F449736

General Info

Members Datasets Scaffolds Average Seq Length
466 305 453 179

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0845127|Ga0496100_0845127_35_649
Length 204
Sequence VPKSSAANCYARFGNQGIQAMSRIGKQPVVYPANVKVHLADGKLRVEGPKGKLEFAPHPAMSVKHDDKARKLEIVRPDDQRESRALHGLTRSLVANMVEGVVKGYEKRLKIEGIGYQARLDKKGLELTVGYANKIVLLPPEGVTVECPDPTTIVVKGADKQKVGQYAAEVRASRKPEPYKGKGVRYENEQVRRKEGKSFASGAQ

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221641 Nocardioides sp. Root122 Isolate Unclassified
5 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
6 2643221696 Nocardioides sp. Root140 Isolate Unclassified
7 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
8 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
9 2739367898 Nocardioides sp. CF479 Isolate Unclassified
10 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
11 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
12 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
13 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
305 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.19
Metatranscriptomes 15.02
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0.21
Rhizoplane 6.87
Rhizosphere 84.55
Stem 0
Stem Tuber 0.21
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002544 3300000549 Bacteria 2524
2 rootH1_10051921 3300003323 Bacteria 1268
3 Ga0007410J51695_1083441 3300003574 Bacteria 1237
4 Ga0058860_11975394 3300004801 Bacteria 764
5 Ga0070658_10158908 3300005327 Bacteria 1895
6 Ga0070676_10257065 3300005328 Bacteria 1168
7 Ga0070683_100092573 3300005329 Bacteria 2839
8 Ga0070683_100094063 3300005329 Bacteria 2817
9 Ga0070683_100252053 3300005329 Bacteria 1679
10 Ga0070683_100271863 3300005329 Bacteria 1612
11 Ga0070683_100426955 3300005329 Bacteria 1265
12 Ga0070683_100920934 3300005329 Bacteria 839
13 Ga0070682_100279710 3300005337 Bacteria 1216
14 Ga0070682_100860304 3300005337 Bacteria 742
15 Ga0068868_100357863 3300005338 Bacteria 1251
16 Ga0070660_101195259 3300005339 Bacteria 645
17 Ga0070689_100980221 3300005340 Bacteria 751
18 Ga0070687_100087385 3300005343 Bacteria 1716
19 Ga0070687_100316407 3300005343 Bacteria 996
20 Ga0070661_100143205 3300005344 Bacteria 1802
21 Ga0070671_100516819 3300005355 Bacteria 1028
22 Ga0070659_100595470 3300005366 Bacteria 950
23 Ga0070659_100677180 3300005366 Bacteria 891
24 Ga0070667_100015035 3300005367 Bacteria 6395
25 Ga0070713_100221657 3300005436 Bacteria 1716
26 Ga0070711_100893883 3300005439 Bacteria 758
27 Ga0070663_100664512 3300005455 Bacteria 883
28 Ga0070706_100516629 3300005467 Bacteria 1111
29 Ga0070707_100094737 3300005468 Bacteria 2891
30 Ga0070698_100011467 3300005471 Bacteria 9406
31 Ga0070684_101578531 3300005535 Bacteria 619
32 Ga0070672_100335509 3300005543 Bacteria 1287
33 Ga0070686_100945775 3300005544 Bacteria 704
34 Ga0068855_100075159 3300005563 Bacteria 3924
35 Ga0070664_100760705 3300005564 Bacteria 905
36 Ga0068857_100005931 3300005577 Bacteria 10431
37 Ga0068857_100368741 3300005577 Bacteria 1332
38 Ga0068856_100147103 3300005614 Bacteria 2364
39 Ga0068852_100418447 3300005616 Bacteria 1321
40 Ga0068864_100830920 3300005618 Viruses 909
41 Ga0068863_100074392 3300005841 Bacteria 3214
42 Ga0068860_100368999 3300005843 Bacteria 1415
43 Ga0068860_101350777 3300005843 Bacteria 734
44 Ga0081455_10153210 3300005937 Bacteria 1775
45 Ga0081539_10001524 3300005985 Bacteria 38861
46 Ga0070717_10125394 3300006028 Bacteria 2204
47 Ga0075365_10056293 3300006038 Bacteria 2613
48 Ga0075365_10105707 3300006038 Bacteria 1931
49 Ga0075364_10175395 3300006051 Bacteria 1450
50 Ga0075367_10544938 3300006178 Bacteria 736
51 Ga0097621_100930603 3300006237 Bacteria 811
52 Ga0075370_10079859 3300006353 Bacteria 1879
53 Ga0068871_100681032 3300006358 Bacteria 941
54 Ga0075428_100009144 3300006844 Bacteria 10996
55 Ga0075430_100479789 3300006846 Bacteria 1026
56 Ga0075434_100480883 3300006871 Bacteria 1263
57 Ga0075429_100364585 3300006880 Bacteria 1265
58 Ga0068865_100292114 3300006881 Bacteria 1301
59 Ga0105240_10306364 3300009093 Bacteria 1816
60 Ga0105240_10520767 3300009093 Bacteria 1320
61 Ga0111539_10036331 3300009094 Bacteria 5959
62 Ga0111539_10389303 3300009094 Bacteria 1623
63 Ga0105245_11325920 3300009098 Bacteria 769
64 Ga0114129_10732364 3300009147 Bacteria 1268
65 Ga0105243_10188641 3300009148 Bacteria 1799
66 Ga0105243_10549172 3300009148 Bacteria 1104
67 Ga0105243_10615412 3300009148 Bacteria 1047
68 Ga0105241_10106282 3300009174 Bacteria 2240
69 Ga0105241_10326458 3300009174 Bacteria 1325
70 Ga0105241_10466144 3300009174 Bacteria 1120
71 Ga0105242_11045967 3300009176 Bacteria 827
72 Ga0105248_10299308 3300009177 Bacteria 1811
73 Ga0105248_10365537 3300009177 Bacteria 1624
74 Ga0105237_10125647 3300009545 Bacteria 2559
75 Ga0105237_10443325 3300009545 Bacteria 1304
76 Ga0105238_10312379 3300009551 Bacteria 1557
77 Ga0105238_10379576 3300009551 Bacteria 1405
78 Ga0105238_10654722 3300009551 Bacteria 1061
79 Ga0105030_105423 3300009987 Bacteria 1078
80 Ga0105239_10005562 3300010375 Bacteria 14736
81 Ga0105239_10024787 3300010375 Bacteria 6608
82 Ga0105239_10607974 3300010375 Bacteria 1247
83 Ga0105246_10912913 3300011119 Bacteria 788
84 Ga0157321_1006639 3300012487 Bacteria 793
85 Ga0157373_10468262 3300013100 Bacteria 908
86 Ga0157371_10016523 3300013102 Bacteria 5505
87 Ga0157371_10607607 3300013102 Bacteria 814
88 Ga0157369_10423690 3300013105 Bacteria 1380
89 Ga0157369_10972994 3300013105 Bacteria 869
90 Ga0157369_12010097 3300013105 Bacteria 586
91 Ga0163162_10217983 3300013306 Bacteria 2038
92 Ga0163162_10698025 3300013306 Bacteria 1136
93 Ga0157372_10048179 3300013307 Bacteria 4737
94 Ga0157372_10195371 3300013307 Bacteria 2344
95 Ga0157372_11250360 3300013307 Bacteria 857
96 Ga0157372_12234994 3300013307 Bacteria 628
97 Ga0157375_10341812 3300013308 Bacteria 1662
98 Ga0157375_10728659 3300013308 Bacteria 1144
99 Ga0163163_10412631 3300014325 Bacteria 1409
100 Ga0157380_10378391 3300014326 Bacteria 1335
101 Ga0163161_10708580 3300017792 Bacteria 839
102 Ga0163161_11187988 3300017792 Bacteria 659
103 Ga0197907_11041387 3300020069 Bacteria 927
104 Ga0197907_11402319 3300020069 Bacteria 1627
105 Ga0206356_11353562 3300020070 Bacteria 1085
106 Ga0206349_1546246 3300020075 Bacteria 952
107 Ga0206353_10663939 3300020082 Bacteria 888
108 Ga0206353_11787582 3300020082 Bacteria 2828
109 Ga0206353_11845735 3300020082 Bacteria 1110
110 Ga0213873_10006215 3300021358 Bacteria 2340
111 Ga0213872_10147513 3300021361 Bacteria 1029
