F449556

General Info

Members Datasets Scaffolds Average Seq Length
465 316 435 521

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0004488|Ga0496119_0004488_5026_6933
Length 635
Sequence MSSSCEIAFKVIGAPPRPSNRRMAIDRVTAGTGRTRGPAAAGDSWELASLICISDFYCGKHTLPGLRRRRFTTLIIVYVQSIDVIDNLKAGAHSLPNGLPNPHRYDDMTTLTQTTSYADAQALCSSDKLWELFDGNREQMNIAHECIDRHAGKDEPAIILVRAAGSDETYTFRQIAQLSSQFAHALVEQGIRPGDRVAVMLEPSLAFYVAMFGAMKMGAIAVPLFTLFGPDGIRLRVQDCKPRMLVTNAEKAPMVSAGEDMRVVIADDTFLGKLASYPTHYACNTRADDLAIFQYTSGTTRELPDAVKHTHRALVTLMLAALYGTGVRPGDRFMCPSSPAWGHGLWHGTLAPLALGVTIGAYAGKFNAERLLQALQDHAFNNISAAATHYRMMRNSGAADRYRYQLDKVSFTGEPIDSETSAFVEATFGRPVCSMYGTTEIGVCLVNYPGAPDFTVKPGSLGKPVPGLRVEVQDASGAPCSPGVTGELKLWRRDAWVATKDLGRIDEDGYFWHGGRADDVIISAGWTMSAVEIEDAILKHRDVSEAAAIGVPDALRGQVVKAFVVSARPGDDAFVEEIQNAVRSQLAQHEYPRQVVFVPELPKTPAGKIHRRKLREQELATADASTVNAAPAAHV

