F449320

General Info

Members Datasets Scaffolds Average Seq Length
464 226 928 397

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10093270|Ga0265313_100932701
Length 416
Sequence MGSIAVQCLCIKGDGRMAKQKFERNKPHLNVGTMGHIDHGKTTLTAAITKVSQLLGKAEFKAYDQIDNAPEEKARGITINIAHVEYETDKRHYAHVDMPGHRDYIKNMITGAAQVDGAILVVAAPDGPMPQTHEHVLLARQVEVPSIVVYLNKTDMMDDPELLELVELELRELLTKQGFPGDTTPIVRGSAKQALDSTSKDPNAPEYASIRELLRVIDEYIPEPKRDIEKPFMMSVEDVFSIKGRGTVVTGRVDRGRIKIGEPVEIIGLHEKNTSSVVTGVEMFHKQLDEGMAGDNLGLLLRGIERTDVERGQVIAKPGSITPHKKFLAQVYVLKKEEGGRHKAFFNGYRPQFYIRTMDVTGNITLPEGVEMVMPGDDVNLSVELIVPVALEQGSKFAIREGGLTVGAGVVTKIEK

Samples

Sample ID Description Type Environment
1 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
154 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
155 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
156 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
157 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 9.48
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 2.37
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265313_10093270 3300031595 Bacteria 1347
2 CNXas_1000074 3300000545 Bacteria 18734
3 JGI25406J46586_10000367 3300003203 Bacteria 20597
4 JGI25407J50210_10000496 3300003373 Bacteria 7874
5 Ga0058861_12072519 3300004800 Bacteria 2876
6 Ga0058862_10058516 3300004803 Bacteria 2118
7 Ga0065704_10071821 3300005289 Bacteria 9838
8 Ga0065704_10115502 3300005289 Bacteria 1871
9 Ga0065712_10091824 3300005290 Bacteria 2354
10 Ga0065707_10000538 3300005295 Bacteria 42818
11 Ga0065707_10005283 3300005295 Bacteria 6062
12 Ga0065707_10006372 3300005295 Bacteria 5046
13 Ga0065707_10095528 3300005295 Bacteria 3369
14 Ga0065707_10166376 3300005295 Bacteria 1519
15 Ga0065707_10172671 3300005295 Bacteria 1473
16 Ga0070658_10002296 3300005327 Bacteria 16040
17 Ga0070683_100035139 3300005329 Bacteria 4581
18 Ga0068869_100160534 3300005334 Bacteria 1750
19 Ga0070680_100099873 3300005336 Bacteria 2408
20 Ga0070661_100041243 3300005344 Bacteria 3368
21 Ga0070674_100011938 3300005356 Bacteria 5312
22 Ga0070659_100023306 3300005366 Bacteria 4736
23 Ga0070667_100150136 3300005367 Bacteria 2046
24 Ga0070703_10040526 3300005406 Bacteria 1449
25 Ga0070705_100004040 3300005440 Bacteria 7167
26 Ga0070705_100095952 3300005440 Bacteria 1860
27 Ga0070694_100079416 3300005444 Bacteria 2277
28 Ga0070708_100030326 3300005445 Bacteria 4674
29 Ga0070708_100196691 3300005445 Bacteria 1886
30 Ga0070662_100101254 3300005457 Bacteria 2180
31 Ga0070706_100055724 3300005467 Bacteria 3649
32 Ga0070706_100148991 3300005467 Bacteria 2184
33 Ga0070706_100157985 3300005467 Bacteria 2117
34 Ga0070707_100007728 3300005468 Bacteria 9989
35 Ga0070707_100107665 3300005468 Bacteria 2704
36 Ga0070698_100049206 3300005471 Bacteria 4304
37 Ga0070698_100080296 3300005471 Bacteria 3256
38 Ga0070699_100006210 3300005518 Bacteria 10429
39 Ga0070699_100052031 3300005518 Bacteria 3546
40 Ga0070684_100000110 3300005535 Bacteria 53697
41 Ga0070697_100084259 3300005536 Bacteria 2622
42 Ga0070665_100192770 3300005548 Bacteria 2038
43 Ga0070704_100000748 3300005549 Bacteria 15972
44 Ga0070664_100101943 3300005564 Bacteria 2497
45 Ga0068857_100093997 3300005577 Bacteria 2684
46 Ga0068854_100209452 3300005578 Bacteria 1537
47 Ga0068856_100151383 3300005614 Bacteria 2329
48 Ga0070702_100179957 3300005615 Bacteria 1382
49 Ga0068859_100083672 3300005617 Bacteria 3234
50 Ga0068864_100146126 3300005618 Bacteria 2138
51 Ga0068863_100051874 3300005841 Bacteria 3887
52 Ga0068863_100140120 3300005841 Bacteria 2311
53 Ga0068860_100003526 3300005843 Bacteria 16089
54 Ga0068860_100069468 3300005843 Bacteria 3348
55 Ga0068862_100004463 3300005844 Bacteria 11802
56 Ga0081455_10003653 3300005937 Bacteria 17623
57 Ga0081455_10017674 3300005937 Bacteria 6824
58 Ga0081538_10000037 3300005981 Bacteria 119828
59 Ga0081538_10000458 3300005981 Bacteria 45661
60 Ga0081538_10021020 3300005981 Bacteria 4784
61 Ga0081540_1011953 3300005983 Bacteria 5759
62 Ga0081539_10000671 3300005985 Bacteria 68678
63 Ga0075364_10005793 3300006051 Bacteria 7207
64 Ga0070712_100062821 3300006175 Bacteria 2627
65 Ga0075362_10058867 3300006177 Bacteria 1734
66 Ga0075428_100080048 3300006844 Bacteria 3565
67 Ga0075430_100092384 3300006846 Bacteria 2530
68 Ga0075431_100026658 3300006847 Bacteria 5928
69 Ga0075433_10049399 3300006852 Bacteria 3659
70 Ga0075429_100075089 3300006880 Bacteria 2944
71 Ga0075429_100081291 3300006880 Bacteria 2825
72 Ga0075429_100099567 3300006880 Bacteria 2536
73 Ga0075436_100120235 3300006914 Bacteria 1837
74 Ga0075436_100197972 3300006914 Bacteria 1422
75 Ga0097620_100083667 3300006931 Bacteria 3234
76 Ga0075435_100078235 3300007076 Bacteria 2712
77 Ga0105251_10076649 3300009011 Bacteria 1551
78 Ga0111539_10151332 3300009094 Bacteria 2716
79 Ga0111539_10340670 3300009094 Bacteria 1745