112 Ga0213875_10289759 3300021388 Bacteria 774
113 Ga0213871_10002791 3300021441 Bacteria 3269
114 Ga0224712_10033862 3300022467 Bacteria 1874
115 Ga0224712_10101953 3300022467 Bacteria 1219
116 Ga0224712_10147735 3300022467 Bacteria 1039
117 Ga0224712_10357227 3300022467 Bacteria 691
118 Ga0207688_10218099 3300025901 Bacteria 1148
119 Ga0207688_10319676 3300025901 Bacteria 952
120 Ga0207647_10046050 3300025904 Bacteria 2718
121 Ga0207647_10296730 3300025904 Bacteria 921
122 Ga0207705_10329546 3300025909 Bacteria 1174
123 Ga0207654_10182348 3300025911 Bacteria 1370
124 Ga0207654_10500005 3300025911 Bacteria 858
125 Ga0207654_10508822 3300025911 Bacteria 851
126 Ga0207671_10082050 3300025914 Bacteria 2419
127 Ga0207671_10256615 3300025914 Bacteria 1375
128 Ga0207663_10854519 3300025916 Bacteria 726
129 Ga0207662_10116418 3300025918 Bacteria 1672
130 Ga0207662_10342068 3300025918 Bacteria 1003
131 Ga0207657_10503897 3300025919 Bacteria 948
132 Ga0207652_10052678 3300025921 Bacteria 3494
133 Ga0207646_10180661 3300025922 Bacteria 1906
134 Ga0207694_10703471 3300025924 Bacteria 852
135 Ga0207700_11228669 3300025928 Bacteria 668
136 Ga0207690_10506944 3300025932 Bacteria 977
137 Ga0207709_10138366 3300025935 Bacteria 1670
138 Ga0207670_10686519 3300025936 Bacteria 847
139 Ga0207665_10443551 3300025939 Bacteria 995
140 Ga0207691_10106653 3300025940 Bacteria 2495
141 Ga0207691_10141516 3300025940 Bacteria 2120
142 Ga0207711_10481938 3300025941 Bacteria 1156
143 Ga0207689_10413948 3300025942 Bacteria 1124
144 Ga0207661_10277429 3300025944 Bacteria 1497
145 Ga0207661_10897678 3300025944 Bacteria 816
146 Ga0207667_10128124 3300025949 Bacteria 2614
147 Ga0207667_10248667 3300025949 Bacteria 1819
148 Ga0207658_10012024 3300025986 Bacteria 5904
149 Ga0207639_10220868 3300026041 Bacteria 1636
150 Ga0207678_10408368 3300026067 Bacteria 1176
151 Ga0207702_10340110 3300026078 Bacteria 1433
152 Ga0207641_10060895 3300026088 Bacteria 3218
153 Ga0207641_11277911 3300026088 Unclassified 734
154 Ga0207648_10569273 3300026089 Bacteria 1042
155 Ga0207676_11032441 3300026095 Bacteria 811
156 Ga0207674_10004220 3300026116 Bacteria 17343
157 Ga0207674_10183315 3300026116 Bacteria 2044
158 Ga0207674_10360988 3300026116 Bacteria 1404
159 Ga0207683_10065107 3300026121 Bacteria 3213
160 Ga0207683_10802441 3300026121 Bacteria 874
161 Ga0207698_10509214 3300026142 Bacteria 1173
162 Ga0207698_10534251 3300026142 Bacteria 1147
163 Ga0207428_10722690 3300027907 Bacteria 711
164 Ga0268266_10110335 3300028379 Bacteria 2437
165 Ga0268266_10833033 3300028379 Bacteria 891
166 Ga0268264_10500911 3300028381 Bacteria 1185
167 Ga0268264_11274417 3300028381 Bacteria 745
168 Ga0314311_1188435 3300030733 Bacteria 1487
169 Ga0316178_1000562 3300030735 Bacteria 2083
170 Ga0316183_1198375 3300030742 Bacteria 1011
171 Ga0316181_1015722 3300030744 Bacteria 1621
172 Ga0316182_1203529 3300030745 Bacteria 1647
173 Ga0307408_100746912 3300031548 Bacteria 883
174 Ga0316579_10004024 3300031691 Bacteria 5796
175 Ga0316579_10233586 3300031691 Unclassified 889
176 Ga0307405_10036906 3300031731 Bacteria 2933
177 Ga0307405_10102000 3300031731 Bacteria 1926
178 Ga0307405_11124697 3300031731 Bacteria 676
179 Ga0307413_10046989 3300031824 Bacteria 2571
180 Ga0307413_10098081 3300031824 Bacteria 1928
181 Ga0307410_10005588 3300031852 Bacteria 6677
182 Ga0307410_10348590 3300031852 Bacteria 1182
183 Ga0307410_11344997 3300031852 Bacteria 626
184 Ga0326468_10016266 3300031889 Bacteria 833
185 Ga0307406_10149713 3300031901 Bacteria 1663
186 Ga0307406_10449509 3300031901 Bacteria 1033
187 Ga0307407_10014457 3300031903 Bacteria 3866
188 Ga0307407_10763559 3300031903 Bacteria 733
189 Ga0307412_10126978 3300031911 Bacteria 1846
190 Ga0307412_10178688 3300031911 Bacteria 1594
191 Ga0307409_100049756 3300031995 Bacteria 3197
192 Ga0307409_100325459 3300031995 Bacteria 1440
193 Ga0307409_100346414 3300031995 Bacteria 1400
194 Ga0307409_100597700 3300031995 Bacteria 1090
195 Ga0307409_100950438 3300031995 Bacteria 875
196 Ga0307416_100036084 3300032002 Bacteria 3786
197 Ga0307416_100313147 3300032002 Bacteria 1567
198 Ga0307414_10555865 3300032004 Bacteria 1023
199 Ga0307411_10005932 3300032005 Bacteria 6067
200 Ga0307411_10430174 3300032005 Bacteria 1099
201 Ga0307415_100015918 3300032126 Bacteria 4466
202 Ga0307415_100484587 3300032126 Bacteria 1077
203 Ga0373926_0179608 3300035083 Bacteria 811
204 Ga0373944_0009816 3300035089 Bacteria 2602
205 Ga0373945_0230686 3300035116 Bacteria 777
206 Ga0373927_0000686 3300035695 Bacteria 25824
207 Ga0373925_0005035 3300037068 Bacteria 9915
208 Ga0395900_0354722 3300037418 Bacteria 1439
209 Ga0395898_0052865 3300037466 Bacteria 3968
210 Ga0436364_0144600 3300037853 Bacteria 638
211 Ga0436364_0283278 3300037853 Bacteria 1241
212 Ga0436364_1492027 3300037853 Bacteria 5286
213 Ga0400489_08299 3300039093 Bacteria 2200
214 Ga0436365_0863959 3300039437 Bacteria 806
215 Ga0436365_1198709 3300039437 Bacteria 1106
216 Ga0436365_1915326 3300039437 Bacteria 944
217 Ga0436360_0054036 3300039438 Bacteria 2648
218 Ga0436360_0172513 3300039438 Bacteria 3638
219 Ga0436360_0561605 3300039438 Bacteria 14597
220 Ga0436360_0619766 3300039438 Bacteria 630
221 Ga0436360_0742778 3300039438 Bacteria 955
222 Ga0436360_0910661 3300039438 Bacteria 1320
223 Ga0436360_1052071 3300039438 Bacteria 657
224 Ga0436361_0384229 3300039447 Bacteria 1292
225 Ga0436361_1131666 3300039447 Bacteria 1218
226 Ga0436361_1150223 3300039447 Bacteria 725
227 Ga0436361_1205299 3300039447 Bacteria 6283
228 Ga0436363_1405626 3300039450 Bacteria 619
229 Ga0436362_0094217 3300039453 Bacteria 9983
230 Ga0436362_0212492 3300039453 Bacteria 599
231 Ga0436362_0642521 3300039453 Bacteria 763
232 Ga0436362_1087159 3300039453 Bacteria 1135
233 Ga0439453_0013624 3300041408 Bacteria 1385
234 Ga0451793_0520399 3300041452 Bacteria 1214
235 Ga0451853_3097571 3300041512 Bacteria 2205
236 Ga0451853_3256778 3300041512 Bacteria 603
237 Ga0439449_0285961 3300042007 Bacteria 622
238 Ga0439434_0098712 3300042435 Bacteria 940
239 Ga0466965_0083147 3300044683 Bacteria 1620
240 Ga0466965_0170629 3300044683 Bacteria 1144
241 Ga0466965_0245385 3300044683 Bacteria 959
242 Ga0466966_0082183 3300044684 Bacteria 2005
243 Ga0466961_0087308 3300044693 Bacteria 1971
244 Ga0466961_0478580 3300044693 Bacteria 753
245 Ga0466963_0313118 3300044694 Bacteria 1104
246 Ga0466964_0299276 3300044706 Bacteria 810
247 Ga0466971_0071867 3300044719 Bacteria 1571
248 Ga0466970_0054158 3300044765 Bacteria 2142
249 Ga0466970_0309932 3300044765 Bacteria 891