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221717 Acidovorax sp. Root267 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
17 2816332133 Acidovorax radicis 2721A Isolate Unclassified
18 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
19 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
20 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
21 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
22 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
23 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
24 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
25 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
26 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
27 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
28 2941479691
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
197 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
293 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
303 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
307 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
308 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
309 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
316 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0
Isolates 6.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 1.08
Rhizoplane 2.15
Rhizosphere 69.89
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018638 3300003203 Bacteria 2849
2 JGI25165J46597_1000156 3300003214 Bacteria 109696
3 JGI26129J50193_1000423 3300003349 Bacteria 2628
4 Ga0055537_1000416 3300003773 Bacteria 27832
5 Ga0055534_1000008 3300003784 Bacteria 211098
6 Ga0070676_10000025 3300005328 Bacteria 46204
7 Ga0070676_10034865 3300005328 Bacteria 2891
8 Ga0070670_100003183 3300005331 Bacteria 13549
9 Ga0068869_100001973 3300005334 Bacteria 12307
10 Ga0068869_100002868 3300005334 Bacteria 10462
11 Ga0068869_100015308 3300005334 Bacteria 5141
12 Ga0068869_100035652 3300005334 Bacteria 3527
13 Ga0070680_100002681 3300005336 Bacteria 13192
14 Ga0070680_100103131 3300005336 Bacteria 2370
15 Ga0070682_100000180 3300005337 Bacteria 47178
16 Ga0068868_100012344 3300005338 Bacteria 6242
17 Ga0070660_100000321 3300005339 Bacteria 31730
18 Ga0070691_10001201 3300005341 Bacteria 10863
19 Ga0070691_10010576 3300005341 Bacteria 4213
20 Ga0070661_100002220 3300005344 Bacteria 13322
21 Ga0070668_100061260 3300005347 Bacteria 2915
22 Ga0070668_100068474 3300005347 Bacteria 2759
23 Ga0070667_100013281 3300005367 Bacteria 6803
24 Ga0070703_10005991 3300005406 Bacteria 3402
25 Ga0070714_100087111 3300005435 Bacteria 2731
26 Ga0070701_10014405 3300005438 Bacteria 3625
27 Ga0070705_100000078 3300005440 Bacteria 53383
28 Ga0070705_100007889 3300005440 Bacteria 5258
29 Ga0070705_100039002 3300005440 Bacteria 2692
30 Ga0070700_100035003 3300005441 Bacteria 3036
31 Ga0070694_100006597 3300005444 Bacteria 7052
32 Ga0070694_100007718 3300005444 Bacteria 6568
33 Ga0070663_100006683 3300005455 Bacteria 6955
34 Ga0070678_100135083 3300005456 Bacteria 1966
35 Ga0070662_100001051 3300005457 Bacteria 16865
36 Ga0068867_100004056 3300005459 Bacteria 10307
37 Ga0068867_100004238 3300005459 Bacteria 10092
38 Ga0068867_100071264 3300005459 Bacteria 2599
39 Ga0070706_100090817 3300005467 Bacteria 2832
40 Ga0070706_100113057 3300005467 Bacteria 2528
41 Ga0070706_100124897 3300005467 Bacteria 2399
42 Ga0070707_100013604 3300005468 Bacteria 7618
43 Ga0070707_100050930 3300005468 Bacteria 3969
44 Ga0070698_100000605 3300005471 Bacteria 38553
45 Ga0070698_100008141 3300005471 Bacteria 11335
46 Ga0070698_100019252 3300005471 Bacteria 7171
47 Ga0070699_100007710 3300005518 Bacteria 9356
48 Ga0070699_100028367 3300005518 Bacteria 4827
49 Ga0070679_100000702 3300005530 Bacteria 28706
50 Ga0070697_100013484 3300005536 Bacteria 6413
51 Ga0070697_100088270 3300005536 Bacteria 2560
52 Ga0068853_100000255 3300005539 Bacteria 37353
53 Ga0070672_100024798 3300005543 Bacteria 4439
54 Ga0070695_100001050 3300005545 Bacteria 15103
55 Ga0070695_100001834 3300005545 Bacteria 11980
56 Ga0070695_100002564 3300005545 Bacteria 10489
57 Ga0070695_100004328 3300005545 Bacteria 8315
58 Ga0070696_100002235 3300005546 Bacteria 12768
59 Ga0070693_100000163 3300005547 Bacteria 30819
60 Ga0070704_100011895 3300005549 Bacteria 5357
61 Ga0070704_100046200 3300005549 Bacteria 3035
62 Ga0070704_100080826 3300005549 Bacteria 2392
63 Ga0070664_100031618 3300005564 Bacteria 4424
64 Ga0068857_100014395 3300005577 Bacteria 6897
65 Ga0068856_100004092 3300005614 Bacteria 14577
66 Ga0068864_100001289 3300005618 Bacteria 20865
67 Ga0068864_100019338 3300005618 Bacteria 5693
68 Ga0068861_100002113 3300005719 Bacteria 12859
69 Ga0068863_100014737 3300005841 Bacteria 7521
70 Ga0068860_100020556 3300005843 Bacteria 6396
71 Ga0068860_100045214 3300005843 Bacteria 4198
72 Ga0068862_100008690 3300005844 Bacteria 8402
73 Ga0081540_1006616 3300005983 Bacteria 8405
74 Ga0081540_1013137 3300005983 Bacteria 5404
75 Ga0081539_10000021 3300005985 Bacteria 360643
76 Ga0081539_10010465 3300005985 Bacteria 7528
77 Ga0070717_10126661 3300006028 Bacteria 2193
78 Ga0075365_10001269 3300006038 Bacteria 11208
79 Ga0075368_10001040 3300006042 Bacteria 8693
80 Ga0075363_100000518 3300006048 Bacteria 12399
81 Ga0075363_100001321 3300006048 Bacteria 9271
82 Ga0075364_10002446 3300006051 Bacteria 10402
83 Ga0075432_10003879 3300006058 Bacteria 5094
84 Ga0070716_100037354 3300006173 Bacteria 2684
85 Ga0070712_100008679 3300006175 Bacteria 6400
86 Ga0075367_10002318 3300006178 Bacteria 8652
87 Ga0075367_10011651 3300006178 Bacteria 4664
88 Ga0075366_10003763 3300006195 Bacteria 8060
89 Ga0075366_10015804 3300006195 Bacteria 4333
90 Ga0075366_10062526 3300006195 Bacteria 2213
91 Ga0068871_100031561 3300006358 Bacteria 4179
92 Ga0075428_100107224 3300006844 Bacteria 3045
93 Ga0075428_100179555 3300006844 Bacteria 2292
94 Ga0075430_100035954 3300006846 Bacteria 4201
95 Ga0075431_100023061 3300006847 Bacteria 6363
96 Ga0075431_100064241 3300006847 Bacteria 3790
97 Ga0075431_100065489 3300006847 Bacteria 3753
98 Ga0075433_10028729 3300006852 Bacteria 4730
99 Ga0075434_100015254 3300006871 Bacteria 7364
100 Ga0075429_100002436 3300006880 Bacteria 15668
101 Ga0075429_100014571 3300006880 Bacteria 6814
102 Ga0075429_100136854 3300006880 Bacteria 2144
103 Ga0075436_100124817 3300006914 Bacteria 1803
104 Ga0079104_1004965 3300006946 Bacteria 5472
105 Ga0079104_1009183 3300006946 Bacteria 3372
106 Ga0099826_10000171 3300006948 Bacteria 27420
107 Ga0099826_10016175 3300006948 Bacteria 5630
108 Ga0075435_100022819 3300007076 Bacteria 4831
109 Ga0075435_100104739 3300007076 Bacteria 2347
110 Ga0099794_10018682 3300007265 Bacteria 3112
111 Ga0105240_10017110 3300009093 Bacteria 9789
112 Ga0114129_10006567 3300009147 Bacteria 16508
113 Ga0114129_10024131 3300009147 Bacteria 8618
114 Ga0105243_10027174 3300009148 Bacteria 4383
115 Ga0105243_10104315 3300009148 Bacteria 2360
116 Ga0105243_10112788 3300009148 Bacteria 2278
117 Ga0105241_10000746 3300009174 Bacteria 24758
118 Ga0105241_10109167 3300009174 Bacteria 2212
119 Ga0105248_10017466 3300009177 Bacteria 7911
120 Ga0105237_10003478 3300009545 Bacteria 18674
121 Ga0105249_10058580 3300009553 Bacteria 3530
122 Ga0105239_10012299 3300010375 Bacteria 9532
123 Ga0105246_10009290 3300011119 Bacteria 6053
124 Ga0157373_10000755 3300013100 Bacteria 25102
125 Ga0157373_10003078 3300013100 Bacteria 12597
126 Ga0163162_10031403 3300013306 Bacteria 5268
127 Ga0157372_10001139 3300013307 Bacteria 28905
128 Ga0157372_10025971 3300013307 Bacteria 6371
129 Ga0157375_10020434 3300013308 Bacteria 6049
130 Ga0157375_10086657 3300013308 Bacteria 3183
131 Ga0157375_10320675 3300013308 Bacteria 1714
132 Ga0182008_10000800 3300014497 Bacteria 22028
133 Ga0182008_10003506 3300014497 Bacteria 9462
134 Ga0157377_10039758 3300014745 Bacteria 2603
135 Ga0157376_10005128 3300014969 Bacteria 9131
136 Ga0182006_1000299 3300015261 Bacteria 43544
137 Ga0183362_10018 3300015683 Bacteria 25088
138 Ga0163161_10003885 3300017792 Bacteria 10475
139 Ga0163161_10019607 3300017792 Bacteria 4745
140 Ga0213871_10000476 3300021441 Bacteria 5455
141 Ga0209233_1000213 3300025261 Bacteria 109881
142 Ga0209565_1000042 3300025263 Bacteria 239712
143 Ga0209673_1000071 3300025273 Bacteria 239966
144 Ga0209675_1000041 3300025291 Bacteria 239712
145 Ga0209676_1006404 3300025292 Bacteria 5821
146 Ga0209025_1042936 3300025294 Bacteria 1913
147 Ga0209050_1000426 3300025298 Bacteria 77545