80 Ga0105245_10053320 3300009098 Bacteria 3630
81 Ga0114129_10038622 3300009147 Bacteria 6733
82 Ga0114129_10122580 3300009147 Bacteria 3577
83 Ga0114129_10186278 3300009147 Bacteria 2821
84 Ga0114129_10638680 3300009147 Bacteria 1375
85 Ga0105242_10163177 3300009176 Bacteria 1952
86 Ga0105248_10057194 3300009177 Bacteria 4377
87 Ga0105237_10008233 3300009545 Bacteria 11320
88 Ga0105249_10032780 3300009553 Bacteria 4701
89 Ga0105249_10432596 3300009553 Bacteria 1352
90 Ga0105246_10058508 3300011119 Bacteria 2670
91 Ga0157378_10099678 3300013297 Bacteria 2651
92 Ga0163162_10253568 3300013306 Bacteria 1891
93 Ga0157372_10198086 3300013307 Bacteria 2326
94 Ga0157375_10100196 3300013308 Bacteria 2977
95 Ga0157380_10090631 3300014326 Bacteria 2523
96 Ga0157377_10001754 3300014745 Bacteria 9448
97 Ga0157379_10004406 3300014968 Bacteria 12063
98 Ga0157376_10052518 3300014969 Bacteria 3390
99 Ga0213872_10000653 3300021361 Bacteria 26296
100 Ga0213872_10010225 3300021361 Bacteria 4472
101 Ga0213875_10009950 3300021388 Bacteria 4790
102 Ga0207697_10000803 3300025315 Bacteria 17826
103 Ga0207653_10014997 3300025885 Bacteria 2432
104 Ga0207647_10002251 3300025904 Bacteria 14706
105 Ga0207643_10069945 3300025908 Bacteria 2018
106 Ga0207705_10004133 3300025909 Bacteria 11007
107 Ga0207684_10053006 3300025910 Bacteria 3444
108 Ga0207684_10053102 3300025910 Bacteria 3440
109 Ga0207671_10015682 3300025914 Bacteria 5923
110 Ga0207662_10135836 3300025918 Bacteria 1554
111 Ga0207657_10067061 3300025919 Bacteria 3053
112 Ga0207657_10146122 3300025919 Bacteria 1928
113 Ga0207646_10053083 3300025922 Bacteria 3626
114 Ga0207646_10080967 3300025922 Bacteria 2903
115 Ga0207659_10165402 3300025926 Bacteria 1741
116 Ga0207687_10102350 3300025927 Bacteria 2110
117 Ga0207686_10033973 3300025934 Bacteria 3049
118 Ga0207686_10166760 3300025934 Bacteria 1549
119 Ga0207709_10086564 3300025935 Bacteria 2035
120 Ga0207670_10050340 3300025936 Bacteria 2791
121 Ga0207670_10243742 3300025936 Bacteria 1386
122 Ga0207669_10018866 3300025937 Bacteria 3578
123 Ga0207665_10239642 3300025939 Bacteria 1336
124 Ga0207711_10233874 3300025941 Bacteria 1684
125 Ga0207679_10324427 3300025945 Bacteria 1334
126 Ga0207712_10062246 3300025961 Bacteria 2652
127 Ga0207703_10005743 3300026035 Bacteria 9940
128 Ga0207703_10293877 3300026035 Bacteria 1479
129 Ga0207678_10207164 3300026067 Bacteria 1677
130 Ga0207708_10006509 3300026075 Bacteria 8649
131 Ga0207708_10070438 3300026075 Bacteria 2677
132 Ga0207702_10181041 3300026078 Bacteria 1941
133 Ga0207641_10313194 3300026088 Bacteria 1486
134 Ga0207676_10280156 3300026095 Bacteria 1513
135 Ga0207675_100207816 3300026118 Bacteria 1882
136 Ga0207675_100293891 3300026118 Bacteria 1581
137 Ga0207683_10144158 3300026121 Bacteria 2147
138 Ga0207698_10064708 3300026142 Bacteria 2868
139 Ga0209981_1007757 3300027378 Bacteria 1452
140 Ga0207428_10033464 3300027907 Bacteria 4221
141 Ga0268264_10113795 3300028381 Bacteria 2374
142 Ga0268264_10432010 3300028381 Bacteria 1272
143 Ga0265326_10013834 3300028558 Bacteria 2355
144 Ga0265334_10021402 3300028573 Bacteria 2641
145 Ga0265334_10023402 3300028573 Bacteria 2511
146 Ga0265324_10018640 3300029957 Bacteria 2507
147 Ga0265330_10006275 3300031235 Bacteria 5877
148 Ga0265320_10022503 3300031240 Bacteria 3370
149 Ga0265320_10036818 3300031240 Bacteria 2470
150 Ga0265339_10052865 3300031249 Bacteria 2211
151 Ga0265331_10006301 3300031250 Bacteria 7026
152 Ga0265331_10113559 3300031250 Bacteria 1241
153 Ga0265327_10018681 3300031251 Bacteria 4288
154 Ga0265316_10076258 3300031344 Bacteria 2576
155 Ga0307513_10029552 3300031456 Bacteria 6246
156 Ga0316575_10007199 3300031665 Bacteria 4026
157 Ga0316575_10011582 3300031665 Bacteria 3266
158 Ga0316575_10036799 3300031665 Bacteria 1926
159 Ga0316575_10055232 3300031665 Bacteria 1581
160 Ga0316575_10080340 3300031665 Bacteria 1315
161 Ga0316579_10001474 3300031691 Bacteria 8550
162 Ga0316579_10004574 3300031691 Bacteria 5505
163 Ga0316579_10008867 3300031691 Bacteria 4210
164 Ga0316579_10024805 3300031691 Bacteria 2702
165 Ga0316579_10066668 3300031691 Bacteria 1700
166 Ga0316576_10017915 3300031727 Bacteria 4825
167 Ga0316576_10020188 3300031727 Bacteria 4578
168 Ga0316576_10089589 3300031727 Bacteria 2291
169 Ga0316576_10103742 3300031727 Bacteria 2127
170 Ga0316576_10144740 3300031727 Bacteria 1790
171 Ga0316576_10274545 3300031727 Bacteria 1263
172 Ga0316578_10003853 3300031728 Bacteria 6959
173 Ga0316578_10008090 3300031728 Bacteria 5323
174 Ga0316578_10015639 3300031728 Bacteria 4084
175 Ga0316578_10051684 3300031728 Bacteria 2407
176 Ga0316578_10060051 3300031728 Bacteria 2237
177 Ga0316578_10083171 3300031728 Bacteria 1906
178 Ga0316578_10128929 3300031728 Bacteria 1521
179 Ga0316577_10000214 3300031733 Bacteria 19741
180 Ga0316577_10014391 3300031733 Bacteria 4342