250 Ga0466970_0925488 3300044765 Bacteria 513
251 Ga0466957_0594026 3300044842 Bacteria 774
252 Ga0466960_0040844 3300044901 Bacteria 2195
253 Ga0466960_0257501 3300044901 Bacteria 971
254 Ga0466959_0090601 3300045049 Bacteria 2196
255 Ga0451576_0884039 3300045051 Unclassified 938
256 Ga0466958_0304918 3300045836 Bacteria 1023
257 Ga0466958_0462798 3300045836 Bacteria 821
258 Ga0466967_0364322 3300045976 Bacteria 1401
259 Ga0466967_0623288 3300045976 Bacteria 1065
260 Ga0466967_0951300 3300045976 Bacteria 855
261 Ga0495603_0179692 3300046455 Bacteria 1224
262 Ga0495629_0370082 3300046459 Bacteria 976
263 Ga0495651_0139624 3300046462 Bacteria 1759
264 Ga0495580_0031237 3300046472 Bacteria 3850
265 Ga0495582_0132660 3300046473 Bacteria 1408
266 Ga0495662_0240081 3300046476 Bacteria 893
267 Ga0495608_0040460 3300046511 Bacteria 3122
268 Ga0495608_0112488 3300046511 Bacteria 1750
269 Ga0495618_0129501 3300046514 Bacteria 1615
270 Ga0495620_0238744 3300046515 Bacteria 694
271 Ga0495628_0476523 3300046516 Bacteria 904
272 Ga0495630_0008235 3300046517 Bacteria 7486
273 Ga0495665_0010435 3300046531 Bacteria 5027
274 Ga0495586_0116964 3300046535 Bacteria 1487
275 Ga0495587_0571302 3300046536 Bacteria 623
276 Ga0495645_0455363 3300046543 Bacteria 806
277 Ga0495667_0337454 3300046559 Bacteria 953
278 Ga0495667_0359610 3300046559 Bacteria 919
279 Ga0495635_0298049 3300046663 Bacteria 1081
280 Ga0495588_0481636 3300046674 Bacteria 651
281 Ga0495657_0372598 3300046675 Bacteria 843
282 Ga0495646_0291425 3300046680 Bacteria 865
283 Ga0495647_0243348 3300046681 Bacteria 799
284 Ga0495658_0099016 3300046683 Bacteria 1738
285 Ga0495613_0236318 3300046689 Bacteria 1279
286 Ga0495624_0004418 3300046690 Bacteria 10287
287 Ga0495581_0062876 3300047315 Bacteria 2145
288 Ga0495674_0008030 3300047319 Bacteria 10076
289 Ga0495675_0122155 3300047444 Bacteria 1622
290 Ga0495684_0013498 3300047471 Bacteria 6286
291 Ga0495684_0130825 3300047471 Bacteria 1885
292 Ga0495593_0118705 3300047673 Bacteria 1347
293 Ga0495614_0030694 3300048089 Bacteria 2314
294 Ga0496100_0845127 3300048903 Bacteria 718
295 Ga0496100_0925391 3300048903 Bacteria 685
296 Ga0496102_0078954 3300048905 Bacteria 3030
297 Ga0496102_0328656 3300048905 Bacteria 1440
298 Ga0496102_0528845 3300048905 Bacteria 1102
299 Ga0496102_0656220 3300048905 Bacteria 972
300 Ga0496104_0735678 3300048907 Bacteria 894
301 Ga0496105_0429800 3300048908 Bacteria 1045
302 Ga0496105_0499451 3300048908 Bacteria 955
303 Ga0496106_0197686 3300048909 Bacteria 1600
304 Ga0496106_0511425 3300048909 Bacteria 964
305 Ga0496107_0106396 3300048910 Bacteria 2060
306 Ga0496107_0255065 3300048910 Bacteria 1305
307 Ga0496108_0116105 3300048911 Bacteria 2293
308 Ga0496108_0596581 3300048911 Bacteria 962
309 Ga0496109_0127108 3300048912 Bacteria 2377
310 Ga0496109_0317446 3300048912 Bacteria 1470
311 Ga0496109_0320152 3300048912 Bacteria 1463
312 Ga0496109_0757926 3300048912 Bacteria 908
313 Ga0496110_0187288 3300048913 Bacteria 1879
314 Ga0496110_0226039 3300048913 Bacteria 1702
315 Ga0496110_0589444 3300048913 Bacteria 1009
316 Ga0496110_0668353 3300048913 Bacteria 939
317 Ga0496110_0961383 3300048913 Bacteria 761
318 Ga0496112_0325275 3300048915 Bacteria 1482
319 Ga0496113_0062846 3300048916 Bacteria 2805
320 Ga0496113_0815445 3300048916 Bacteria 741
321 Ga0496114_0278830 3300048917 Bacteria 1473
322 Ga0496114_0741750 3300048917 Bacteria 859
323 Ga0496114_0822654 3300048917 Bacteria 808
324 Ga0496115_0775438 3300048918 Bacteria 748
325 Ga0496126_0259426 3300048929 Bacteria 1446
326 Ga0496126_0480305 3300048929 Bacteria 996
327 Ga0496126_0593039 3300048929 Bacteria 874
328 Ga0501306_000429 3300049127 Bacteria 3172
329 Ga0501306_037252 3300049127 Bacteria 743
330 Ga0501308_023383 3300049128 Bacteria 788
331 Ga0501309_000041 3300049129 Bacteria 6410
332 Ga0501309_012308 3300049129 Bacteria 1125
333 Ga0501310_050463 3300049130 Bacteria 601
334 Ga0501305_000112 3300049161 Bacteria 4974
335 Ga0501305_010379 3300049161 Bacteria 1242
336 Ga0501307_000400 3300049162 Bacteria 2876
337 Ga0501311_000605 3300049527 Bacteria 2631
338 Ga0501312_000527 3300049528 Bacteria 3140
339 Ga0501313_000556 3300049529 Bacteria 2651
340 Ga0501313_006476 3300049529 Bacteria 1269
341 Ga0501314_000421 3300049530 Bacteria 2614
342 Ga0501314_011651 3300049530 Bacteria 834
343 Ga0501315_000092 3300049531 Bacteria 4451
344 Ga0501315_017420 3300049531 Bacteria 939
345 Ga0501315_044433 3300049531 Bacteria 682
346 Ga0501316_000538 3300049532 Bacteria 2676
347 Ga0501316_007114 3300049532 Bacteria 1208
348 Ga0501317_000054 3300049533 Bacteria 5235
349 Ga0501317_006299 3300049533 Bacteria 1300
350 Ga0501317_048939 3300049533 Bacteria 666
351 Ga0501318_000039 3300049534 Bacteria 5313
352 Ga0501318_001893 3300049534 Bacteria 1734
353 Ga0501319_000087 3300049535 Bacteria 3199
354 Ga0501319_002582 3300049535 Bacteria 1157
355 Ga0501320_000206 3300049536 Bacteria 3056
356 Ga0501320_007364 3300049536 Bacteria 1057
357 Ga0501321_000052 3300049537 Bacteria 5020
358 Ga0501321_012212 3300049537 Bacteria 970
359 Ga0501322_000122 3300049538 Bacteria 3004
360 Ga0501323_000080 3300049539 Bacteria 4990
361 Ga0501324_000012 3300049540 Bacteria 6616
362 Ga0501324_002878 3300049540 Bacteria 1283
363 Ga0501325_000072 3300049541 Bacteria 3117
364 Ga0501325_015792 3300049541 Bacteria 748
365 Ga0501326_05864 3300049542 Bacteria 677
366 Ga0501330_006770 3300049546 Bacteria 757
367 Ga0501333_013425 3300049549 Bacteria 606
368 Ga0501336_005600 3300049552 Bacteria 913
369 Ga0501336_014751 3300049552 Bacteria 665
370 Ga0501340_000178 3300049556 Bacteria 2291
371 Ga0501340_003385 3300049556 Bacteria 965
372 Ga0501031_0122600 3300049568 Bacteria 1698
373 Ga0501032_0192604 3300049569 Bacteria 1332
374 Ga0501033_0094885 3300049570 Bacteria 2181
375 Ga0501034_0006303 3300049571 Bacteria 12769
376 Ga0501034_0336749 3300049571 Bacteria 1439
377 Ga0501036_0053426 3300049572 Bacteria 3421
378 Ga0501036_0416300 3300049572 Bacteria 1120
379 Ga0501036_0422338 3300049572 Bacteria 1111
380 Ga0501039_0786070 3300049575 Bacteria 743
381 Ga0501040_0083061 3300049576 Bacteria 2221
382 Ga0501040_0542188 3300049576 Bacteria 839
383 Ga0501042_0342098 3300049578 Bacteria 1081
384 Ga0501042_0517370 3300049578 Bacteria 867
385 Ga0501043_0432626 3300049579 Bacteria 991
386 Ga0501048_0175836 3300049582 Bacteria 1517
387 Ga0501048_0222977 3300049582 Bacteria 1337
388 Ga0501048_0394752 3300049582 Bacteria 988
389 Ga0501067_0198771 3300049583 Bacteria 1116