148 Ga0209050_1016927 3300025298 Bacteria 2945
149 Ga0207653_10002512 3300025885 Bacteria 5823
150 Ga0207653_10003042 3300025885 Bacteria 5327
151 Ga0207688_10023645 3300025901 Bacteria 3367
152 Ga0207645_10000170 3300025907 Bacteria 51882
153 Ga0207645_10112306 3300025907 Bacteria 1765
154 Ga0207643_10000051 3300025908 Bacteria 77737
155 Ga0207643_10003494 3300025908 Bacteria 8451
156 Ga0207684_10001912 3300025910 Bacteria 21637
157 Ga0207684_10076512 3300025910 Bacteria 2844
158 Ga0207707_10000453 3300025912 Bacteria 42710
159 Ga0207695_10015402 3300025913 Bacteria 9002
160 Ga0207693_10025988 3300025915 Bacteria 4637
161 Ga0207660_10000203 3300025917 Bacteria 38120
162 Ga0207657_10001421 3300025919 Bacteria 25553
163 Ga0207649_10000678 3300025920 Bacteria 22629
164 Ga0207652_10000690 3300025921 Bacteria 32930
165 Ga0207646_10005958 3300025922 Bacteria 12715
166 Ga0207646_10160488 3300025922 Bacteria 2029
167 Ga0207681_10023818 3300025923 Bacteria 3921
168 Ga0207681_10122183 3300025923 Bacteria 1911
169 Ga0207664_10031572 3300025929 Bacteria 4053
170 Ga0207690_10004624 3300025932 Bacteria 8135
171 Ga0207706_10004456 3300025933 Bacteria 13158
172 Ga0207686_10028723 3300025934 Bacteria 3273
173 Ga0207709_10016190 3300025935 Bacteria 4144
174 Ga0207670_10025754 3300025936 Bacteria 3697
175 Ga0207665_10000838 3300025939 Bacteria 20765
176 Ga0207691_10022418 3300025940 Bacteria 5955
177 Ga0207691_10058834 3300025940 Bacteria 3495
178 Ga0207689_10000296 3300025942 Bacteria 45380
179 Ga0207689_10003188 3300025942 Bacteria 15042
180 Ga0207689_10004497 3300025942 Bacteria 12621
181 Ga0207689_10045561 3300025942 Bacteria 3626
182 Ga0207679_10002459 3300025945 Bacteria 11401
183 Ga0207667_10001806 3300025949 Bacteria 26953
184 Ga0207668_10018443 3300025972 Bacteria 4391
185 Ga0207640_10001187 3300025981 Bacteria 14234
186 Ga0207703_10121567 3300026035 Bacteria 2242
187 Ga0207639_10018490 3300026041 Bacteria 4953
188 Ga0207678_10003431 3300026067 Bacteria 14281
189 Ga0207678_10033033 3300026067 Bacteria 4509
190 Ga0207702_10002742 3300026078 Bacteria 16501
191 Ga0207648_10004394 3300026089 Bacteria 14487
192 Ga0207648_10006061 3300026089 Bacteria 12054
193 Ga0207676_10016735 3300026095 Bacteria 5308
194 Ga0207674_10000836 3300026116 Bacteria 40167
195 Ga0207674_10004538 3300026116 Bacteria 16676
196 Ga0207674_10019104 3300026116 Bacteria 7430
197 Ga0207675_100000828 3300026118 Bacteria 30811
198 Ga0207675_100002531 3300026118 Bacteria 18076
199 Ga0207675_100120691 3300026118 Bacteria 2480
200 Ga0207683_10001975 3300026121 Bacteria 18142
201 Ga0209969_1000924 3300027360 Bacteria 3971
202 Ga0209968_1000610 3300027526 Bacteria 5549
203 Ga0209970_1000595 3300027614 Bacteria 6298
204 Ga0209983_1000595 3300027665 Bacteria 7768
205 Ga0209282_1000814 3300027666 Bacteria 15944
206 Ga0209971_1000060 3300027682 Bacteria 34835
207 Ga0209966_1000448 3300027695 Bacteria 11517
208 Ga0209998_10000006 3300027717 Bacteria 101038
209 Ga0209813_10000031 3300027866 Bacteria 65084
210 Ga0209974_10001956 3300027876 Bacteria 7524
211 Ga0268265_10162190 3300028380 Bacteria 1900
212 Ga0268264_10006914 3300028381 Bacteria 9521
213 Ga0268264_10041284 3300028381 Bacteria 3815
214 Ga0265334_10000075 3300028573 Bacteria 72027
215 Ga0307517_10075836 3300028786 Bacteria 2945
216 Ga0307515_10011589 3300028794 Bacteria 16719
217 Ga0307515_10086521 3300028794 Bacteria 3994
218 Ga0307511_10000019 3300030521 Bacteria 117947
219 Ga0307511_10000581 3300030521 Bacteria 39122
220 Ga0307511_10008856 3300030521 Bacteria 10045
221 Ga0265327_10000773 3300031251 Bacteria 49324
222 Ga0307513_10007709 3300031456 Bacteria 13905
223 Ga0307513_10015049 3300031456 Bacteria 9390
224 Ga0307513_10019069 3300031456 Bacteria 8177
225 Ga0307513_10083980 3300031456 Bacteria 3273
226 Ga0307509_10000224 3300031507 Bacteria 91320
227 Ga0307509_10121365 3300031507 Bacteria 2590
228 Ga0307408_100038787 3300031548 Bacteria 3363
229 Ga0307508_10001759 3300031616 Bacteria 24057
230 Ga0307516_10000258 3300031730 Bacteria 67844
231 Ga0307405_10108171 3300031731 Bacteria 1878
232 Ga0307412_10000086 3300031911 Bacteria 85829
233 Ga0307414_10042859 3300032004 Bacteria 3078
234 Ga0307507_10054512 3300033179 Bacteria 3804
235 Ga0307510_10000001 3300033180 Bacteria 1172244
236 Ga0307510_10008583 3300033180 Bacteria 12185
237 Ga0373960_0001045 3300035121 Bacteria 5969
238 Ga0373931_0012328 3300035691 Bacteria 4140
239 Ga0373931_0043736 3300035691 Bacteria 2360
240 Ga0373931_0094593 3300035691 Bacteria 1671
241 Ga0373927_0000200 3300035695 Bacteria 48402
242 Ga0373925_0000032 3300037068 Bacteria 145357
243 Ga0436360_0178551 3300039438 Bacteria 13175
244 Ga0436361_0454785 3300039447 Bacteria 5459
245 Ga0451797_1153611 3300041453 Bacteria 2042
246 Ga0451837_1099769 3300041494 Bacteria 2741
247 Ga0451843_0549177 3300041509 Bacteria 9781
248 Ga0439448_0002263 3300042005 Bacteria 5203
249 Ga0439450_003210 3300042008 Bacteria 2675
250 Ga0439458_0004744 3300042157 Bacteria 3092
251 Ga0439459_0000225 3300042438 Bacteria 6454
252 Ga0439460_0002756 3300042461 Bacteria 4229
253 Ga0451577_0017423 3300042876 Bacteria 6637
254 Ga0451576_0013618 3300045051 Bacteria 9091
255 Ga0451576_0050048 3300045051 Bacteria 4384
256 Ga0451576_0260407 3300045051 Bacteria 1813
257 Ga0495603_0002825 3300046455 Bacteria 10258
258 Ga0495629_0094446 3300046459 Bacteria 2087
259 Ga0495638_0000021 3300046460 Bacteria 365602
260 Ga0495638_0000079 3300046460 Bacteria 157488
261 Ga0495638_0005158 3300046460 Bacteria 9766
262 Ga0495638_0005402 3300046460 Bacteria 9516
263 Ga0495638_0034502 3300046460 Bacteria 3230
264 Ga0495650_0000163 3300046471 Bacteria 148569
265 Ga0495650_0005782 3300046471 Bacteria 7897
266 Ga0495580_0003863 3300046472 Bacteria 12683
267 Ga0495584_0065042 3300046491 Bacteria 1834
268 Ga0495596_0000081 3300046500 Bacteria 65577
269 Ga0495596_0009256 3300046500 Bacteria 4340
270 Ga0495583_0000332 3300046506 Bacteria 74708
271 Ga0495583_0024237 3300046506 Bacteria 3053
272 Ga0495606_0024030 3300046507 Bacteria 4404
273 Ga0495610_0000406 3300046512 Bacteria 44173
274 Ga0495610_0002077 3300046512 Bacteria 17092
275 Ga0495610_0025743 3300046512 Bacteria 3152
276 Ga0495631_0000868 3300046518 Bacteria 19032
277 Ga0495632_0000659 3300046519 Bacteria 31636
278 Ga0495643_0000201 3300046522 Bacteria 93295
279 Ga0495643_0046332 3300046522 Bacteria 2357
280 Ga0495648_0000026 3300046524 Bacteria 232162
281 Ga0495642_0014089 3300046528 Bacteria 3099
282 Ga0495622_0017150 3300046557 Bacteria 3371
283 Ga0495633_0004028 3300046558 Bacteria 9504
284 Ga0495656_0028465 3300046615 Bacteria 2242
285 Ga0495625_0000011 3300046660 Bacteria 377120
286 Ga0495625_0000056 3300046660 Bacteria 186024
287 Ga0495625_0000078 3300046660 Bacteria 161613
288 Ga0495625_0010075 3300046660 Bacteria 7854
289 Ga0495625_0026013 3300046660 Bacteria 4427
290 Ga0495625_0033417 3300046660 Bacteria 3804
291 Ga0495625_0051963 3300046660 Bacteria 2936
292 Ga0495661_0073007 3300046665 Bacteria 2000
293 Ga0495588_0010751 3300046674 Bacteria 4271
294 Ga0495658_0003181 3300046683 Bacteria 8178
295 Ga0495669_0019298 3300046684 Bacteria 2942
296 Ga0495671_0000050 3300046692 Bacteria 141936
297 Ga0495671_0025749 3300046692 Bacteria 3054
298 Ga0495600_0090006 3300046809 Bacteria 2001
299 Ga0495581_0031550 3300047315 Bacteria 3070
300 Ga0495676_0022799 3300047321 Bacteria 5441
301 Ga0495677_0003672 3300047445 Bacteria 5937
302 Ga0495673_0000125 3300047469 Bacteria 141937
303 Ga0495593_0004560 3300047673 Bacteria 8233
304 Ga0495614_0000897 3300048089 Bacteria 12639
305 Ga0495615_0000016 3300048090 Bacteria 56891
306 Ga0495615_0010717 3300048090 Bacteria 1842
307 Ga0496101_0001086 3300048904 Bacteria 16129
308 Ga0496101_0006666 3300048904 Bacteria 7445
309 Ga0496101_0180000 3300048904 Bacteria 1628
310 Ga0496104_0005610 3300048907 Bacteria 10985
311 Ga0496105_0001424 3300048908 Bacteria 16806
312 Ga0496106_0058628 3300048909 Bacteria 2915
313 Ga0496110_0002674 3300048913 Bacteria 13459
314 Ga0496114_0057672 3300048917 Bacteria 3242
315 Ga0496116_0000062 3300048919 Bacteria 271104
316 Ga0496116_0013297 3300048919 Bacteria 6649
317 Ga0496116_0076309 3300048919 Bacteria 2100
318 Ga0496119_0004488 3300048922 Bacteria 13873
319 Ga0496121_0008786 3300048924 Bacteria 11780
320 Ga0496122_0000102 3300048925 Bacteria 197296
321 Ga0496122_0000320 3300048925 Bacteria 105489
322 Ga0496122_0006981 3300048925 Bacteria 12712