181 Ga0316577_10071393 3300031733 Bacteria 1937
182 Ga0316577_10086869 3300031733 Bacteria 1750
183 Ga0316577_10092397 3300031733 Bacteria 1694
184 Ga0316577_10121678 3300031733 Bacteria 1467
185 Ga0307410_10223972 3300031852 Bacteria 1448
186 Ga0307409_100299139 3300031995 Bacteria 1496
187 Ga0307409_100401011 3300031995 Bacteria 1310
188 Ga0307416_100088559 3300032002 Bacteria 2647
189 Ga0307411_10169616 3300032005 Bacteria 1644
190 Ga0316583_10012488 3300032133 Bacteria 3065
191 Ga0316585_10011594 3300032137 Bacteria 2602
192 Ga0316585_10019494 3300032137 Bacteria 2068
193 Ga0316585_10037136 3300032137 Bacteria 1546
194 Ga0316585_10050971 3300032137 Bacteria 1329
195 Ga0316585_10072586 3300032137 Bacteria 1118
196 Ga0316580_10012403 3300032139 Bacteria 2597
197 Ga0316593_10000242 3300032168 Bacteria 8872
198 Ga0316593_10002635 3300032168 Bacteria 4302
199 Ga0316593_10003331 3300032168 Bacteria 3970
200 Ga0316593_10010813 3300032168 Bacteria 2633
201 Ga0316593_10022518 3300032168 Bacteria 1980
202 Ga0316593_10022763 3300032168 Bacteria 1971
203 Ga0316593_10029131 3300032168 Bacteria 1784
204 Ga0316593_10030774 3300032168 Bacteria 1745
205 Ga0316593_10045663 3300032168 Bacteria 1468
206 Ga0316593_10058534 3300032168 Bacteria 1314
207 Ga0316592_1000292 3300033524 Bacteria 6379
208 Ga0316592_1000535 3300033524 Bacteria 5370
209 Ga0316592_1001923 3300033524 Bacteria 3495
210 Ga0316592_1003566 3300033524 Bacteria 2818
211 Ga0316592_1004293 3300033524 Bacteria 2640
212 Ga0316592_1009501 3300033524 Bacteria 1948
213 Ga0316592_1009703 3300033524 Bacteria 1930
214 Ga0316592_1012112 3300033524 Bacteria 1763
215 Ga0316592_1012361 3300033524 Bacteria 1748
216 Ga0316592_1015372 3300033524 Bacteria 1594
217 Ga0316586_1004198 3300033527 Bacteria 1950
218 Ga0316586_1006371 3300033527 Bacteria 1693
219 Ga0316586_1007070 3300033527 Bacteria 1628
220 Ga0316587_1009242 3300033529 Bacteria 1561
221 Ga0316596_1001769 3300033541 Bacteria 4486
222 Ga0316596_1001921 3300033541 Bacteria 4354
223 Ga0316596_1002564 3300033541 Bacteria 3891
224 Ga0316596_1004622 3300033541 Bacteria 3102
225 Ga0316596_1004986 3300033541 Bacteria 3009
226 Ga0316596_1005984 3300033541 Bacteria 2806
227 Ga0316596_1011942 3300033541 Bacteria 2130
228 Ga0316596_1012020 3300033541 Bacteria 2124
229 Ga0316596_1012727 3300033541 Bacteria 2072
230 Ga0316596_1017252 3300033541 Bacteria 1814
231 Ga0316596_1019766 3300033541 Bacteria 1710
232 Ga0316596_1021957 3300033541 Bacteria 1629
233 Ga0316596_1025319 3300033541 Bacteria 1526
234 Ga0316596_1025516 3300033541 Bacteria 1521
235 Ga0316596_1026403 3300033541 Bacteria 1497
236 Ga0316596_1027561 3300033541 Bacteria 1466
237 Ga0316596_1028500 3300033541 Bacteria 1443
238 Ga0316596_1034539 3300033541 Bacteria 1320
239 Ga0373948_0006985 3300034817 Bacteria 1885
240 Ga0373950_0003827 3300034818 Bacteria 2181
241 Ga0373926_0027202 3300035083 Bacteria 2003
242 Ga0373949_0013324 3300035090 Bacteria 1821
243 Ga0373932_0033726 3300035112 Bacteria 1439
244 Ga0373962_0015757 3300035242 Bacteria 1942
245 Ga0316574_0000443 3300035398 Bacteria 16514
246 Ga0316574_0003387 3300035398 Bacteria 8207
247 Ga0316574_0108791 3300035398 Bacteria 1776
248 Ga0373927_0096032 3300035695 Bacteria 1926
249 Ga0373933_0184101 3300035724 Bacteria 1333
250 Ga0373947_0041297 3300035725 Bacteria 2750
251 Ga0373937_0128775 3300036401 Bacteria 2363
252 Ga0316582_0007265 3300036647 Bacteria 5890
253 Ga0316582_0015629 3300036647 Bacteria 4347
254 Ga0316582_0019018 3300036647 Bacteria 4012
255 Ga0316582_0046464 3300036647 Bacteria 2737
256 Ga0316582_0050825 3300036647 Bacteria 2628
257 Ga0316582_0055586 3300036647 Bacteria 2523
258 Ga0316582_0074709 3300036647 Bacteria 2201
259 Ga0316582_0082785 3300036647 Bacteria 2098
260 Ga0316582_0088391 3300036647 Bacteria 2035
261 Ga0316582_0115556 3300036647 Bacteria 1791
262 Ga0316582_0159015 3300036647 Bacteria 1530
263 Ga0316582_0193675 3300036647 Bacteria 1385
264 Ga0316582_0201093 3300036647 Bacteria 1359
265 Ga0316584_0010222 3300036712 Bacteria 6552
266 Ga0316584_0033125 3300036712 Bacteria 3825
267 Ga0316584_0056212 3300036712 Bacteria 2946
268 Ga0316584_0058967 3300036712 Bacteria 2874
269 Ga0316584_0073357 3300036712 Bacteria 2565
270 Ga0316584_0074597 3300036712 Bacteria 2543
271 Ga0316584_0084344 3300036712 Bacteria 2380
272 Ga0316584_0133223 3300036712 Bacteria 1855
273 Ga0316584_0180801 3300036712 Bacteria 1561
274 Ga0316584_0211409 3300036712 Bacteria 1428
275 Ga0395899_0030497 3300037312 Bacteria 4055
276 Ga0395900_0011365 3300037418 Bacteria 9108
277 Ga0395898_0066169 3300037466 Bacteria 3502
278 Ga0395905_0019777 3300037471 Bacteria 6383
279 Ga0316581_0009833 3300037588 Bacteria 2638
280 Ga0316581_0016323 3300037588 Bacteria 2130
281 Ga0316581_0025673 3300037588 Bacteria 1753
282 Ga0316581_0032000 3300037588 Bacteria 1586