390 Ga0501068_0082786 3300049584 Bacteria 1972
391 Ga0501071_0096522 3300049587 Bacteria 2175
392 Ga0501071_0721694 3300049587 Bacteria 768
393 Ga0501072_1211361 3300049588 Bacteria 586
394 Ga0501073_0082216 3300049589 Bacteria 2240
395 Ga0501074_0145694 3300049590 Bacteria 1694
396 Ga0501075_0079307 3300049591 Bacteria 2485
397 Ga0501075_0417666 3300049591 Bacteria 1023
398 Ga0501076_0082515 3300049592 Bacteria 2580
399 Ga0501077_0317699 3300049593 Bacteria 993
400 Ga0501202_068144 3300049652 Bacteria 816
401 Ga0501208_007553 3300049655 Bacteria 1433
402 Ga0501079_0217156 3300049741 Bacteria 1494
403 Ga0501079_0228905 3300049741 Bacteria 1452
404 Ga0501080_0043650 3300049742 Bacteria 4174
405 Ga0501081_0112751 3300049743 Bacteria 1931
406 Ga0501081_0385307 3300049743 Bacteria 1036
407 Ga0501083_0232778 3300049744 Unclassified 1200
408 Ga0501279_048335 3300049775 Bacteria 669
409 Ga0501035_0273134 3300049822 Bacteria 1430
410 Ga0501035_0463500 3300049822 Bacteria 1047
411 Ga0501044_0004670 3300049823 Bacteria 15326
412 Ga0501044_0358892 3300049823 Bacteria 1376
413 Ga0501045_0025024 3300049824 Bacteria 4288
414 Ga0501045_0084671 3300049824 Bacteria 2339
415 Ga0501045_0639745 3300049824 Bacteria 786
416 Ga0501212_028851 3300049851 Bacteria 888
417 nmdc:mga03n38_131444_c1 3300050490 Bacteria 1241
418 nmdc:mga00v17_209789_c1 3300050491 Bacteria 1260
419 nmdc:mga0yw44_106278_c1 3300050492 Bacteria 1794
420 nmdc:mga0yw44_60126_c1 3300050492 Bacteria 2327
421 nmdc:mga06z11_111579_c1 3300050494 Bacteria 1515
422 nmdc:mga04h51_228933_c1 3300050495 Bacteria 739
423 nmdc:mga09592_339962_c1 3300050508 Bacteria 1299
424 nmdc:mga08y16_320329_c1 3300050511 Bacteria 1596
425 nmdc:mga0n895_153479_c1 3300050512 Bacteria 2333
426 Ga0495601_0004469 3300053077 Bacteria 8082
427 Ga0495601_0097906 3300053077 Bacteria 1892
428 Ga0495595_0032286 3300053084 Bacteria 2358
429 Ga0495619_0023386 3300053085 Bacteria 3962
430 Ga0500556_0000915 3300053104 Bacteria 16267
431 Ga0500604_0200676 3300053151 Bacteria 686
432 Ga0501084_0238495 3300054114 Bacteria 1535
433 Ga0501084_0322850 3300054114 Bacteria 1304
434 Ga0587084_002623 3300059477 Bacteria 1888
435 Ga0587070_123909 3300059491 Bacteria 621
436 Ga0587080_024601 3300059503 Bacteria 1012
437 Ga0587083_0027121 3300059505 Bacteria 1111
438 Ga0587083_0034522 3300059505 Bacteria 1027
439 Ga0587088_041664 3300059508 Bacteria 867
440 Ga0587098_007540 3300059604 Bacteria 1136
441 Ga0587098_017532 3300059604 Bacteria 878
442 Ga0587099_022160 3300059622 Bacteria 724
443 Ga0587076_019336 3300059645 Bacteria 1106
444 Ga0587079_011347 3300059647 Bacteria 1433
445 Ga0587102_030066 3300059649 Bacteria 659
446 Ga0587071_104859 3300060344 Bacteria 658
447 Ga0501082_0104714 3300060353 Bacteria 2448
448 Ga0501082_0886081 3300060353 Bacteria 781
449 Ga0466962_0374835 3300061719 Bacteria 710
450 Ga0466962_0403160 3300061719 Bacteria 685
451 Ga0530510_0170144 3300061734 Bacteria 1614
452 Ga0530510_0286910 3300061734 Bacteria 1230
453 Ga0530510_0391992 3300061734 Bacteria 1046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021441 Ga0213871_10002791 Ga0213871_100027915 132
2 3300039438 Ga0436360_0561605 Ga0436360_0561605_4329_4880 132
3 3300039447 Ga0436361_1205299 Ga0436361_1205299_4009_4560 132
4 3300039453 Ga0436362_0094217 Ga0436362_0094217_8032_8583 132
5 3300045976 Ga0466967_0951300 Ga0466967_0951300_39_590 134
6 3300048918 Ga0496115_0775438 Ga0496115_0775438_92_643 136
7 3300048929 Ga0496126_0259426 Ga0496126_0259426_337_888 136
8 3300048917 Ga0496114_0822654 Ga0496114_0822654_76_627 137
9 3300039453 Ga0436362_1087159 Ga0436362_1087159_53_604 142
10 3300031995 Ga0307409_100950438 Ga0307409_1009504381 143
11 3300039447 Ga0436361_0384229 Ga0436361_0384229_82_639 144
12 3300042435 Ga0439434_0098712 Ga0439434_0098712_26_673 145
13 3300039438 Ga0436360_0619766 Ga0436360_0619766_41_616 147
14 3300005343 Ga0070687_100087385 Ga0070687_1000873852 148
15 3300005367 Ga0070667_100015035 Ga0070667_1000150353 148
16 3300005843 Ga0068860_100368999 Ga0068860_1003689992 148
17 3300025918 Ga0207662_10116418 Ga0207662_101164183 148
18 3300025986 Ga0207658_10012024 Ga0207658_1001202411 148
19 3300028381 Ga0268264_10500911 Ga0268264_105009112 148
20 3300037853 Ga0436364_0144600 Ga0436364_0144600_108_599 150
21 3300005366 Ga0070659_100677180 Ga0070659_1006771802 151
22 3300039453 Ga0436362_0212492 Ga0436362_0212492_28_522 151
23 3300006028 Ga0070717_10125394 Ga0070717_101253943 152
24 3300039450 Ga0436363_1405626 Ga0436363_1405626_91_603 152
25 3300041512 Ga0451853_3256778 Ga0451853_3256778_58_585 152
26 3300039453 Ga0436362_0642521 Ga0436362_0642521_205_738 153
27 3300044765 Ga0466970_0925488 Ga0466970_0925488_17_493 153
28 3300048910 Ga0496107_0255065 Ga0496107_0255065_790_1281 153
29 3300059649 Ga0587102_030066 Ga0587102_030066_87_584 153
30 3300009176 Ga0105242_11045967 Ga0105242_110459671 154
31 3300048905 Ga0496102_0528845 Ga0496102_0528845_223_744 154
32 3300046516 Ga0495628_0476523 Ga0495628_0476523_75_632 155
33 3300046536 Ga0495587_0571302 Ga0495587_0571302_27_584 155
34 3300046663 Ga0495635_0298049 Ga0495635_0298049_310_867 155
35 3300053077 Ga0495601_0004469 Ga0495601_0004469_2909_3466 155
36 3300053084 Ga0495595_0032286 Ga0495595_0032286_275_832 155
37 3300053085 Ga0495619_0023386 Ga0495619_0023386_1772_2329 155
38 3300009551 Ga0105238_10312379 Ga0105238_103123791 156
39 iso_pu_bacteria 2582580736 2583149022 156
40 iso_pu_bacteria 2899370129 2899373902 156
41 3300005618 Ga0068864_100830920 Ga0068864_1008309201 157
42 3300005841 Ga0068863_100074392 Ga0068863_1000743925 157
43 3300026088 Ga0207641_10060895 Ga0207641_100608954 157
44 iso_pu_bacteria 2643221561 2643824223 157
45 iso_pu_bacteria 2643221615 2644091102 157
46 iso_pu_bacteria 2643221641 2644229152 157
47 iso_pu_bacteria 2643221657 2644320905 157
48 iso_pu_bacteria 2643221696 2644533527 157
49 iso_pu_bacteria 2643221697 2644538508 157
50 iso_pu_bacteria 2687453257 2688065823 157
51 iso_pu_bacteria 2739367898 2740168046 157
52 iso_pu_bacteria 2889415604 2889421829 157
53 iso_pu_bacteria 2920107658 2920113195 157
54 iso_pu_bacteria 8054609563 8054613753 157
55 3300005340 Ga0070689_100980221 Ga0070689_1009802211 158
56 3300005436 Ga0070713_100221657 Ga0070713_1002216571 158
57 3300021361 Ga0213872_10147513 Ga0213872_101475132 158
58 3300025936 Ga0207670_10686519 Ga0207670_106865192 158
59 3300026088 Ga0207641_11277911 Ga0207641_112779111 158
60 3300037853 Ga0436364_1492027 Ga0436364_1492027_2717_3250 158