323 Ga0496122_0016785 3300048925 Bacteria 6896
324 Ga0496122_0073445 3300048925 Bacteria 2425
325 Ga0496123_0000258 3300048926 Bacteria 107501
326 Ga0496123_0000428 3300048926 Bacteria 75893
327 Ga0496123_0000742 3300048926 Bacteria 52830
328 Ga0496123_0001578 3300048926 Bacteria 31096
329 Ga0496124_0000004 3300048927 Bacteria 976131
330 Ga0496124_0001631 3300048927 Bacteria 32175
331 Ga0496124_0097777 3300048927 Bacteria 2383
332 Ga0496125_0000023 3300048928 Bacteria 449042
333 Ga0496125_0001120 3300048928 Bacteria 40923
334 Ga0496126_0000709 3300048929 Bacteria 60772
335 Ga0496126_0024322 3300048929 Bacteria 5849
336 Ga0501033_0115124 3300049570 Bacteria 1954
337 Ga0501036_0185384 3300049572 Bacteria 1751
338 Ga0501040_0003458 3300049576 Bacteria 10185
339 Ga0501042_0008302 3300049578 Bacteria 6847
340 Ga0501043_0065869 3300049579 Bacteria 2845
341 Ga0501046_0004871 3300049580 Bacteria 12094
342 Ga0501047_0024675 3300049581 Bacteria 5773
343 Ga0501047_0151594 3300049581 Bacteria 2194
344 Ga0501048_0020059 3300049582 Bacteria 4903
345 Ga0501048_0069850 3300049582 Bacteria 2481
346 Ga0501068_0029389 3300049584 Bacteria 3254
347 Ga0501068_0055622 3300049584 Bacteria 2397
348 Ga0501070_0012720 3300049586 Bacteria 7097
349 Ga0501071_0097724 3300049587 Bacteria 2162
350 Ga0501072_0011616 3300049588 Bacteria 6727
351 Ga0501074_0107438 3300049590 Bacteria 1998
352 Ga0501075_0005377 3300049591 Bacteria 8756
353 Ga0501076_0002271 3300049592 Bacteria 13141
354 Ga0501076_0005192 3300049592 Bacteria 9323
355 Ga0501076_0114483 3300049592 Bacteria 2182
356 Ga0501077_0003731 3300049593 Bacteria 9165
357 Ga0501249_000139 3300049679 Bacteria 22524
358 Ga0501079_0009225 3300049741 Bacteria 7473
359 Ga0501080_0026075 3300049742 Bacteria 5430
360 Ga0501080_0036734 3300049742 Bacteria 4573
361 Ga0501081_0002828 3300049743 Bacteria 11010
362 Ga0501081_0003768 3300049743 Bacteria 9710
363 Ga0501081_0004213 3300049743 Bacteria 9222
364 Ga0501083_0010370 3300049744 Bacteria 6560
365 Ga0501035_0000469 3300049822 Bacteria 45211
366 Ga0501035_0131541 3300049822 Bacteria 2181
367 Ga0501044_0000424 3300049823 Bacteria 52233
368 Ga0501044_0058071 3300049823 Bacteria 3969
369 Ga0501044_0060995 3300049823 Bacteria 3859
370 Ga0501044_0066840 3300049823 Bacteria 3664
371 Ga0501045_0002044 3300049824 Bacteria 13623
372 nmdc:mga00v17_10501_c1 3300050491 Bacteria 5058
373 nmdc:mga0k408_22906_c1 3300050493 Bacteria 3520
374 nmdc:mga0k408_52681_c1 3300050493 Bacteria 2358
375 nmdc:mga06z11_2850_c1 3300050494 Bacteria 6634
376 nmdc:mga06z11_81_c1 3300050494 Bacteria 40390
377 nmdc:mga04h51_54_c1 3300050495 Bacteria 36697
378 nmdc:mga07m45_81567_c1 3300050496 Bacteria 1847
379 nmdc:mga05p37_129878_c1 3300050507 Bacteria 3092
380 nmdc:mga05p37_25458_c1 3300050507 Bacteria 7196
381 nmdc:mga05p37_64274_c1 3300050507 Bacteria 4515
382 nmdc:mga05p37_65522_c1 3300050507 Bacteria 4469
383 nmdc:mga05p37_72792_c1 3300050507 Bacteria 4229
384 nmdc:mga05p37_77270_c1 3300050507 Bacteria 4099
385 nmdc:mga09592_204737_c1 3300050508 Bacteria 1709
386 nmdc:mga09592_21461_c1 3300050508 Bacteria 5320
387 nmdc:mga09592_29217_c1 3300050508 Bacteria 4585
388 nmdc:mga0qj67_19184_c1 3300050509 Bacteria 5223
389 nmdc:mga06r32_117227_c1 3300050510 Bacteria 2624
390 nmdc:mga06r32_60315_c1 3300050510 Bacteria 3650
391 nmdc:mga06r32_72357_c1 3300050510 Bacteria 3338
392 nmdc:mga08y16_128611_c1 3300050511 Bacteria 2635
393 nmdc:mga0rr50_123533_c1 3300050513 Bacteria 2064
394 nmdc:mga0rr50_15863_c1 3300050513 Bacteria 4985
395 nmdc:mga0a205_18336_c1 3300050515 Bacteria 6578
396 Ga0500643_000063 3300053087 Bacteria 122135
397 Ga0500643_000580 3300053087 Bacteria 25332
398 Ga0500643_000652 3300053087 Bacteria 23332
399 Ga0500651_0000421 3300053093 Bacteria 22744
400 Ga0500566_0000252 3300053094 Bacteria 28789
401 Ga0500641_0000707 3300053096 Bacteria 12072
402 Ga0500556_0012645 3300053104 Bacteria 2529
403 Ga0500571_000100 3300053110 Bacteria 28202
404 Ga0500591_020931 3300053115 Bacteria 3172
405 Ga0500594_0000921 3300053118 Bacteria 6315
406 Ga0500595_000094 3300053119 Bacteria 61463
407 Ga0500595_016596 3300053119 Bacteria 2739
408 Ga0500607_038644 3300053121 Bacteria 2596
409 Ga0500608_000998 3300053122 Bacteria 10177
410 Ga0500608_025451 3300053122 Bacteria 2770
411 Ga0500655_000626 3300053133 Bacteria 7106
412 Ga0500658_0000101 3300053134 Bacteria 39385
413 Ga0500658_0000387 3300053134 Bacteria 19372
414 Ga0500559_0001441 3300053136 Bacteria 13498
415 Ga0500568_0000687 3300053139 Bacteria 24406
416 Ga0500574_000129 3300053141 Bacteria 8354
417 Ga0500588_0008667 3300053146 Bacteria 2386
418 Ga0500590_061149 3300053148 Bacteria 1891
419 Ga0500616_0004246 3300053153 Bacteria 10306
420 Ga0500619_002857 3300053154 Bacteria 3419
421 Ga0500622_0001137 3300053156 Bacteria 22215
422 Ga0500624_000066 3300053157 Bacteria 62660
423 Ga0500638_000233 3300053162 Bacteria 11918
424 Ga0500638_025729 3300053162 Bacteria 2815
425 Ga0500636_0000197 3300053177 Bacteria 32448
426 Ga0500636_0000577 3300053177 Bacteria 20072
427 Ga0500636_0012498 3300053177 Bacteria 4977
428 Ga0500625_033858 3300053729 Bacteria 2423
429 Ga0501084_0002755 3300054114 Bacteria 14187
430 Ga0501084_0012940 3300054114 Bacteria 6908
431 Ga0501084_0017972 3300054114 Bacteria 5888
432 Ga0501082_0004058 3300060353 Bacteria 12768
433 Ga0501082_0010406 3300060353 Bacteria 8008
434 Ga0501082_0019254 3300060353 Bacteria 5884
435 Ga0530510_0157265 3300061734 Bacteria 1680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10062526 Ga0075366_100625262 431
2 3300050493 nmdc:mga0k408_52681_c1 nmdc:mga0k408_52681_c1_901_2238 431
3 3300046506 Ga0495583_0024237 Ga0495583_0024237_21_1517 488
4 3300060353 Ga0501082_0019254 Ga0501082_0019254_2473_4053 499
5 3300049570 Ga0501033_0115124 Ga0501033_0115124_214_1824 500
6 3300049572 Ga0501036_0185384 Ga0501036_0185384_43_1653 500
7 3300049823 Ga0501044_0058071 Ga0501044_0058071_2154_3764 500
8 3300048927 Ga0496124_0001631 Ga0496124_0001631_12643_14220 501
9 3300048929 Ga0496126_0000709 Ga0496126_0000709_5688_7265 501
10 3300013308 Ga0157375_10086657 Ga0157375_100866572 502
11 3300014969 Ga0157376_10005128 Ga0157376_100051283 502
12 3300025940 Ga0207691_10058834 Ga0207691_100588342 502
13 3300026121 Ga0207683_10001975 Ga0207683_1000197512 502
14 3300046558 Ga0495633_0004028 Ga0495633_0004028_1526_3082 505
15 3300050511 nmdc:mga08y16_128611_c1 nmdc:mga08y16_128611_c1_997_2565 506
16 3300053096 Ga0500641_0000707 Ga0500641_0000707_2887_4437 506
17 3300005536 Ga0070697_100088270 Ga0070697_1000882701 507
18 3300005985 Ga0081539_10010465 Ga0081539_100104657 507
19 3300006844 Ga0075428_100107224 Ga0075428_1001072242 507
20 3300006844 Ga0075428_100179555 Ga0075428_1001795551 507
21 3300006846 Ga0075430_100035954 Ga0075430_1000359543 507
22 3300006847 Ga0075431_100023061 Ga0075431_1000230618 507
23 3300006847 Ga0075431_100065489 Ga0075431_1000654893 507
24 3300006880 Ga0075429_100014571 Ga0075429_1000145712 507
25 3300009147 Ga0114129_10006567 Ga0114129_1000656713 507
26 3300050507 nmdc:mga05p37_129878_c1 nmdc:mga05p37_129878_c1_1367_2899 507
27 3300050507 nmdc:mga05p37_72792_c1 nmdc:mga05p37_72792_c1_2262_3785 507
28 3300050508 nmdc:mga09592_21461_c1 nmdc:mga09592_21461_c1_3469_5001 507
29 3300050510 nmdc:mga06r32_72357_c1 nmdc:mga06r32_72357_c1_594_2126 507
30 iso_pu_bacteria 2511231028 2511400194 507
31 iso_pu_bacteria 2643221596 2643991321 507
32 iso_pu_bacteria 2738543012 2739246955 507
33 iso_pu_bacteria 2816332133 2816474899 507
34 iso_pu_bacteria 2824704595 2824713171 507
35 iso_pu_bacteria 2824753945 2824759930 507
36 iso_pu_bacteria 2824763712 2824770364 507
37 iso_pu_bacteria 2857542790 2857546040 507
38 iso_pu_bacteria 2904711408 2904713204 507
39 iso_pu_bacteria 8055225921 8055226306 507
40 3300005334 Ga0068869_100035652 Ga0068869_1000356523 508
41 3300005336 Ga0070680_100103131 Ga0070680_1001031312 508
42 3300005341 Ga0070691_10001201 Ga0070691_100012019 508
43 3300005406 Ga0070703_10005991 Ga0070703_100059912 508
44 3300005438 Ga0070701_10014405 Ga0070701_100144052 508
45 3300005440 Ga0070705_100039002 Ga0070705_1000390022 508
46 3300005441 Ga0070700_100035003 Ga0070700_1000350032 508
47 3300005459 Ga0068867_100071264 Ga0068867_1000712641 508
48 3300005549 Ga0070704_100080826 Ga0070704_1000808262 508
49 3300006880 Ga0075429_100002436 Ga0075429_1000024368 508
50 3300009148 Ga0105243_10027174 Ga0105243_100271743 508
51 3300009174 Ga0105241_10109167 Ga0105241_101091672 508