283 Ga0436364_1228372 3300037853 Bacteria 25658
284 Ga0400484_25283 3300038725 Bacteria 22222
285 Ga0400484_31592 3300038725 Bacteria 2182
286 Ga0400484_35517 3300038725 Bacteria 2082
287 Ga0400490_26208 3300038726 Bacteria 1604
288 Ga0400490_49731 3300038726 Bacteria 8030
289 Ga0400483_135165 3300039062 Bacteria 2310
290 Ga0400489_64154 3300039093 Bacteria 127676
291 Ga0400487_65380 3300039110 Bacteria 2097
292 Ga0436365_0292643 3300039437 Bacteria 6395
293 Ga0436365_1896641 3300039437 Bacteria 4371
294 Ga0436361_0212903 3300039447 Bacteria 3827
295 Ga0436361_0444714 3300039447 Bacteria 20038
296 Ga0439450_016634 3300042008 Bacteria 1523
297 Ga0451577_0011704 3300042876 Bacteria 8283
298 Ga0451577_0036920 3300042876 Bacteria 4399
299 Ga0451577_0050730 3300042876 Bacteria 3704
300 Ga0451577_0058965 3300042876 Bacteria 3423
301 Ga0451577_0072487 3300042876 Bacteria 3073
302 Ga0451577_0142643 3300042876 Bacteria 2153
303 Ga0451577_0152778 3300042876 Bacteria 2077
304 Ga0451577_0170486 3300042876 Bacteria 1961
305 Ga0451577_0188151 3300042876 Bacteria 1862
306 Ga0451577_0283558 3300042876 Bacteria 1501
307 Ga0439440_0003063 3300042993 Bacteria 3191
308 Ga0453683_0005001 3300044673 Bacteria 9312
309 Ga0453683_0009016 3300044673 Bacteria 6663
310 Ga0453683_0033895 3300044673 Bacteria 3220
311 Ga0453683_0034835 3300044673 Bacteria 3173
312 Ga0453683_0047637 3300044673 Bacteria 2688
313 Ga0453683_0080790 3300044673 Bacteria 2036
314 Ga0453684_0001835 3300044712 Bacteria 55524
315 Ga0453684_0002841 3300044712 Bacteria 40773
316 Ga0453684_0015826 3300044712 Bacteria 11859
317 Ga0453684_0016312 3300044712 Bacteria 11631
318 Ga0453684_0039071 3300044712 Bacteria 6473
319 Ga0453684_0040080 3300044712 Bacteria 6368
320 Ga0453684_0040272 3300044712 Bacteria 6350
321 Ga0453684_0047886 3300044712 Bacteria 5662
322 Ga0453684_0056484 3300044712 Bacteria 5092
323 Ga0453684_0056639 3300044712 Bacteria 5082
324 Ga0453684_0063966 3300044712 Bacteria 4702
325 Ga0453684_0083124 3300044712 Bacteria 3986
326 Ga0453684_0108156 3300044712 Bacteria 3385
327 Ga0453684_0111173 3300044712 Bacteria 3329
328 Ga0453684_0126547 3300044712 Bacteria 3074
329 Ga0453684_0131496 3300044712 Bacteria 3002
330 Ga0453684_0163504 3300044712 Bacteria 2630
331 Ga0453684_0177061 3300044712 Bacteria 2507
332 Ga0453684_0283429 3300044712 Bacteria 1889
333 Ga0453684_0286581 3300044712 Bacteria 1876
334 Ga0453684_0287924 3300044712 Bacteria 1871
335 Ga0453684_0303360 3300044712 Bacteria 1814
336 Ga0453684_0314872 3300044712 Bacteria 1774
337 Ga0453684_0353499 3300044712 Bacteria 1656
338 Ga0453684_0409758 3300044712 Bacteria 1516
339 Ga0453684_0547340 3300044712 Bacteria 1275
340 Ga0451576_0074509 3300045051 Bacteria 3532
341 Ga0451576_0089043 3300045051 Bacteria 3210
342 Ga0451576_0127284 3300045051 Bacteria 2654
343 Ga0451576_0174545 3300045051 Bacteria 2244
344 Ga0451576_0180993 3300045051 Bacteria 2201
345 Ga0495603_0131311 3300046455 Bacteria 1458
346 Ga0495580_0025084 3300046472 Bacteria 4358
347 Ga0495639_0115668 3300046475 Bacteria 1276
348 Ga0495628_0151849 3300046516 Bacteria 1764
349 Ga0495630_0126219 3300046517 Bacteria 1942
350 Ga0495632_0078529 3300046519 Bacteria 1577
351 Ga0495652_0244234 3300046529 Bacteria 1334
352 Ga0495658_0035258 3300046683 Bacteria 2751
353 Ga0495604_0185527 3300047317 Bacteria 1453
354 Ga0496101_0080548 3300048904 Bacteria 2406
355 Ga0496102_0097894 3300048905 Bacteria 2721
356 Ga0496106_0063614 3300048909 Bacteria 2805
357 Ga0496106_0238653 3300048909 Bacteria 1452
358 Ga0496108_0080301 3300048911 Bacteria 2762
359 Ga0496108_0311730 3300048911 Bacteria 1371
360 Ga0496109_0045331 3300048912 Bacteria 3989
361 Ga0496110_0031912 3300048913 Bacteria 4546
362 Ga0496111_0096024 3300048914 Bacteria 2175
363 Ga0496112_0380577 3300048915 Bacteria 1352
364 Ga0496113_0059402 3300048916 Bacteria 2880
365 Ga0501031_0239438 3300049568 Bacteria 1180
366 Ga0501032_0027283 3300049569 Bacteria 3925
367 Ga0501033_0002745 3300049570 Bacteria 14763
368 Ga0501036_0002699 3300049572 Bacteria 14009
369 Ga0501036_0053582 3300049572 Bacteria 3416
370 Ga0501036_0240005 3300049572 Bacteria 1520
371 Ga0501037_0047112 3300049573 Bacteria 3160
372 Ga0501037_0106584 3300049573 Bacteria 2020
373 Ga0501038_0059970 3300049574 Bacteria 3257
374 Ga0501038_0189825 3300049574 Bacteria 1654
375 Ga0501039_0004374 3300049575 Bacteria 10649
376 Ga0501039_0046684 3300049575 Bacteria 3347
377 Ga0501040_0092891 3300049576 Bacteria 2098
378 Ga0501041_0002629 3300049577 Bacteria 10246
379 Ga0501041_0088677 3300049577 Bacteria 1909
380 Ga0501041_0106439 3300049577 Bacteria 1738
381 Ga0501042_0004791 3300049578 Bacteria 8642
382 Ga0501042_0203825 3300049578 Bacteria 1426
383 Ga0501042_0320996 3300049578 Bacteria 1119
384 Ga0501043_0003806 3300049579 Bacteria 12410