61 3300039437 Ga0436365_1915326 Ga0436365_1915326_267_800 158
62 3300039438 Ga0436360_0054036 Ga0436360_0054036_926_1459 158
63 3300039438 Ga0436360_0172513 Ga0436360_0172513_1506_2039 158
64 3300039438 Ga0436360_0742778 Ga0436360_0742778_296_829 158
65 3300039447 Ga0436361_1131666 Ga0436361_1131666_412_945 158
66 3300048929 Ga0496126_0593039 Ga0496126_0593039_184_717 158
67 3300005329 Ga0070683_100271863 Ga0070683_1002718633 159
68 3300006051 Ga0075364_10175395 Ga0075364_101753953 159
69 3300013102 Ga0157371_10016523 Ga0157371_100165236 159
70 3300013306 Ga0163162_10217983 Ga0163162_102179832 159
71 3300014325 Ga0163163_10412631 Ga0163163_104126313 159
72 3300025928 Ga0207700_11228669 Ga0207700_112286692 159
73 3300031691 Ga0316579_10004024 Ga0316579_100040246 159
74 3300031691 Ga0316579_10233586 Ga0316579_102335862 159
75 3300039093 Ga0400489_08299 Ga0400489_08299_1055_1594 159
76 3300039447 Ga0436361_1150223 Ga0436361_1150223_163_711 159
77 3300045976 Ga0466967_0623288 Ga0466967_0623288_249_785 159
78 3300049552 Ga0501336_005600 Ga0501336_005600_90_626 159
79 3300049571 Ga0501034_0336749 Ga0501034_0336749_163_699 159
80 3300049578 Ga0501042_0517370 Ga0501042_0517370_82_636 159
81 3300049583 Ga0501067_0198771 Ga0501067_0198771_513_1049 159
82 3300049589 Ga0501073_0082216 Ga0501073_0082216_697_1233 159
83 3300049591 Ga0501075_0079307 Ga0501075_0079307_1593_2147 159
84 3300049593 Ga0501077_0317699 Ga0501077_0317699_147_701 159
85 3300049741 Ga0501079_0217156 Ga0501079_0217156_383_937 159
86 3300049744 Ga0501083_0232778 Ga0501083_0232778_373_924 159
87 3300049824 Ga0501045_0084671 Ga0501045_0084671_717_1271 159
88 3300050491 nmdc:mga00v17_209789_c1 nmdc:mga00v17_209789_c1_14_550 159
89 3300060353 Ga0501082_0886081 Ga0501082_0886081_118_672 159
90 3300061734 Ga0530510_0286910 Ga0530510_0286910_498_1052 159
91 3300003323 rootH1_10051921 rootH1_100519211 160
92 3300003574 Ga0007410J51695_1083441 Ga0007410J51695_10834413 160
93 3300004801 Ga0058860_11975394 Ga0058860_119753941 160
94 3300005327 Ga0070658_10158908 Ga0070658_101589082 160
95 3300005328 Ga0070676_10257065 Ga0070676_102570652 160
96 3300005329 Ga0070683_100092573 Ga0070683_1000925733 160
97 3300005329 Ga0070683_100252053 Ga0070683_1002520532 160
98 3300005337 Ga0070682_100279710 Ga0070682_1002797102 160
99 3300005339 Ga0070660_101195259 Ga0070660_1011952591 160
100 3300005355 Ga0070671_100516819 Ga0070671_1005168192 160
101 3300005439 Ga0070711_100893883 Ga0070711_1008938831 160
102 3300005563 Ga0068855_100075159 Ga0068855_1000751592 160
103 3300005577 Ga0068857_100005931 Ga0068857_10000593111 160
104 3300005577 Ga0068857_100368741 Ga0068857_1003687411 160
105 3300005614 Ga0068856_100147103 Ga0068856_1001471034 160
106 3300005843 Ga0068860_101350777 Ga0068860_1013507772 160
107 3300005985 Ga0081539_10001524 Ga0081539_1000152442 160
108 3300006358 Ga0068871_100681032 Ga0068871_1006810322 160
109 3300006844 Ga0075428_100009144 Ga0075428_1000091444 160
110 3300006846 Ga0075430_100479789 Ga0075430_1004797892 160
111 3300006871 Ga0075434_100480883 Ga0075434_1004808831 160
112 3300006880 Ga0075429_100364585 Ga0075429_1003645851 160
113 3300009093 Ga0105240_10306364 Ga0105240_103063642 160
114 3300009093 Ga0105240_10520767 Ga0105240_105207673 160
115 3300009094 Ga0111539_10036331 Ga0111539_100363318 160
116 3300009094 Ga0111539_10389303 Ga0111539_103893032 160
117 3300009098 Ga0105245_11325920 Ga0105245_113259201 160
118 3300009147 Ga0114129_10732364 Ga0114129_107323642 160
119 3300009148 Ga0105243_10188641 Ga0105243_101886414 160
120 3300009148 Ga0105243_10615412 Ga0105243_106154122 160
121 3300009174 Ga0105241_10106282 Ga0105241_101062824 160
122 3300009174 Ga0105241_10466144 Ga0105241_104661442 160
123 3300009177 Ga0105248_10299308 Ga0105248_102993082 160
124 3300009545 Ga0105237_10443325 Ga0105237_104433253 160
125 3300009551 Ga0105238_10654722 Ga0105238_106547222 160
126 3300009987 Ga0105030_105423 Ga0105030_1054232 160
127 3300010375 Ga0105239_10005562 Ga0105239_1000556215 160
128 3300011119 Ga0105246_10912913 Ga0105246_109129131 160
129 3300012487 Ga0157321_1006639 Ga0157321_10066392 160
130 3300013100 Ga0157373_10468262 Ga0157373_104682621 160
131 3300013102 Ga0157371_10607607 Ga0157371_106076072 160
132 3300013105 Ga0157369_10423690 Ga0157369_104236903 160
133 3300013105 Ga0157369_10972994 Ga0157369_109729942 160
134 3300013105 Ga0157369_12010097 Ga0157369_120100971 160
135 3300013306 Ga0163162_10698025 Ga0163162_106980252 160
136 3300013307 Ga0157372_10048179 Ga0157372_100481794 160
137 3300013307 Ga0157372_10195371 Ga0157372_101953714 160
138 3300013307 Ga0157372_12234994 Ga0157372_122349941 160
139 3300013308 Ga0157375_10341812 Ga0157375_103418122 160
140 3300020069 Ga0197907_11041387 Ga0197907_110413872 160
141 3300020069 Ga0197907_11402319 Ga0197907_114023194 160
142 3300020075 Ga0206349_1546246 Ga0206349_15462462 160
143 3300020082 Ga0206353_10663939 Ga0206353_106639392 160
144 3300020082 Ga0206353_11787582 Ga0206353_117875822 160
145 3300021388 Ga0213875_10289759 Ga0213875_102897591 160
146 3300022467 Ga0224712_10101953 Ga0224712_101019532 160
147 3300022467 Ga0224712_10147735 Ga0224712_101477351 160
148 3300025904 Ga0207647_10046050 Ga0207647_100460504 160
149 3300025909 Ga0207705_10329546 Ga0207705_103295462 160
150 3300025911 Ga0207654_10182348 Ga0207654_101823483 160
151 3300025911 Ga0207654_10508822 Ga0207654_105088222 160
152 3300025914 Ga0207671_10256615 Ga0207671_102566152 160
153 3300025916 Ga0207663_10854519 Ga0207663_108545191 160
154 3300025918 Ga0207662_10342068 Ga0207662_103420682 160
155 3300025919 Ga0207657_10503897 Ga0207657_105038972 160
156 3300025921 Ga0207652_10052678 Ga0207652_100526783 160
157 3300025942 Ga0207689_10413948 Ga0207689_104139482 160
158 3300025944 Ga0207661_10277429 Ga0207661_102774293 160
159 3300025949 Ga0207667_10128124 Ga0207667_101281243 160
160 3300025949 Ga0207667_10248667 Ga0207667_102486672 160
161 3300026041 Ga0207639_10220868 Ga0207639_102208683 160
162 3300026078 Ga0207702_10340110 Ga0207702_103401102 160
163 3300026089 Ga0207648_10569273 Ga0207648_105692732 160
164 3300026116 Ga0207674_10004220 Ga0207674_1000422018 160
165 3300026116 Ga0207674_10183315 Ga0207674_101833153 160
166 3300027907 Ga0207428_10722690 Ga0207428_107226901 160
167 3300028379 Ga0268266_10110335 Ga0268266_101103354 160
168 3300028381 Ga0268264_11274417 Ga0268264_112744172 160
169 3300031731 Ga0307405_10102000 Ga0307405_101020004 160
170 3300031824 Ga0307413_10098081 Ga0307413_100980813 160
171 3300031852 Ga0307410_10348590 Ga0307410_103485902 160
