_c1
921 nmdc:mga0n895_8364_c1
922 nmdc:mga0rr50_32433_c1
923 nmdc:mga0rr50_428421_c1
924 nmdc:mga0a205_10290_c1
925 nmdc:mga0a205_249636_c1
926 nmdc:mga0a205_297992_c2
927 nmdc:mga0a205_452022_c1
928 nmdc:mga0a205_530_c1
929 nmdc:mga0a205_644_c1
930 nmdc:mga0a205_72467_c1
931 nmdc:mga0sz30_152252_c1
932 Ga0590071_003982
933 Ga0590075_000064
934 Ga0590077_000154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

22

173

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.937 17 165
6xwv-assembly1.cif.gz_A crystal structure of drosophila melanogaster cenp-c bound to cal1 0.899 53 136
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.8971 53 138
3c3v-assembly1.cif.gz_A crystal structure of peanut major allergen ara h 3 0.8838 53 151
3ksc-assembly2.cif.gz_D crystal structure of pea prolegumin, an 11s seed globulin from pisum sativum l. 0.8821 53 151
ID Description Score Start End Superfamily
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9285 17 165 2.60.120.10
af_A0A1D6QI94_1_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9051 53 151 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8971 53 138 2.60.120.10
af_A0A0R0GUX4_36_216_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8837 53 151 2.60.120.10
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8825 53 151 2.60.120.10
ID Description Score Start End GO Terms
AF-X0ZMI9-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9862 54 143 GO:0008830
AF-A0A1F9AQ25-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9854 16 135 GO:0000271
GO:0005829
GO:0008830
AF-A0A534HVU9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.9824 15 166 GO:0000271
GO:0005829
GO:0008830
AF-A0A661ADX7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9775 36 166 GO:0000271
GO:0005829
GO:0008830
AF-A0A1F9AQ25-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9773 16 135 GO:0000271
GO:0005829
GO:0008830

Map