385 Ga0501046_0145936 3300049580 Bacteria 1787
386 Ga0501048_0011486 3300049582 Bacteria 6604
387 Ga0501048_0161552 3300049582 Bacteria 1586
388 Ga0501067_0110072 3300049583 Bacteria 1531
389 Ga0501068_0000827 3300049584 Bacteria 16101
390 Ga0501071_0017899 3300049587 Bacteria 4898
391 Ga0501071_0067056 3300049587 Bacteria 2609
392 Ga0501071_0175429 3300049587 Bacteria 1605
393 Ga0501071_0177680 3300049587 Bacteria 1595
394 Ga0501071_0294239 3300049587 Bacteria 1230
395 Ga0501072_0030108 3300049588 Bacteria 4243
396 Ga0501072_0030730 3300049588 Bacteria 4201
397 Ga0501072_0044218 3300049588 Bacteria 3502
398 Ga0501073_0100436 3300049589 Bacteria 2009
399 Ga0501073_0117690 3300049589 Bacteria 1841
400 Ga0501073_0120944 3300049589 Bacteria 1815
401 Ga0501074_0006425 3300049590 Bacteria 8489
402 Ga0501074_0062215 3300049590 Bacteria 2688
403 Ga0501074_0161315 3300049590 Bacteria 1601
404 Ga0501075_0002791 3300049591 Bacteria 11695
405 Ga0501075_0010399 3300049591 Bacteria 6538
406 Ga0501075_0178079 3300049591 Bacteria 1622
407 Ga0501076_0007946 3300049592 Bacteria 7739
408 Ga0501076_0015943 3300049592 Bacteria 5687
409 Ga0501076_0103163 3300049592 Bacteria 2300
410 Ga0501076_0204069 3300049592 Bacteria 1615
411 Ga0501076_0293429 3300049592 Bacteria 1332
412 Ga0501077_0005865 3300049593 Bacteria 7482
413 Ga0501079_0013027 3300049741 Bacteria 6342
414 Ga0501079_0053819 3300049741 Bacteria 3105
415 Ga0501079_0123642 3300049741 Bacteria 2012
416 Ga0501079_0214815 3300049741 Bacteria 1502
417 Ga0501080_0004766 3300049742 Bacteria 12101
418 Ga0501080_0068774 3300049742 Bacteria 3294
419 Ga0501080_0126419 3300049742 Bacteria 2368
420 Ga0501080_0182150 3300049742 Bacteria 1932
421 Ga0501080_0194715 3300049742 Bacteria 1862
422 Ga0501081_0038712 3300049743 Bacteria 3259
423 Ga0501081_0049062 3300049743 Bacteria 2906
424 Ga0501081_0160998 3300049743 Bacteria 1617
425 Ga0501083_0005079 3300049744 Bacteria 9320
426 Ga0501083_0126637 3300049744 Bacteria 1674
427 Ga0501083_0194469 3300049744 Bacteria 1324
428 Ga0501035_0020721 3300049822 Bacteria 6042
429 Ga0501044_0103360 3300049823 Bacteria 2864
430 Ga0501045_0173079 3300049824 Bacteria 1608
431 nmdc:mga00v17_11835_c1 3300050491 Bacteria 4800
432 nmdc:mga00v17_41950_c2 3300050491 Bacteria 2387
433 nmdc:mga05p37_172421_c1 3300050507 Bacteria 2638
434 nmdc:mga05p37_19272_c1 3300050507 Bacteria 8252
435 nmdc:mga05p37_24978_c1 3300050507 Bacteria 7262
436 nmdc:mga05p37_30422_c1 3300050507 Bacteria 6588
437 nmdc:mga05p37_501779_c1 3300050507 Bacteria 1392
438 nmdc:mga05p37_5396_c1 3300050507 Bacteria 15029
439 nmdc:mga05p37_94751_c1 3300050507 Bacteria 3678
440 nmdc:mga09592_208091_c1 3300050508 Bacteria 1694
441 nmdc:mga09592_219426_c1 3300050508 Bacteria 1648
442 nmdc:mga09592_240193_c1 3300050508 Bacteria 1570
443 nmdc:mga0qj67_70642_c1 3300050509 Bacteria 2785
444 nmdc:mga06r32_110238_c1 3300050510 Bacteria 2707
445 nmdc:mga06r32_176550_c1 3300050510 Bacteria 2121
446 nmdc:mga06r32_388567_c1 3300050510 Bacteria 1378
447 nmdc:mga06r32_87091_c1 3300050510 Bacteria 3047
448 nmdc:mga08x19_110922_c1 3300050514 Bacteria 1830
449 nmdc:mga08x19_37884_c1 3300050514 Bacteria 3062
450 nmdc:mga08x19_5717_c1 3300050514 Bacteria 7349
451 nmdc:mga0a205_56751_c1 3300050515 Bacteria 3781
452 Ga0495601_0219925 3300053077 Bacteria 1240
453 Ga0495619_0005698 3300053085 Bacteria 7898
454 Ga0500595_022725 3300053119 Bacteria 2214
455 Ga0501084_0000338 3300054114 Bacteria 35721
456 Ga0501084_0013743 3300054114 Bacteria 6700
457 Ga0501084_0014855 3300054114 Bacteria 6456
458 Ga0501082_0008983 3300060353 Bacteria 8626
459 Ga0501082_0010750 3300060353 Bacteria 7878
460 Ga0501082_0269631 3300060353 Bacteria 1481
461 Ga0501082_0287852 3300060353 Bacteria 1430
462 Ga0530510_0004402 3300061734 Bacteria 9755
463 Ga0530510_0155291 3300061734 Bacteria 1691
464 2644552030 2643221699 Bacteria 5731501
465 Ga0265313_10093270
466 CNXas_1000074
467 JGI25406J46586_10000367
468 JGI25407J50210_10000496
469 Ga0058861_12072519
470 Ga0058862_10058516
471 Ga0065704_10071821
472 Ga0065704_10115502
473 Ga0065712_10091824
474 Ga0065707_10000538
475 Ga0065707_10005283
476 Ga0065707_10006372
477 Ga0065707_10095528
478 Ga0065707_10166376
479 Ga0065707_10172671
480 Ga0070658_10002296
481 Ga0070683_100035139
482 Ga0068869_100160534
483 Ga0070680_100099873
484 Ga0070661_100041243
485 Ga0070674_100011938
486 Ga0070659_100023306
487 Ga0070667_100150136
488 Ga0070703_10040526
489 Ga0070705_100004040
490 Ga0070705_100095952
491 Ga0070694_100079416
492 Ga0070708_100030326
493 Ga0070708_100196691
494 Ga0070662_100101254
495 Ga0070706_100055724
496 Ga0070706_100148991
497 Ga0070706_100157985
498 Ga0070707_100007728
499 Ga0070707_100107665
500 Ga0070698_100049206
501 Ga0070698_100080296
502 Ga0070699_100006210
503 Ga0070699_100052031
504 Ga0070684_100000110
505 Ga0070697_100084259