172 3300031852 Ga0307410_11344997 Ga0307410_113449971 160
173 3300031889 Ga0326468_10016266 Ga0326468_100162661 160
174 3300031901 Ga0307406_10449509 Ga0307406_104495091 160
175 3300031903 Ga0307407_10763559 Ga0307407_107635591 160
176 3300031995 Ga0307409_100346414 Ga0307409_1003464142 160
177 3300031995 Ga0307409_100597700 Ga0307409_1005977002 160
178 3300032002 Ga0307416_100036084 Ga0307416_1000360841 160
179 3300032004 Ga0307414_10555865 Ga0307414_105558652 160
180 3300032005 Ga0307411_10430174 Ga0307411_104301742 160
181 3300035083 Ga0373926_0179608 Ga0373926_0179608_159_698 160
182 3300035089 Ga0373944_0009816 Ga0373944_0009816_1489_2028 160
183 3300035116 Ga0373945_0230686 Ga0373945_0230686_65_604 160
184 3300035695 Ga0373927_0000686 Ga0373927_0000686_13403_13942 160
185 3300037068 Ga0373925_0005035 Ga0373925_0005035_8819_9358 160
186 3300037418 Ga0395900_0354722 Ga0395900_0354722_330_869 160
187 3300037466 Ga0395898_0052865 Ga0395898_0052865_1885_2424 160
188 3300037853 Ga0436364_0283278 Ga0436364_0283278_324_875 160
189 3300039437 Ga0436365_0863959 Ga0436365_0863959_38_589 160
190 3300039437 Ga0436365_1198709 Ga0436365_1198709_425_976 160
191 3300039438 Ga0436360_1052071 Ga0436360_1052071_56_607 160
192 3300044683 Ga0466965_0083147 Ga0466965_0083147_713_1252 160
193 3300044683 Ga0466965_0170629 Ga0466965_0170629_585_1124 160
194 3300044683 Ga0466965_0245385 Ga0466965_0245385_103_642 160
195 3300044684 Ga0466966_0082183 Ga0466966_0082183_1400_1939 160
196 3300044693 Ga0466961_0087308 Ga0466961_0087308_1421_1960 160
197 3300044693 Ga0466961_0478580 Ga0466961_0478580_123_662 160
198 3300044694 Ga0466963_0313118 Ga0466963_0313118_485_1024 160
199 3300044706 Ga0466964_0299276 Ga0466964_0299276_205_744 160
200 3300044719 Ga0466971_0071867 Ga0466971_0071867_120_659 160
201 3300044765 Ga0466970_0054158 Ga0466970_0054158_130_669 160
202 3300044765 Ga0466970_0309932 Ga0466970_0309932_80_619 160
203 3300044842 Ga0466957_0594026 Ga0466957_0594026_149_688 160
204 3300044901 Ga0466960_0040844 Ga0466960_0040844_700_1239 160
205 3300044901 Ga0466960_0257501 Ga0466960_0257501_44_583 160
206 3300045049 Ga0466959_0090601 Ga0466959_0090601_1508_2047 160
207 3300045051 Ga0451576_0884039 Ga0451576_0884039_218_775 160
208 3300045836 Ga0466958_0462798 Ga0466958_0462798_119_658 160
209 3300045976 Ga0466967_0364322 Ga0466967_0364322_73_612 160
210 3300046459 Ga0495629_0370082 Ga0495629_0370082_222_779 160
211 3300046462 Ga0495651_0139624 Ga0495651_0139624_798_1358 160
212 3300046472 Ga0495580_0031237 Ga0495580_0031237_826_1383 160
213 3300046473 Ga0495582_0132660 Ga0495582_0132660_143_700 160
214 3300046476 Ga0495662_0240081 Ga0495662_0240081_83_622 160
215 3300046511 Ga0495608_0040460 Ga0495608_0040460_1419_1976 160
216 3300046511 Ga0495608_0112488 Ga0495608_0112488_1033_1590 160
217 3300046514 Ga0495618_0129501 Ga0495618_0129501_1037_1594 160
218 3300046515 Ga0495620_0238744 Ga0495620_0238744_139_678 160
219 3300046517 Ga0495630_0008235 Ga0495630_0008235_1391_1948 160
220 3300046531 Ga0495665_0010435 Ga0495665_0010435_2345_2902 160
221 3300046535 Ga0495586_0116964 Ga0495586_0116964_834_1391 160
222 3300046543 Ga0495645_0455363 Ga0495645_0455363_103_663 160
223 3300046559 Ga0495667_0337454 Ga0495667_0337454_61_618 160
224 3300046559 Ga0495667_0359610 Ga0495667_0359610_37_594 160
225 3300046675 Ga0495657_0372598 Ga0495657_0372598_178_735 160
226 3300046680 Ga0495646_0291425 Ga0495646_0291425_124_681 160
227 3300046681 Ga0495647_0243348 Ga0495647_0243348_111_650 160
228 3300046683 Ga0495658_0099016 Ga0495658_0099016_72_611 160
229 3300046689 Ga0495613_0236318 Ga0495613_0236318_279_839 160
230 3300046690 Ga0495624_0004418 Ga0495624_0004418_1392_1949 160
231 3300047315 Ga0495581_0062876 Ga0495581_0062876_675_1232 160
232 3300047319 Ga0495674_0008030 Ga0495674_0008030_5907_6464 160
233 3300047444 Ga0495675_0122155 Ga0495675_0122155_228_785 160
234 3300047471 Ga0495684_0013498 Ga0495684_0013498_5695_6252 160
235 3300047471 Ga0495684_0130825 Ga0495684_0130825_145_705 160
236 3300047673 Ga0495593_0118705 Ga0495593_0118705_223_780 160
237 3300048089 Ga0495614_0030694 Ga0495614_0030694_727_1284 160
238 3300048903 Ga0496100_0845127 Ga0496100_0845127_35_649 160
239 3300048905 Ga0496102_0656220 Ga0496102_0656220_92_634 160
240 3300048908 Ga0496105_0499451 Ga0496105_0499451_262_822 160
241 3300048911 Ga0496108_0116105 Ga0496108_0116105_742_1302 160
242 3300048912 Ga0496109_0127108 Ga0496109_0127108_1350_1892 160
243 3300048912 Ga0496109_0757926 Ga0496109_0757926_261_821 160
244 3300048913 Ga0496110_0226039 Ga0496110_0226039_131_670 160
245 3300048913 Ga0496110_0589444 Ga0496110_0589444_415_966 160
246 3300048915 Ga0496112_0325275 Ga0496112_0325275_670_1209 160
247 3300048916 Ga0496113_0062846 Ga0496113_0062846_1185_1745 160
248 3300048917 Ga0496114_0741750 Ga0496114_0741750_255_797 160
249 3300049531 Ga0501315_017420 Ga0501315_017420_128_667 160
250 3300049552 Ga0501336_014751 Ga0501336_014751_31_570 160
251 3300049571 Ga0501034_0006303 Ga0501034_0006303_12029_12586 160
252 3300049572 Ga0501036_0422338 Ga0501036_0422338_12_560 160
253 3300049576 Ga0501040_0542188 Ga0501040_0542188_80_628 160
254 3300049582 Ga0501048_0222977 Ga0501048_0222977_671_1219 160
255 3300049590 Ga0501074_0145694 Ga0501074_0145694_778_1326 160
256 3300049591 Ga0501075_0417666 Ga0501075_0417666_411_959 160
257 3300049741 Ga0501079_0228905 Ga0501079_0228905_177_725 160
258 3300049742 Ga0501080_0043650 Ga0501080_0043650_1170_1727 160
259 3300049743 Ga0501081_0112751 Ga0501081_0112751_664_1221 160
260 3300049822 Ga0501035_0273134 Ga0501035_0273134_618_1166 160
261 3300049823 Ga0501044_0004670 Ga0501044_0004670_2724_3281 160
262 3300049823 Ga0501044_0358892 Ga0501044_0358892_101_658 160
263 3300049824 Ga0501045_0025024 Ga0501045_0025024_2165_2713 160
264 3300050508 nmdc:mga09592_339962_c1 nmdc:mga09592_339962_c1_68_619 160
265 3300050511 nmdc:mga08y16_320329_c1 nmdc:mga08y16_320329_c1_327_875 160
266 3300050512 nmdc:mga0n895_153479_c1 nmdc:mga0n895_153479_c1_662_1219 160
267 3300053077 Ga0495601_0097906 Ga0495601_0097906_855_1415 160
268 3300053151 Ga0500604_0200676 Ga0500604_0200676_56_595 160
269 3300054114 Ga0501084_0322850 Ga0501084_0322850_49_597 160
270 3300059477 Ga0587084_002623 Ga0587084_002623_1274_1816 160
271 3300060353 Ga0501082_0104714 Ga0501082_0104714_294_851 160
272 3300061719 Ga0466962_0374835 Ga0466962_0374835_42_581 160
273 3300061719 Ga0466962_0403160 Ga0466962_0403160_92_631 160
274 3300000549 LJQas_1002544 LJQas_10025442 161