52 3300009553 Ga0105249_10058580 Ga0105249_100585802 508
53 3300025885 Ga0207653_10003042 Ga0207653_100030423 508
54 3300025908 Ga0207643_10003494 Ga0207643_100034946 508
55 3300025934 Ga0207686_10028723 Ga0207686_100287233 508
56 3300025935 Ga0207709_10016190 Ga0207709_100161903 508
57 3300025942 Ga0207689_10045561 Ga0207689_100455613 508
58 3300026116 Ga0207674_10004538 Ga0207674_1000453813 508
59 3300031548 Ga0307408_100038787 Ga0307408_1000387874 508
60 3300049582 Ga0501048_0069850 Ga0501048_0069850_686_2212 508
61 3300049584 Ga0501068_0029389 Ga0501068_0029389_216_1742 508
62 3300049588 Ga0501072_0011616 Ga0501072_0011616_1835_3361 508
63 3300049590 Ga0501074_0107438 Ga0501074_0107438_160_1686 508
64 3300049591 Ga0501075_0005377 Ga0501075_0005377_5094_6620 508
65 3300049592 Ga0501076_0002271 Ga0501076_0002271_3864_5390 508
66 3300049592 Ga0501076_0114483 Ga0501076_0114483_408_1934 508
67 3300049593 Ga0501077_0003731 Ga0501077_0003731_2313_3839 508
68 3300049743 Ga0501081_0002828 Ga0501081_0002828_8300_9826 508
69 3300049743 Ga0501081_0003768 Ga0501081_0003768_4709_6235 508
70 3300050507 nmdc:mga05p37_65522_c1 nmdc:mga05p37_65522_c1_2870_4396 508
71 3300054114 Ga0501084_0002755 Ga0501084_0002755_646_2172 508
72 3300054114 Ga0501084_0017972 Ga0501084_0017972_2329_3855 508
73 3300060353 Ga0501082_0010406 Ga0501082_0010406_3991_5517 508
74 iso_pu_bacteria 2512564014 2512646149 508
75 iso_pu_bacteria 2599185292 2599906061 508
76 iso_pu_bacteria 2643221569 2643858914 508
77 iso_pu_bacteria 2643221594 2643981923 508
78 iso_pu_bacteria 2643221609 2644057211 508
79 iso_pu_bacteria 2643221611 2644071967 508
80 iso_pu_bacteria 2643221621 2644122778 508
81 iso_pu_bacteria 2643221658 2644328435 508
82 iso_pu_bacteria 2643221717 2644645361 508
83 iso_pu_bacteria 2738541277 2738722329 508
84 iso_pu_bacteria 2738543019 2739282693 508
85 iso_pu_bacteria 2808606395 2809033988 508
86 iso_pu_bacteria 2842775625 2842776799 508
87 iso_pu_bacteria 2857537821 2857539859 508
88 iso_pu_bacteria 2941479691 2941479822 508
89 3300006028 Ga0070717_10126661 Ga0070717_101266612 509
90 3300033179 Ga0307507_10054512 Ga0307507_100545122 509
91 3300048090 Ga0495615_0010717 Ga0495615_0010717_90_1634 509
92 iso_pu_bacteria 2904479285 2904479599 509
93 3300005328 Ga0070676_10000025 Ga0070676_100000258 510
94 3300005331 Ga0070670_100003183 Ga0070670_1000031836 510
95 3300005334 Ga0068869_100002868 Ga0068869_1000028684 510
96 3300005336 Ga0070680_100002681 Ga0070680_10000268112 510
97 3300005337 Ga0070682_100000180 Ga0070682_1000001803 510
98 3300005338 Ga0068868_100012344 Ga0068868_1000123445 510
99 3300005339 Ga0070660_100000321 Ga0070660_10000032112 510
100 3300005341 Ga0070691_10010576 Ga0070691_100105762 510
101 3300005344 Ga0070661_100002220 Ga0070661_1000022208 510
102 3300005440 Ga0070705_100000078 Ga0070705_10000007838 510
103 3300005444 Ga0070694_100007718 Ga0070694_1000077182 510
104 3300005455 Ga0070663_100006683 Ga0070663_1000066835 510
105 3300005457 Ga0070662_100001051 Ga0070662_1000010519 510
106 3300005459 Ga0068867_100004238 Ga0068867_1000042384 510
107 3300005471 Ga0070698_100000605 Ga0070698_10000060522 510
108 3300005530 Ga0070679_100000702 Ga0070679_10000070220 510
109 3300005539 Ga0068853_100000255 Ga0068853_1000002552 510
110 3300005545 Ga0070695_100001050 Ga0070695_10000105012 510
111 3300005546 Ga0070696_100002235 Ga0070696_1000022354 510
112 3300005547 Ga0070693_100000163 Ga0070693_1000001638 510
113 3300005549 Ga0070704_100011895 Ga0070704_1000118953 510
114 3300005564 Ga0070664_100031618 Ga0070664_1000316182 510
115 3300005614 Ga0068856_100004092 Ga0068856_10000409210 510
116 3300005618 Ga0068864_100019338 Ga0068864_1000193385 510
117 3300005841 Ga0068863_100014737 Ga0068863_1000147376 510
118 3300005843 Ga0068860_100045214 Ga0068860_1000452144 510
119 3300007076 Ga0075435_100104739 Ga0075435_1001047392 510
120 3300009147 Ga0114129_10024131 Ga0114129_100241319 510
121 3300009148 Ga0105243_10112788 Ga0105243_101127882 510
122 3300009174 Ga0105241_10000746 Ga0105241_1000074619 510
123 3300013100 Ga0157373_10000755 Ga0157373_1000075519 510
124 3300013307 Ga0157372_10001139 Ga0157372_100011399 510
125 3300013308 Ga0157375_10020434 Ga0157375_100204345 510
126 3300014745 Ga0157377_10039758 Ga0157377_100397582 510
127 3300025885 Ga0207653_10002512 Ga0207653_100025125 510
128 3300025901 Ga0207688_10023645 Ga0207688_100236453 510
129 3300025907 Ga0207645_10000170 Ga0207645_1000017014 510
130 3300025908 Ga0207643_10000051 Ga0207643_1000005123 510
131 3300025912 Ga0207707_10000453 Ga0207707_1000045321 510
132 3300025917 Ga0207660_10000203 Ga0207660_1000020312 510
133 3300025919 Ga0207657_10001421 Ga0207657_100014215 510
134 3300025920 Ga0207649_10000678 Ga0207649_1000067812 510
135 3300025921 Ga0207652_10000690 Ga0207652_1000069015 510
136 3300025923 Ga0207681_10023818 Ga0207681_100238183 510
137 3300025932 Ga0207690_10004624 Ga0207690_100046243 510
138 3300025933 Ga0207706_10004456 Ga0207706_100044565 510
139 3300025936 Ga0207670_10025754 Ga0207670_100257542 510
140 3300025942 Ga0207689_10000296 Ga0207689_1000029631 510
141 3300025945 Ga0207679_10002459 Ga0207679_100024592 510
142 3300025949 Ga0207667_10001806 Ga0207667_1000180612 510
143 3300025981 Ga0207640_10001187 Ga0207640_100011877 510
144 3300026041 Ga0207639_10018490 Ga0207639_100184904 510
145 3300026067 Ga0207678_10003431 Ga0207678_100034319 510
146 3300026078 Ga0207702_10002742 Ga0207702_1000274211 510
147 3300026089 Ga0207648_10004394 Ga0207648_100043945 510
148 3300026095 Ga0207676_10016735 Ga0207676_100167353 510
149 3300026116 Ga0207674_10000836 Ga0207674_1000083620 510
150 3300026118 Ga0207675_100002531 Ga0207675_10000253117 510
151 3300028380 Ga0268265_10162190 Ga0268265_101621902 510
152 3300028381 Ga0268264_10041284 Ga0268264_100412843 510
153 3300031731 Ga0307405_10108171 Ga0307405_101081712 510
154 3300035121 Ga0373960_0001045 Ga0373960_0001045_2300_3865 510
155 3300035691 Ga0373931_0043736 Ga0373931_0043736_76_1641 510
156 3300041453 Ga0451797_1153611 Ga0451797_1153611_347_1924 510
157 3300041494 Ga0451837_1099769 Ga0451837_1099769_170_1747 510
158 3300041509 Ga0451843_0549177 Ga0451843_0549177_5198_6775 510
159 3300042005 Ga0439448_0002263 Ga0439448_0002263_1155_2720 510
160 3300042157 Ga0439458_0004744 Ga0439458_0004744_985_2550 510
161 3300042438 Ga0439459_0000225 Ga0439459_0000225_3468_5033 510
162 3300042876 Ga0451577_0017423 Ga0451577_0017423_1930_3495 510
163 3300045051 Ga0451576_0050048 Ga0451576_0050048_2752_4317 510
164 3300046557 Ga0495622_0017150 Ga0495622_0017150_163_1710 510
165 3300046692 Ga0495671_0025749 Ga0495671_0025749_366_1928 510
166 3300049579 Ga0501043_0065869 Ga0501043_0065869_944_2521 510
167 3300050496 nmdc:mga07m45_81567_c1 nmdc:mga07m45_81567_c1_137_1699 510
168 3300050507 nmdc:mga05p37_64274_c1 nmdc:mga05p37_64274_c1_2744_4309 510
169 3300050507 nmdc:mga05p37_77270_c1 nmdc:mga05p37_77270_c1_2206_3738 510
170 3300050510 nmdc:mga06r32_117227_c1 nmdc:mga06r32_117227_c1_225_1757 510
171 3300050513 nmdc:mga0rr50_123533_c1 nmdc:mga0rr50_123533_c1_350_1915 510
172 3300050515 nmdc:mga0a205_18336_c1 nmdc:mga0a205_18336_c1_1604_3169 510
173 3300053087 Ga0500643_000063 Ga0500643_000063_81242_82801 510
174 3300053122 Ga0500608_025451 Ga0500608_025451_334_1893 510
175 3300053148 Ga0500590_061149 Ga0500590_061149_100_1659 510
176 3300053162 Ga0500638_025729 Ga0500638_025729_106_1665 510
177 3300053177 Ga0500636_0000197 Ga0500636_0000197_25078_26637 510
178 3300003214 JGI25165J46597_1000156 JGI25165J46597_100015674 511
179 3300003349 JGI26129J50193_1000423 JGI26129J50193_10004232 511
180 3300003773 Ga0055537_1000416 Ga0055537_10004167 511
181 3300003784 Ga0055534_1000008 Ga0055534_10000087 511
182 3300005328 Ga0070676_10034865 Ga0070676_100348652 511
183 3300005334 Ga0068869_100015308 Ga0068869_1000153083 511
184 3300005435 Ga0070714_100087111 Ga0070714_1000871112 511
185 3300005440 Ga0070705_100007889 Ga0070705_1000078893 511
186 3300005444 Ga0070694_100006597 Ga0070694_1000065974 511
187 3300005467 Ga0070706_100090817 Ga0070706_1000908172 511
188 3300005467 Ga0070706_100113057 Ga0070706_1001130572 511
189 3300005468 Ga0070707_100013604 Ga0070707_1000136043 511
190 3300005471 Ga0070698_100019252 Ga0070698_1000192524 511
191 3300005518 Ga0070699_100007710 Ga0070699_1000077107 511
192 3300005545 Ga0070695_100001834 Ga0070695_1000018349 511
193 3300005545 Ga0070695_100002564 Ga0070695_1000025643 511