506 Ga0070665_100192770
507 Ga0070704_100000748
508 Ga0070664_100101943
509 Ga0068857_100093997
510 Ga0068854_100209452
511 Ga0068856_100151383
512 Ga0070702_100179957
513 Ga0068859_100083672
514 Ga0068864_100146126
515 Ga0068863_100051874
516 Ga0068863_100140120
517 Ga0068860_100003526
518 Ga0068860_100069468
519 Ga0068862_100004463
520 Ga0081455_10003653
521 Ga0081455_10017674
522 Ga0081538_10000037
523 Ga0081538_10000458
524 Ga0081538_10021020
525 Ga0081540_1011953
526 Ga0081539_10000671
527 Ga0075364_10005793
528 Ga0070712_100062821
529 Ga0075362_10058867
530 Ga0075428_100080048
531 Ga0075430_100092384
532 Ga0075431_100026658
533 Ga0075433_10049399
534 Ga0075429_100075089
535 Ga0075429_100081291
536 Ga0075429_100099567
537 Ga0075436_100120235
538 Ga0075436_100197972
539 Ga0097620_100083667
540 Ga0075435_100078235
541 Ga0105251_10076649
542 Ga0111539_10151332
543 Ga0111539_10340670
544 Ga0105245_10053320
545 Ga0114129_10038622
546 Ga0114129_10122580
547 Ga0114129_10186278
548 Ga0114129_10638680
549 Ga0105242_10163177
550 Ga0105248_10057194
551 Ga0105237_10008233
552 Ga0105249_10032780
553 Ga0105249_10432596
554 Ga0105246_10058508
555 Ga0157378_10099678
556 Ga0163162_10253568
557 Ga0157372_10198086
558 Ga0157375_10100196
559 Ga0157380_10090631
560 Ga0157377_10001754
561 Ga0157379_10004406
562 Ga0157376_10052518
563 Ga0213872_10000653
564 Ga0213872_10010225
565 Ga0213875_10009950
566 Ga0207697_10000803
567 Ga0207653_10014997
568 Ga0207647_10002251
569 Ga0207643_10069945
570 Ga0207705_10004133
571 Ga0207684_10053006
572 Ga0207684_10053102
573 Ga0207671_10015682
574 Ga0207662_10135836
575 Ga0207657_10067061
576 Ga0207657_10146122
577 Ga0207646_10053083
578 Ga0207646_10080967
579 Ga0207659_10165402
580 Ga0207687_10102350
581 Ga0207686_10033973
582 Ga0207686_10166760
583 Ga0207709_10086564
584 Ga0207670_10050340
585 Ga0207670_10243742
586 Ga0207669_10018866
587 Ga0207665_10239642
588 Ga0207711_10233874
589 Ga0207679_10324427
590 Ga0207712_10062246
591 Ga0207703_10005743
592 Ga0207703_10293877
593 Ga0207678_10207164
594 Ga0207708_10006509
595 Ga0207708_10070438
596 Ga0207702_10181041
597 Ga0207641_10313194
598 Ga0207676_10280156
599 Ga0207675_100207816
600 Ga0207675_100293891
601 Ga0207683_10144158
602 Ga0207698_10064708
603 Ga0209981_1007757
604 Ga0207428_10033464
605 Ga0268264_10113795
606 Ga0268264_10432010
607 Ga0265326_10013834
608 Ga0265334_10021402
609 Ga0265334_10023402
610 Ga0265324_10018640
611 Ga0265330_10006275
612 Ga0265320_10022503
613 Ga0265320_10036818
614 Ga0265339_10052865
615 Ga0265331_10006301
616 Ga0265331_10113559
617 Ga0265327_10018681
618 Ga0265316_10076258
619 Ga0307513_10029552
620 Ga0316575_10007199
621 Ga0316575_10011582
622 Ga0316575_10036799
623 Ga0316575_10055232
624 Ga0316575_10080340
625 Ga0316579_10001474
626 Ga0316579_10004574
627 Ga0316579_10008867
628 Ga0316579_10024805
629 Ga0316579_10066668
630 Ga0316576_10017915
631 Ga0316576_10020188
632 Ga0316576_10089589
633 Ga0316576_10103742
634 Ga0316576_10144740
635 Ga0316576_10274545
636 Ga0316578_10003853
637 Ga0316578_10008090
638 Ga0316578_10015639
639 Ga0316578_10051684
640 Ga0316578_10060051
641 Ga0316578_10083171
642 Ga0316578_10128929
643 Ga0316577_10000214
644 Ga0316577_10014391
645 Ga0316577_10071393
646 Ga0316577_10086869
647 Ga0316577_10092397
648 Ga0316577_10121678
649 Ga0307410_10223972
650 Ga0307409_100299139
651 Ga0307409_100401011
652 Ga0307416_100088559
653 Ga0307411_10169616
654 Ga0316583_10012488
655 Ga0316585_10011594
656 Ga0316585_10019494
657 Ga0316585_10037136
658 Ga0316585_10050971
659 Ga0316585_10072586
660 Ga0316580_10012403
661 Ga0316593_10000242
662 Ga0316593_10002635
663 Ga0316593_10003331
664 Ga0316593_10010813
665 Ga0316593_10022518
666 Ga0316593_10022763
667 Ga0316593_10029131
668 Ga0316593_10030774
669 Ga0316593_10045663
670 Ga0316593_10058534
671 Ga0316592_1000292
672 Ga0316592_1000535
673 Ga0316592_1001923
674 Ga0316592_1003566
675 Ga0316592_1004293
676 Ga0316592_1009501
677 Ga0316592_1009703
678 Ga0316592_1012112
679 Ga0316592_1012361
680 Ga0316592_1015372
681 Ga0316586_1004198
682 Ga0316586_1006371
683 Ga0316586_1007070
684 Ga0316587_1009242
685 Ga0316596_1001769
686 Ga0316596_1001921
687 Ga0316596_1002564
688 Ga0316596_1004622
689 Ga0316596_1004986
690 Ga0316596_1005984
691 Ga0316596_1011942
692 Ga0316596_1012020
693 Ga0316596_1012727
694 Ga0316596_1017252
695 Ga0316596_1019766
696 Ga0316596_1021957
697 Ga0316596_1025319
698 Ga0316596_1025516
699 Ga0316596_1026403
700 Ga0316596_1027561
701 Ga0316596_1028500
702 Ga0316596_1034539
703 Ga0373948_0006985
704 Ga0373950_0003827
705 Ga0373926_0027202
706 Ga0373949_0013324
707 Ga0373932_0033726
708 Ga0373962_0015757
709 Ga0316574_0000443
710 Ga0316574_0003387
711 Ga0316574_0108791
712 Ga0373927_0096032
713 Ga0373933_0184101
714 Ga0373947_0041297
715 Ga0373937_0128775