275 3300005329 Ga0070683_100094063 Ga0070683_1000940631 161
276 3300005329 Ga0070683_100426955 Ga0070683_1004269551 161
277 3300005329 Ga0070683_100920934 Ga0070683_1009209342 161
278 3300005337 Ga0070682_100860304 Ga0070682_1008603042 161
279 3300005338 Ga0068868_100357863 Ga0068868_1003578632 161
280 3300005343 Ga0070687_100316407 Ga0070687_1003164072 161
281 3300005344 Ga0070661_100143205 Ga0070661_1001432053 161
282 3300005366 Ga0070659_100595470 Ga0070659_1005954702 161
283 3300005455 Ga0070663_100664512 Ga0070663_1006645122 161
284 3300005467 Ga0070706_100516629 Ga0070706_1005166292 161
285 3300005468 Ga0070707_100094737 Ga0070707_1000947375 161
286 3300005471 Ga0070698_100011467 Ga0070698_10001146710 161
287 3300005535 Ga0070684_101578531 Ga0070684_1015785311 161
288 3300005543 Ga0070672_100335509 Ga0070672_1003355092 161
289 3300005544 Ga0070686_100945775 Ga0070686_1009457751 161
290 3300005564 Ga0070664_100760705 Ga0070664_1007607052 161
291 3300005616 Ga0068852_100418447 Ga0068852_1004184472 161
292 3300005937 Ga0081455_10153210 Ga0081455_101532104 161
293 3300006038 Ga0075365_10056293 Ga0075365_100562936 161
294 3300006038 Ga0075365_10105707 Ga0075365_101057074 161
295 3300006178 Ga0075367_10544938 Ga0075367_105449381 161
296 3300006237 Ga0097621_100930603 Ga0097621_1009306031 161
297 3300006353 Ga0075370_10079859 Ga0075370_100798594 161
298 3300006881 Ga0068865_100292114 Ga0068865_1002921142 161
299 3300009148 Ga0105243_10549172 Ga0105243_105491721 161
300 3300009174 Ga0105241_10326458 Ga0105241_103264582 161
301 3300009177 Ga0105248_10365537 Ga0105248_103655372 161
302 3300009545 Ga0105237_10125647 Ga0105237_101256473 161
303 3300009551 Ga0105238_10379576 Ga0105238_103795763 161
304 3300010375 Ga0105239_10024787 Ga0105239_1002478713 161
305 3300010375 Ga0105239_10607974 Ga0105239_106079742 161
306 3300013307 Ga0157372_11250360 Ga0157372_112503602 161
307 3300013308 Ga0157375_10728659 Ga0157375_107286592 161
308 3300014326 Ga0157380_10378391 Ga0157380_103783913 161
309 3300017792 Ga0163161_10708580 Ga0163161_107085802 161
310 3300017792 Ga0163161_11187988 Ga0163161_111879882 161
311 3300020070 Ga0206356_11353562 Ga0206356_113535622 161
312 3300020082 Ga0206353_11845735 Ga0206353_118457352 161
313 3300021358 Ga0213873_10006215 Ga0213873_100062152 161
314 3300022467 Ga0224712_10033862 Ga0224712_100338621 161
315 3300022467 Ga0224712_10357227 Ga0224712_103572271 161
316 3300025901 Ga0207688_10218099 Ga0207688_102180992 161
317 3300025901 Ga0207688_10319676 Ga0207688_103196762 161
318 3300025904 Ga0207647_10296730 Ga0207647_102967302 161
319 3300025911 Ga0207654_10500005 Ga0207654_105000051 161
320 3300025914 Ga0207671_10082050 Ga0207671_100820505 161
321 3300025922 Ga0207646_10180661 Ga0207646_101806613 161
322 3300025924 Ga0207694_10703471 Ga0207694_107034711 161
323 3300025932 Ga0207690_10506944 Ga0207690_105069442 161
324 3300025935 Ga0207709_10138366 Ga0207709_101383662 161
325 3300025939 Ga0207665_10443551 Ga0207665_104435512 161
326 3300025940 Ga0207691_10106653 Ga0207691_101066534 161
327 3300025940 Ga0207691_10141516 Ga0207691_101415163 161
328 3300025941 Ga0207711_10481938 Ga0207711_104819382 161
329 3300025944 Ga0207661_10897678 Ga0207661_108976782 161
330 3300026067 Ga0207678_10408368 Ga0207678_104083682 161
331 3300026095 Ga0207676_11032441 Ga0207676_110324412 161
332 3300026116 Ga0207674_10360988 Ga0207674_103609883 161
333 3300026121 Ga0207683_10065107 Ga0207683_100651072 161
334 3300026121 Ga0207683_10802441 Ga0207683_108024411 161
335 3300026142 Ga0207698_10509214 Ga0207698_105092142 161
336 3300026142 Ga0207698_10534251 Ga0207698_105342512 161
337 3300028379 Ga0268266_10833033 Ga0268266_108330331 161
338 3300030733 Ga0314311_1188435 Ga0314311_11884353 161
339 3300030735 Ga0316178_1000562 Ga0316178_10005623 161
340 3300030742 Ga0316183_1198375 Ga0316183_11983752 161
341 3300030744 Ga0316181_1015722 Ga0316181_10157222 161
342 3300030745 Ga0316182_1203529 Ga0316182_12035293 161
343 3300031548 Ga0307408_100746912 Ga0307408_1007469122 161
344 3300031731 Ga0307405_10036906 Ga0307405_100369066 161
345 3300031731 Ga0307405_11124697 Ga0307405_111246972 161
346 3300031824 Ga0307413_10046989 Ga0307413_100469893 161
347 3300031852 Ga0307410_10005588 Ga0307410_100055882 161
348 3300031901 Ga0307406_10149713 Ga0307406_101497133 161
349 3300031903 Ga0307407_10014457 Ga0307407_100144576 161
350 3300031911 Ga0307412_10126978 Ga0307412_101269783 161
351 3300031911 Ga0307412_10178688 Ga0307412_101786883 161
352 3300031995 Ga0307409_100049756 Ga0307409_1000497562 161
353 3300031995 Ga0307409_100325459 Ga0307409_1003254592 161
354 3300032002 Ga0307416_100313147 Ga0307416_1003131474 161
355 3300032005 Ga0307411_10005932 Ga0307411_100059329 161
356 3300032126 Ga0307415_100015918 Ga0307415_1000159189 161
357 3300032126 Ga0307415_100484587 Ga0307415_1004845872 161
358 3300039438 Ga0436360_0910661 Ga0436360_0910661_178_729 161
359 3300041408 Ga0439453_0013624 Ga0439453_0013624_183_725 161
360 3300041452 Ga0451793_0520399 Ga0451793_0520399_373_915 161
361 3300041512 Ga0451853_3097571 Ga0451853_3097571_629_1171 161
362 3300042007 Ga0439449_0285961 Ga0439449_0285961_65_607 161
363 3300045836 Ga0466958_0304918 Ga0466958_0304918_386_937 161
364 3300046455 Ga0495603_0179692 Ga0495603_0179692_289_831 161
365 3300046674 Ga0495588_0481636 Ga0495588_0481636_22_561 161
366 3300048903 Ga0496100_0925391 Ga0496100_0925391_133_675 161
367 3300048905 Ga0496102_0078954 Ga0496102_0078954_1550_2092 161
368 3300048905 Ga0496102_0328656 Ga0496102_0328656_303_845 161
369 3300048907 Ga0496104_0735678 Ga0496104_0735678_151_690 161
370 3300048908 Ga0496105_0429800 Ga0496105_0429800_33_575 161
371 3300048909 Ga0496106_0197686 Ga0496106_0197686_987_1526 161
372 3300048909 Ga0496106_0511425 Ga0496106_0511425_258_800 161
373 3300048910 Ga0496107_0106396 Ga0496107_0106396_511_1053 161
374 3300048911 Ga0496108_0596581 Ga0496108_0596581_129_668 161
375 3300048912 Ga0496109_0317446 Ga0496109_0317446_708_1247 161
376 3300048912 Ga0496109_0320152 Ga0496109_0320152_243_785 161
377 3300048913 Ga0496110_0187288 Ga0496110_0187288_728_1270 161
378 3300048913 Ga0496110_0668353 Ga0496110_0668353_122_661 161
379 3300048913 Ga0496110_0961383 Ga0496110_0961383_175_714 161
380 3300048916 Ga0496113_0815445 Ga0496113_0815445_134_676 161
381 3300048917 Ga0496114_0278830 Ga0496114_0278830_739_1278 161
382 3300048929 Ga0496126_0480305 Ga0496126_0480305_142_684 161
383 3300049127 Ga0501306_000429 Ga0501306_000429_1442_1984 161