194 3300005545 Ga0070695_100004328 Ga0070695_1000043286 511
195 3300005549 Ga0070704_100046200 Ga0070704_1000462002 511
196 3300005844 Ga0068862_100008690 Ga0068862_1000086906 511
197 3300005983 Ga0081540_1006616 Ga0081540_10066164 511
198 3300005983 Ga0081540_1013137 Ga0081540_10131375 511
199 3300006038 Ga0075365_10001269 Ga0075365_100012692 511
200 3300006048 Ga0075363_100000518 Ga0075363_1000005187 511
201 3300006051 Ga0075364_10002446 Ga0075364_100024468 511
202 3300006058 Ga0075432_10003879 Ga0075432_100038793 511
203 3300006173 Ga0070716_100037354 Ga0070716_1000373542 511
204 3300006175 Ga0070712_100008679 Ga0070712_1000086793 511
205 3300006195 Ga0075366_10015804 Ga0075366_100158043 511
206 3300006946 Ga0079104_1009183 Ga0079104_10091832 511
207 3300006948 Ga0099826_10000171 Ga0099826_1000017134 511
208 3300006948 Ga0099826_10016175 Ga0099826_100161752 511
209 3300011119 Ga0105246_10009290 Ga0105246_100092904 511
210 3300013100 Ga0157373_10003078 Ga0157373_1000307810 511
211 3300013307 Ga0157372_10025971 Ga0157372_100259716 511
212 3300014497 Ga0182008_10000800 Ga0182008_1000080015 511
213 3300015261 Ga0182006_1000299 Ga0182006_10002997 511
214 3300017792 Ga0163161_10003885 Ga0163161_100038857 511
215 3300021441 Ga0213871_10000476 Ga0213871_100004763 511
216 3300025261 Ga0209233_1000213 Ga0209233_100021337 511
217 3300025263 Ga0209565_1000042 Ga0209565_10000427 511
218 3300025273 Ga0209673_1000071 Ga0209673_1000071220 511
219 3300025291 Ga0209675_1000041 Ga0209675_1000041219 511
220 3300025294 Ga0209025_1042936 Ga0209025_10429361 511
221 3300025910 Ga0207684_10076512 Ga0207684_100765122 511
222 3300025915 Ga0207693_10025988 Ga0207693_100259882 511
223 3300025922 Ga0207646_10160488 Ga0207646_101604881 511
224 3300025923 Ga0207681_10122183 Ga0207681_101221832 511
225 3300025929 Ga0207664_10031572 Ga0207664_100315722 511
226 3300025939 Ga0207665_10000838 Ga0207665_1000083819 511
227 3300025942 Ga0207689_10003188 Ga0207689_100031884 511
228 3300026118 Ga0207675_100120691 Ga0207675_1001206912 511
229 3300027360 Ga0209969_1000924 Ga0209969_10009243 511
230 3300027526 Ga0209968_1000610 Ga0209968_10006103 511
231 3300027614 Ga0209970_1000595 Ga0209970_10005953 511
232 3300027665 Ga0209983_1000595 Ga0209983_10005953 511
233 3300027666 Ga0209282_1000814 Ga0209282_100081416 511
234 3300027682 Ga0209971_1000060 Ga0209971_10000604 511
235 3300027695 Ga0209966_1000448 Ga0209966_10004489 511
236 3300027717 Ga0209998_10000006 Ga0209998_1000000621 511
237 3300027876 Ga0209974_10001956 Ga0209974_100019565 511
238 3300028794 Ga0307515_10011589 Ga0307515_100115899 511
239 3300031456 Ga0307513_10007709 Ga0307513_1000770914 511
240 3300031456 Ga0307513_10015049 Ga0307513_100150495 511
241 3300031456 Ga0307513_10083980 Ga0307513_100839802 511
242 3300031507 Ga0307509_10121365 Ga0307509_101213652 511
243 3300031616 Ga0307508_10001759 Ga0307508_100017592 511
244 3300032004 Ga0307414_10042859 Ga0307414_100428593 511
245 3300033180 Ga0307510_10008583 Ga0307510_100085839 511
246 3300035695 Ga0373927_0000200 Ga0373927_0000200_46741_48333 511
247 3300037068 Ga0373925_0000032 Ga0373925_0000032_57207_58799 511
248 3300039438 Ga0436360_0178551 Ga0436360_0178551_10209_11771 511
249 3300039447 Ga0436361_0454785 Ga0436361_0454785_415_1977 511
250 3300042008 Ga0439450_003210 Ga0439450_003210_1030_2607 511
251 3300042461 Ga0439460_0002756 Ga0439460_0002756_1360_2937 511
252 3300045051 Ga0451576_0013618 Ga0451576_0013618_5460_7037 511
253 3300046455 Ga0495603_0002825 Ga0495603_0002825_4352_5911 511
254 3300046459 Ga0495629_0094446 Ga0495629_0094446_200_1765 511
255 3300046460 Ga0495638_0005158 Ga0495638_0005158_5762_7324 511
256 3300046471 Ga0495650_0000163 Ga0495650_0000163_116940_118505 511
257 3300046491 Ga0495584_0065042 Ga0495584_0065042_198_1757 511
258 3300046512 Ga0495610_0025743 Ga0495610_0025743_1501_3054 511
259 3300046518 Ga0495631_0000868 Ga0495631_0000868_6784_8337 511
260 3300046660 Ga0495625_0000056 Ga0495625_0000056_36080_37636 511
261 3300046660 Ga0495625_0010075 Ga0495625_0010075_2634_4187 511
262 3300046660 Ga0495625_0051963 Ga0495625_0051963_330_1889 511
263 3300046665 Ga0495661_0073007 Ga0495661_0073007_296_1861 511
264 3300046683 Ga0495658_0003181 Ga0495658_0003181_2793_4346 511
265 3300046809 Ga0495600_0090006 Ga0495600_0090006_412_1977 511
266 3300047315 Ga0495581_0031550 Ga0495581_0031550_199_1758 511
267 3300047321 Ga0495676_0022799 Ga0495676_0022799_381_1934 511
268 3300047445 Ga0495677_0003672 Ga0495677_0003672_885_2450 511
269 3300047673 Ga0495593_0004560 Ga0495593_0004560_4536_6089 511
270 3300048089 Ga0495614_0000897 Ga0495614_0000897_3820_5373 511
271 3300048919 Ga0496116_0076309 Ga0496116_0076309_500_2062 511
272 3300048925 Ga0496122_0000320 Ga0496122_0000320_63384_64946 511
273 3300048926 Ga0496123_0000258 Ga0496123_0000258_46868_48430 511
274 3300048927 Ga0496124_0000004 Ga0496124_0000004_515175_516728 511
275 3300049576 Ga0501040_0003458 Ga0501040_0003458_5366_6952 511
276 3300049578 Ga0501042_0008302 Ga0501042_0008302_2118_3704 511
277 3300049580 Ga0501046_0004871 Ga0501046_0004871_6462_8048 511
278 3300049581 Ga0501047_0024675 Ga0501047_0024675_544_2130 511
279 3300049582 Ga0501048_0020059 Ga0501048_0020059_894_2480 511
280 3300049584 Ga0501068_0055622 Ga0501068_0055622_794_2380 511
281 3300049587 Ga0501071_0097724 Ga0501071_0097724_370_1956 511
282 3300049592 Ga0501076_0005192 Ga0501076_0005192_2341_3927 511
283 3300049741 Ga0501079_0009225 Ga0501079_0009225_2684_4270 511
284 3300049742 Ga0501080_0026075 Ga0501080_0026075_596_2182 511
285 3300049743 Ga0501081_0004213 Ga0501081_0004213_5529_7115 511
286 3300049744 Ga0501083_0010370 Ga0501083_0010370_2972_4558 511
287 3300049822 Ga0501035_0131541 Ga0501035_0131541_384_1970 511
288 3300049824 Ga0501045_0002044 Ga0501045_0002044_3987_5573 511
289 3300050491 nmdc:mga00v17_10501_c1 nmdc:mga00v17_10501_c1_275_1828 511
290 3300050493 nmdc:mga0k408_22906_c1 nmdc:mga0k408_22906_c1_1876_3429 511
291 3300050507 nmdc:mga05p37_25458_c1 nmdc:mga05p37_25458_c1_1559_3136 511
292 3300053087 Ga0500643_000580 Ga0500643_000580_21011_22576 511
293 3300053087 Ga0500643_000652 Ga0500643_000652_13539_15101 511
294 3300053093 Ga0500651_0000421 Ga0500651_0000421_10231_11784 511
295 3300053094 Ga0500566_0000252 Ga0500566_0000252_26670_28232 511
296 3300053104 Ga0500556_0012645 Ga0500556_0012645_340_1902 511
297 3300053110 Ga0500571_000100 Ga0500571_000100_4375_5928 511
298 3300053118 Ga0500594_0000921 Ga0500594_0000921_205_1758 511
299 3300053119 Ga0500595_000094 Ga0500595_000094_56749_58314 511
300 3300053121 Ga0500607_038644 Ga0500607_038644_656_2209 511
301 3300053122 Ga0500608_000998 Ga0500608_000998_7123_8676 511
302 3300053133 Ga0500655_000626 Ga0500655_000626_4372_5925 511
303 3300053134 Ga0500658_0000101 Ga0500658_0000101_12742_14295 511
304 3300053134 Ga0500658_0000387 Ga0500658_0000387_4375_5928 511
305 3300053136 Ga0500559_0001441 Ga0500559_0001441_3029_4591 511
306 3300053139 Ga0500568_0000687 Ga0500568_0000687_10112_11665 511
307 3300053141 Ga0500574_000129 Ga0500574_000129_2430_3983 511
308 3300053153 Ga0500616_0004246 Ga0500616_0004246_4222_5775 511
309 3300053154 Ga0500619_002857 Ga0500619_002857_1817_3370 511
310 3300053162 Ga0500638_000233 Ga0500638_000233_5939_7492 511
311 3300053177 Ga0500636_0000577 Ga0500636_0000577_11757_13322 511
312 3300053177 Ga0500636_0012498 Ga0500636_0012498_1153_2706 511
313 3300053729 Ga0500625_033858 Ga0500625_033858_251_1804 511
314 3300054114 Ga0501084_0012940 Ga0501084_0012940_2132_3718 511
315 3300060353 Ga0501082_0004058 Ga0501082_0004058_6866_8452 511
316 3300061734 Ga0530510_0157265 Ga0530510_0157265_11_1612 511
317 iso_pu_bacteria 2928084124 2928088060 511
318 3300005334 Ga0068869_100001973 Ga0068869_1000019736 512
319 3300005347 Ga0070668_100061260 Ga0070668_1000612601 512
320 3300005347 Ga0070668_100068474 Ga0070668_1000684742 512
321 3300005367 Ga0070667_100013281 Ga0070667_1000132815 512
322 3300005456 Ga0070678_100135083 Ga0070678_1001350831 512
323 3300005459 Ga0068867_100004056 Ga0068867_1000040565 512
324 3300005518 Ga0070699_100028367 Ga0070699_1000283672 512
325 3300005543 Ga0070672_100024798 Ga0070672_1000247984 512
326 3300005577 Ga0068857_100014395 Ga0068857_1000143954 512
327 3300005618 Ga0068864_100001289 Ga0068864_1000012895 512
328 3300005719 Ga0068861_100002113 Ga0068861_1000021138 512
329 3300005843 Ga0068860_100020556 Ga0068860_1000205564 512
330 3300006042 Ga0075368_10001040 Ga0075368_100010407 512