716 Ga0316582_0007265
717 Ga0316582_0015629
718 Ga0316582_0019018
719 Ga0316582_0046464
720 Ga0316582_0050825
721 Ga0316582_0055586
722 Ga0316582_0074709
723 Ga0316582_0082785
724 Ga0316582_0088391
725 Ga0316582_0115556
726 Ga0316582_0159015
727 Ga0316582_0193675
728 Ga0316582_0201093
729 Ga0316584_0010222
730 Ga0316584_0033125
731 Ga0316584_0056212
732 Ga0316584_0058967
733 Ga0316584_0073357
734 Ga0316584_0074597
735 Ga0316584_0084344
736 Ga0316584_0133223
737 Ga0316584_0180801
738 Ga0316584_0211409
739 Ga0395899_0030497
740 Ga0395900_0011365
741 Ga0395898_0066169
742 Ga0395905_0019777
743 Ga0316581_0009833
744 Ga0316581_0016323
745 Ga0316581_0025673
746 Ga0316581_0032000
747 Ga0436364_1228372
748 Ga0400484_25283
749 Ga0400484_31592
750 Ga0400484_35517
751 Ga0400490_26208
752 Ga0400490_49731
753 Ga0400483_135165
754 Ga0400489_64154
755 Ga0400487_65380
756 Ga0436365_0292643
757 Ga0436365_1896641
758 Ga0436361_0212903
759 Ga0436361_0444714
760 Ga0439450_016634
761 Ga0451577_0011704
762 Ga0451577_0036920
763 Ga0451577_0050730
764 Ga0451577_0058965
765 Ga0451577_0072487
766 Ga0451577_0142643
767 Ga0451577_0152778
768 Ga0451577_0170486
769 Ga0451577_0188151
770 Ga0451577_0283558
771 Ga0439440_0003063
772 Ga0453683_0005001
773 Ga0453683_0009016
774 Ga0453683_0033895
775 Ga0453683_0034835
776 Ga0453683_0047637
777 Ga0453683_0080790
778 Ga0453684_0001835
779 Ga0453684_0002841
780 Ga0453684_0015826
781 Ga0453684_0016312
782 Ga0453684_0039071
783 Ga0453684_0040080
784 Ga0453684_0040272
785 Ga0453684_0047886
786 Ga0453684_0056484
787 Ga0453684_0056639
788 Ga0453684_0063966
789 Ga0453684_0083124
790 Ga0453684_0108156
791 Ga0453684_0111173
792 Ga0453684_0126547
793 Ga0453684_0131496
794 Ga0453684_0163504
795 Ga0453684_0177061
796 Ga0453684_0283429
797 Ga0453684_0286581
798 Ga0453684_0287924
799 Ga0453684_0303360
800 Ga0453684_0314872
801 Ga0453684_0353499
802 Ga0453684_0409758
803 Ga0453684_0547340
804 Ga0451576_0074509
805 Ga0451576_0089043
806 Ga0451576_0127284
807 Ga0451576_0174545
808 Ga0451576_0180993
809 Ga0495603_0131311
810 Ga0495580_0025084
811 Ga0495639_0115668
812 Ga0495628_0151849
813 Ga0495630_0126219
814 Ga0495632_0078529
815 Ga0495652_0244234
816 Ga0495658_0035258
817 Ga0495604_0185527
818 Ga0496101_0080548
819 Ga0496102_0097894
820 Ga0496106_0063614
821 Ga0496106_0238653
822 Ga0496108_0080301
823 Ga0496108_0311730
824 Ga0496109_0045331
825 Ga0496110_0031912
826 Ga0496111_0096024
827 Ga0496112_0380577
828 Ga0496113_0059402
829 Ga0501031_0239438
830 Ga0501032_0027283
831 Ga0501033_0002745
832 Ga0501036_0002699
833 Ga0501036_0053582
834 Ga0501036_0240005
835 Ga0501037_0047112
836 Ga0501037_0106584
837 Ga0501038_0059970
838 Ga0501038_0189825
839 Ga0501039_0004374
840 Ga0501039_0046684
841 Ga0501040_0092891
842 Ga0501041_0002629
843 Ga0501041_0088677
844 Ga0501041_0106439
845 Ga0501042_0004791
846 Ga0501042_0203825
847 Ga0501042_0320996
848 Ga0501043_0003806
849 Ga0501046_0145936
850 Ga0501048_0011486
851 Ga0501048_0161552
852 Ga0501067_0110072
853 Ga0501068_0000827
854 Ga0501071_0017899
855 Ga0501071_0067056
856 Ga0501071_0175429
857 Ga0501071_0177680
858 Ga0501071_0294239
859 Ga0501072_0030108
860 Ga0501072_0030730
861 Ga0501072_0044218
862 Ga0501073_0100436
863 Ga0501073_0117690
864 Ga0501073_0120944
865 Ga0501074_0006425
866 Ga0501074_0062215
867 Ga0501074_0161315
868 Ga0501075_0002791
869 Ga0501075_0010399
870 Ga0501075_0178079
871 Ga0501076_0007946
872 Ga0501076_0015943
873 Ga0501076_0103163
874 Ga0501076_0204069
875 Ga0501076_0293429
876 Ga0501077_0005865
877 Ga0501079_0013027
878 Ga0501079_0053819
879 Ga0501079_0123642
880 Ga0501079_0214815
881 Ga0501080_0004766
882 Ga0501080_0068774
883 Ga0501080_0126419
884 Ga0501080_0182150
885 Ga0501080_0194715
886 Ga0501081_0038712
887 Ga0501081_0049062
888 Ga0501081_0160998
889 Ga0501083_0005079
890 Ga0501083_0126637
891 Ga0501083_0194469
892 Ga0501035_0020721
893 Ga0501044_0103360
894 Ga0501045_0173079
895 nmdc:mga00v17_11835_c1
896 nmdc:mga00v17_41950_c2
897 nmdc:mga05p37_172421_c1
898 nmdc:mga05p37_19272_c1
899 nmdc:mga05p37_24978_c1
900 nmdc:mga05p37_30422_c1
901 nmdc:mga05p37_501779_c1
902 nmdc:mga05p37_5396_c1
903 nmdc:mga05p37_94751_c1
904 nmdc:mga09592_208091_c1
905 nmdc:mga09592_219426_c1
906 nmdc:mga09592_240193_c1
907 nmdc:mga0qj67_70642_c1
908 nmdc:mga06r32_110238_c1
909 nmdc:mga06r32_176550_c1
910 nmdc:mga06r32_388567_c1
911 nmdc:mga06r32_87091_c1
912 nmdc:mga08x19_110922_c1
913 nmdc:mga08x19_37884_c1
914 nmdc:mga08x19_5717_c1
915 nmdc:mga0a205_56751_c1
916 Ga0495601_0219925
917 Ga0495619_0005698
918 Ga0500595_022725
919 Ga0501084_0000338
920 Ga0501084_0013743
921 Ga0501084_0014855
922 Ga0501082_0008983
923 Ga0501082_0010750
924 Ga0501082_0269631
925 Ga0501082_0287852
926 Ga0530510_0004402
927 Ga0530510_0155291
928 2644552030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03143