384 3300049127 Ga0501306_037252 Ga0501306_037252_192_731 161
385 3300049128 Ga0501308_023383 Ga0501308_023383_29_571 161
386 3300049129 Ga0501309_000041 Ga0501309_000041_4149_4691 161
387 3300049129 Ga0501309_012308 Ga0501309_012308_479_1021 161
388 3300049130 Ga0501310_050463 Ga0501310_050463_29_571 161
389 3300049161 Ga0501305_000112 Ga0501305_000112_4407_4949 161
390 3300049161 Ga0501305_010379 Ga0501305_010379_537_1079 161
391 3300049162 Ga0501307_000400 Ga0501307_000400_365_907 161
392 3300049527 Ga0501311_000605 Ga0501311_000605_463_1005 161
393 3300049528 Ga0501312_000527 Ga0501312_000527_1704_2246 161
394 3300049529 Ga0501313_000556 Ga0501313_000556_59_601 161
395 3300049529 Ga0501313_006476 Ga0501313_006476_510_1052 161
396 3300049530 Ga0501314_000421 Ga0501314_000421_205_747 161
397 3300049530 Ga0501314_011651 Ga0501314_011651_28_570 161
398 3300049531 Ga0501315_000092 Ga0501315_000092_3584_4126 161
399 3300049531 Ga0501315_044433 Ga0501315_044433_31_573 161
400 3300049532 Ga0501316_000538 Ga0501316_000538_429_971 161
401 3300049532 Ga0501316_007114 Ga0501316_007114_412_954 161
402 3300049533 Ga0501317_000054 Ga0501317_000054_2582_3124 161
403 3300049533 Ga0501317_006299 Ga0501317_006299_29_571 161
404 3300049533 Ga0501317_048939 Ga0501317_048939_76_618 161
405 3300049534 Ga0501318_000039 Ga0501318_000039_4184_4726 161
406 3300049534 Ga0501318_001893 Ga0501318_001893_1168_1710 161
407 3300049535 Ga0501319_000087 Ga0501319_000087_2530_3072 161
408 3300049535 Ga0501319_002582 Ga0501319_002582_95_637 161
409 3300049536 Ga0501320_000206 Ga0501320_000206_464_1006 161
410 3300049536 Ga0501320_007364 Ga0501320_007364_484_1026 161
411 3300049537 Ga0501321_000052 Ga0501321_000052_2676_3218 161
412 3300049537 Ga0501321_012212 Ga0501321_012212_303_845 161
413 3300049538 Ga0501322_000122 Ga0501322_000122_412_954 161
414 3300049539 Ga0501323_000080 Ga0501323_000080_3909_4451 161
415 3300049540 Ga0501324_000012 Ga0501324_000012_1010_1552 161
416 3300049540 Ga0501324_002878 Ga0501324_002878_29_571 161
417 3300049541 Ga0501325_000072 Ga0501325_000072_298_840 161
418 3300049541 Ga0501325_015792 Ga0501325_015792_114_656 161
419 3300049542 Ga0501326_05864 Ga0501326_05864_83_622 161
420 3300049546 Ga0501330_006770 Ga0501330_006770_96_638 161
421 3300049549 Ga0501333_013425 Ga0501333_013425_44_586 161
422 3300049556 Ga0501340_000178 Ga0501340_000178_76_618 161
423 3300049556 Ga0501340_003385 Ga0501340_003385_235_777 161
424 3300049568 Ga0501031_0122600 Ga0501031_0122600_1054_1596 161
425 3300049569 Ga0501032_0192604 Ga0501032_0192604_328_870 161
426 3300049570 Ga0501033_0094885 Ga0501033_0094885_1177_1719 161
427 3300049572 Ga0501036_0053426 Ga0501036_0053426_836_1378 161
428 3300049572 Ga0501036_0416300 Ga0501036_0416300_106_648 161
429 3300049575 Ga0501039_0786070 Ga0501039_0786070_121_663 161
430 3300049576 Ga0501040_0083061 Ga0501040_0083061_214_756 161
431 3300049578 Ga0501042_0342098 Ga0501042_0342098_188_730 161
432 3300049579 Ga0501043_0432626 Ga0501043_0432626_68_610 161
433 3300049582 Ga0501048_0175836 Ga0501048_0175836_336_878 161
434 3300049582 Ga0501048_0394752 Ga0501048_0394752_12_554 161
435 3300049584 Ga0501068_0082786 Ga0501068_0082786_190_732 161
436 3300049587 Ga0501071_0096522 Ga0501071_0096522_832_1374 161
437 3300049587 Ga0501071_0721694 Ga0501071_0721694_158_709 161
438 3300049588 Ga0501072_1211361 Ga0501072_1211361_22_564 161
439 3300049592 Ga0501076_0082515 Ga0501076_0082515_1471_2013 161
440 3300049652 Ga0501202_068144 Ga0501202_068144_250_792 161
441 3300049655 Ga0501208_007553 Ga0501208_007553_167_709 161
442 3300049743 Ga0501081_0385307 Ga0501081_0385307_24_566 161
443 3300049775 Ga0501279_048335 Ga0501279_048335_56_598 161
444 3300049822 Ga0501035_0463500 Ga0501035_0463500_193_735 161
445 3300049824 Ga0501045_0639745 Ga0501045_0639745_160_711 161
446 3300049851 Ga0501212_028851 Ga0501212_028851_279_821 161
447 3300050490 nmdc:mga03n38_131444_c1 nmdc:mga03n38_131444_c1_125_667 161
448 3300050492 nmdc:mga0yw44_106278_c1 nmdc:mga0yw44_106278_c1_404_946 161
449 3300050492 nmdc:mga0yw44_60126_c1 nmdc:mga0yw44_60126_c1_990_1529 161
450 3300050494 nmdc:mga06z11_111579_c1 nmdc:mga06z11_111579_c1_27_569 161
451 3300050495 nmdc:mga04h51_228933_c1 nmdc:mga04h51_228933_c1_36_578 161
452 3300053104 Ga0500556_0000915 Ga0500556_0000915_3190_3729 161
453 3300054114 Ga0501084_0238495 Ga0501084_0238495_82_624 161
454 3300059491 Ga0587070_123909 Ga0587070_123909_29_568 161
455 3300059503 Ga0587080_024601 Ga0587080_024601_76_615 161
456 3300059505 Ga0587083_0027121 Ga0587083_0027121_441_980 161
457 3300059505 Ga0587083_0034522 Ga0587083_0034522_295_834 161
458 3300059508 Ga0587088_041664 Ga0587088_041664_238_777 161
459 3300059604 Ga0587098_007540 Ga0587098_007540_500_1042 161
460 3300059604 Ga0587098_017532 Ga0587098_017532_90_629 161
461 3300059622 Ga0587099_022160 Ga0587099_022160_38_577 161
462 3300059645 Ga0587076_019336 Ga0587076_019336_143_682 161
463 3300059647 Ga0587079_011347 Ga0587079_011347_680_1219 161
464 3300060344 Ga0587071_104859 Ga0587071_104859_23_562 161
465 3300061734 Ga0530510_0170144 Ga0530510_0170144_251_790 161
466 3300061734 Ga0530510_0391992 Ga0530510_0391992_323_865 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

112

187

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

31

104

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9749 9 158
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9703 9 153
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9672 9 158
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9663 9 154
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9643 9 153
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9519 65 158 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9508 65 151 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9504 9 64 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.946 65 153 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9436 65 158 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9991 61 144 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6F8LZI7-F1-model_v4 Large ribosomal subunit protein uL6 0.988 9 156 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9864 33 144 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A3C1WGD8-F1-model_v4 Large ribosomal subunit protein uL6 0.983 9 158 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9817 64 147

Feature Viewer

pLDDT pTM Quality
85.78 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map