331 3300006048 Ga0075363_100001321 Ga0075363_1000013217 512
332 3300006178 Ga0075367_10002318 Ga0075367_100023184 512
333 3300006178 Ga0075367_10011651 Ga0075367_100116512 512
334 3300006195 Ga0075366_10003763 Ga0075366_100037635 512
335 3300006358 Ga0068871_100031561 Ga0068871_1000315615 512
336 3300006847 Ga0075431_100064241 Ga0075431_1000642412 512
337 3300006852 Ga0075433_10028729 Ga0075433_100287292 512
338 3300006946 Ga0079104_1004965 Ga0079104_10049652 512
339 3300007265 Ga0099794_10018682 Ga0099794_100186822 512
340 3300009093 Ga0105240_10017110 Ga0105240_100171103 512
341 3300009148 Ga0105243_10104315 Ga0105243_101043152 512
342 3300009177 Ga0105248_10017466 Ga0105248_100174662 512
343 3300009545 Ga0105237_10003478 Ga0105237_1000347812 512
344 3300010375 Ga0105239_10012299 Ga0105239_100122994 512
345 3300013306 Ga0163162_10031403 Ga0163162_100314033 512
346 3300013308 Ga0157375_10320675 Ga0157375_103206751 512
347 3300014497 Ga0182008_10003506 Ga0182008_100035065 512
348 3300015683 Ga0183362_10018 Ga0183362_100187 512
349 3300017792 Ga0163161_10019607 Ga0163161_100196074 512
350 3300025292 Ga0209676_1006404 Ga0209676_10064045 512
351 3300025298 Ga0209050_1000426 Ga0209050_100042683 512
352 3300025298 Ga0209050_1016927 Ga0209050_10169273 512
353 3300025907 Ga0207645_10112306 Ga0207645_101123061 512
354 3300025913 Ga0207695_10015402 Ga0207695_100154023 512
355 3300025940 Ga0207691_10022418 Ga0207691_100224185 512
356 3300025942 Ga0207689_10004497 Ga0207689_100044976 512
357 3300025972 Ga0207668_10018443 Ga0207668_100184432 512
358 3300026035 Ga0207703_10121567 Ga0207703_101215672 512
359 3300026067 Ga0207678_10033033 Ga0207678_100330333 512
360 3300026089 Ga0207648_10006061 Ga0207648_100060615 512
361 3300026116 Ga0207674_10019104 Ga0207674_100191044 512
362 3300026118 Ga0207675_100000828 Ga0207675_10000082817 512
363 3300027866 Ga0209813_10000031 Ga0209813_100000319 512
364 3300028381 Ga0268264_10006914 Ga0268264_100069148 512
365 3300028573 Ga0265334_10000075 Ga0265334_1000007533 512
366 3300028786 Ga0307517_10075836 Ga0307517_100758362 512
367 3300028794 Ga0307515_10086521 Ga0307515_100865213 512
368 3300030521 Ga0307511_10000019 Ga0307511_1000001943 512
369 3300030521 Ga0307511_10000581 Ga0307511_1000058117 512
370 3300030521 Ga0307511_10008856 Ga0307511_100088568 512
371 3300031251 Ga0265327_10000773 Ga0265327_1000077343 512
372 3300031456 Ga0307513_10019069 Ga0307513_100190692 512
373 3300031507 Ga0307509_10000224 Ga0307509_1000022465 512
374 3300031730 Ga0307516_10000258 Ga0307516_1000025827 512
375 3300031911 Ga0307412_10000086 Ga0307412_100000867 512
376 3300033180 Ga0307510_10000001 Ga0307510_1000000164 512
377 3300035691 Ga0373931_0012328 Ga0373931_0012328_408_1973 512
378 3300035691 Ga0373931_0094593 Ga0373931_0094593_75_1658 512
379 3300045051 Ga0451576_0260407 Ga0451576_0260407_23_1579 512
380 3300046460 Ga0495638_0000021 Ga0495638_0000021_82619_84184 512
381 3300046460 Ga0495638_0000079 Ga0495638_0000079_4780_6348 512
382 3300046460 Ga0495638_0005402 Ga0495638_0005402_5482_7050 512
383 3300046460 Ga0495638_0034502 Ga0495638_0034502_108_1667 512
384 3300046471 Ga0495650_0005782 Ga0495650_0005782_2156_3727 512
385 3300046472 Ga0495580_0003863 Ga0495580_0003863_2512_4077 512
386 3300046500 Ga0495596_0000081 Ga0495596_0000081_59709_61295 512
387 3300046500 Ga0495596_0009256 Ga0495596_0009256_2626_4215 512
388 3300046506 Ga0495583_0000332 Ga0495583_0000332_15409_16974 512
389 3300046507 Ga0495606_0024030 Ga0495606_0024030_1655_3241 512
390 3300046512 Ga0495610_0000406 Ga0495610_0000406_20808_22406 512
391 3300046512 Ga0495610_0002077 Ga0495610_0002077_4909_6498 512
392 3300046519 Ga0495632_0000659 Ga0495632_0000659_12890_14455 512
393 3300046522 Ga0495643_0000201 Ga0495643_0000201_54842_56509 512
394 3300046522 Ga0495643_0046332 Ga0495643_0046332_328_1914 512
395 3300046524 Ga0495648_0000026 Ga0495648_0000026_82591_84156 512
396 3300046528 Ga0495642_0014089 Ga0495642_0014089_798_2363 512
397 3300046615 Ga0495656_0028465 Ga0495656_0028465_118_1674 512
398 3300046660 Ga0495625_0000011 Ga0495625_0000011_254395_255963 512
399 3300046660 Ga0495625_0000078 Ga0495625_0000078_154947_156512 512
400 3300046660 Ga0495625_0026013 Ga0495625_0026013_128_1696 512
401 3300046660 Ga0495625_0033417 Ga0495625_0033417_1518_3104 512
402 3300046674 Ga0495588_0010751 Ga0495588_0010751_2519_4075 512
403 3300046684 Ga0495669_0019298 Ga0495669_0019298_852_2417 512
404 3300046692 Ga0495671_0000050 Ga0495671_0000050_57754_59319 512
405 3300047469 Ga0495673_0000125 Ga0495673_0000125_82619_84184 512
406 3300048090 Ga0495615_0000016 Ga0495615_0000016_12152_13738 512
407 3300048904 Ga0496101_0001086 Ga0496101_0001086_8044_9600 512
408 3300048904 Ga0496101_0006666 Ga0496101_0006666_4104_5660 512
409 3300048904 Ga0496101_0180000 Ga0496101_0180000_25_1611 512
410 3300048907 Ga0496104_0005610 Ga0496104_0005610_31_1587 512
411 3300048908 Ga0496105_0001424 Ga0496105_0001424_10729_12285 512
412 3300048909 Ga0496106_0058628 Ga0496106_0058628_264_1940 512
413 3300048913 Ga0496110_0002674 Ga0496110_0002674_6922_8478 512
414 3300048917 Ga0496114_0057672 Ga0496114_0057672_49_1605 512
415 3300048919 Ga0496116_0000062 Ga0496116_0000062_31915_33492 512
416 3300048919 Ga0496116_0013297 Ga0496116_0013297_3488_5074 512
417 3300048922 Ga0496119_0004488 Ga0496119_0004488_5026_6933 512
418 3300048924 Ga0496121_0008786 Ga0496121_0008786_7025_8614 512
419 3300048925 Ga0496122_0000102 Ga0496122_0000102_6255_8162 512
420 3300048925 Ga0496122_0006981 Ga0496122_0006981_88_1674 512
421 3300048925 Ga0496122_0016785 Ga0496122_0016785_4858_6435 512
422 3300048925 Ga0496122_0073445 Ga0496122_0073445_619_2205 512
423 3300048926 Ga0496123_0000428 Ga0496123_0000428_14404_15981 512
424 3300048926 Ga0496123_0000742 Ga0496123_0000742_6255_8162 512
425 3300048926 Ga0496123_0001578 Ga0496123_0001578_4764_6350 512
426 3300048927 Ga0496124_0097777 Ga0496124_0097777_705_2282 512
427 3300048928 Ga0496125_0000023 Ga0496125_0000023_317171_319078 512
428 3300048928 Ga0496125_0001120 Ga0496125_0001120_3500_5089 512
429 3300048929 Ga0496126_0024322 Ga0496126_0024322_1742_3649 512
430 3300049581 Ga0501047_0151594 Ga0501047_0151594_490_2052 512
431 3300049586 Ga0501070_0012720 Ga0501070_0012720_4023_5585 512
432 3300049679 Ga0501249_000139 Ga0501249_000139_7264_8829 512
433 3300049742 Ga0501080_0036734 Ga0501080_0036734_845_2404 512
434 3300049822 Ga0501035_0000469 Ga0501035_0000469_33899_35524 512
435 3300049823 Ga0501044_0000424 Ga0501044_0000424_12740_14302 512
436 3300049823 Ga0501044_0060995 Ga0501044_0060995_1189_2748 512
437 3300049823 Ga0501044_0066840 Ga0501044_0066840_1526_3088 512
438 3300050494 nmdc:mga06z11_2850_c1 nmdc:mga06z11_2850_c1_4546_6108 512
439 3300050494 nmdc:mga06z11_81_c1 nmdc:mga06z11_81_c1_33605_35173 512
440 3300050495 nmdc:mga04h51_54_c1 nmdc:mga04h51_54_c1_10398_11966 512
441 3300050509 nmdc:mga0qj67_19184_c1 nmdc:mga0qj67_19184_c1_3254_4819 512
442 3300050510 nmdc:mga06r32_60315_c1 nmdc:mga06r32_60315_c1_1466_3046 512
443 3300053115 Ga0500591_020931 Ga0500591_020931_260_1822 512
444 3300053119 Ga0500595_016596 Ga0500595_016596_420_1994 512
445 3300053146 Ga0500588_0008667 Ga0500588_0008667_74_1630 512
446 3300053156 Ga0500622_0001137 Ga0500622_0001137_9008_10582 512
447 3300053157 Ga0500624_000066 Ga0500624_000066_52999_54609 512
448 iso_pu_bacteria 2510917021 2511129681 512
449 iso_pu_bacteria 2919709256 2919713018 512
450 iso_pu_bacteria 8054302542 8054303901 512
451 3300003203 JGI25406J46586_10018638 JGI25406J46586_100186382 513
452 3300005467 Ga0070706_100124897 Ga0070706_1001248971 513
453 3300005468 Ga0070707_100050930 Ga0070707_1000509301 513
454 3300005471 Ga0070698_100008141 Ga0070698_1000081412 513
455 3300005536 Ga0070697_100013484 Ga0070697_1000134842 513
456 3300005985 Ga0081539_10000021 Ga0081539_1000002178 513
457 3300006871 Ga0075434_100015254 Ga0075434_1000152544 513
458 3300006880 Ga0075429_100136854 Ga0075429_1001368542 513
459 3300006914 Ga0075436_100124817 Ga0075436_1001248172 513
460 3300007076 Ga0075435_100022819 Ga0075435_1000228194 513
461 3300025910 Ga0207684_10001912 Ga0207684_1000191214 513
462 3300025922 Ga0207646_10005958 Ga0207646_100059582 513
463 3300050508 nmdc:mga09592_204737_c1 nmdc:mga09592_204737_c1_55_1596 513
464 3300050508 nmdc:mga09592_29217_c1 nmdc:mga09592_29217_c1_858_2426 513
465 3300050513 nmdc:mga0rr50_15863_c1 nmdc:mga0rr50_15863_c1_607_2166 513