GTP_EFTU_D3

Elongation factor Tu C-terminal domain

320

415

0.98

PF03144

GTP_EFTU_D2

Elongation factor Tu domain 2

246

316

0.97

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

26

223

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9752 210 394
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.9649 210 394
6wd9-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) 0.9561 10 393
6wd9-assembly1.cif.gz_8 cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-b) 0.9535 10 393
2bvn-assembly2.cif.gz_B e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia 0.9481 7 394
ID Description Score Start End Superfamily
af_Q7K3V6_252_380_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9903 207 327 2.40.30.10
2y12Z02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9873 207 296 2.40.30.10
af_B4FVB2_262_392_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9867 207 333 2.40.30.10
4h9gA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9825 300 393 2.40.30.10
af_G5ECM6_248_343_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.98 207 297 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A2P7P1A2-F1-model_v4 deleted 1.002 214 297
AF-A0A3S0V9N4-F1-model_v4 Elongation factor Tu 1.001 288 394 GO:0003746
GO:0005525
AF-A0A381TUR9-F1-model_v4 Translation elongation factor EFTu/EF1A C-terminal domain-containing protein 1.001 299 394 GO:0003746
GO:0005525
AF-A0A352F424-F1-model_v4 Elongation factor Tu (EC 3.6.5.3) 1 302 394 GO:0003746
GO:0005525
GO:0005829
GO:0016787
AF-A0A7W6H871-F1-model_v4 Translation elongation factor TU 1 307 394 GO:0003746
GO:0005525
GO:0005829

Map