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

532

608

0.96

PF00501

AMP-binding

AMP-binding enzyme

147

499

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u5y-assembly1.cif.gz_D crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.9279 420 504
8u2r-assembly1.cif.gz_A crystal structure of acetyl-coenzyme a synthetase from leishmania infantum (ethyl amp bound) 0.9132 32 504
3etc-assembly2.cif.gz_A 2.1 a structure of acyl-adenylate synthetase from methanosarcina acetivorans containing a link between lys256 and cys298 0.91 31 489
1pg4-assembly1.cif.gz_A acetyl coa synthetase, salmonella enterica 0.9064 32 503
2p2b-assembly1.cif.gz_A acetyl-coa synthetase, v386a mutation 0.9035 32 503
ID Description Score Start End Superfamily
3etcA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9679 408 489 3.30.300.30
af_Q2G294_455_568_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9602 409 505 3.30.300.30
af_O05295_375_473_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9482 409 503 3.30.300.30
af_P27550_518_652_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9452 409 504 3.30.300.30
af_O16481_410_514_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9325 408 506 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A260MX46-F1-model_v4 Acetyl-coenzyme A synthetase 0.9523 33 139 GO:0003987
GO:0005829
GO:0006085
AF-E9IYB4-F1-model_v4 deleted 0.9475 60 139
AF-A0A2D9F669-F1-model_v4 AMP-binding enzyme C-terminal domain-containing protein 0.9187 411 506 GO:0006631
GO:0031956
AF-K1XCL9-F1-model_v4 Acetyl-CoA synthetase 0.9166 9 222 GO:0003987
GO:0005829
GO:0006085
GO:0016020
AF-A0A377B161-F1-model_v4 Propionate--coA ligase (EC 6.2.1.1, EC 6.2.1.17) 0.9136 34 139 GO:0003987
GO:0050218

Feature Viewer

pLDDT pTM Quality
87.83 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map