F449318

General Info

Members Datasets Scaffolds Average Seq Length
464 289 463 74

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10423466|Ga0307513_104234661
Length 89
Sequence MEDDRGRGQAAFAEVAMNWSHGIRQSHRWLSIVFTLTVVANFAARAVDRAEPSAWITYAPLPPLFLMLVSGLYLFALPHTTKWRSRPRA

Samples

Sample ID Description Type Environment
1 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
188 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
288 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.53
Nodule 0.65
Rhizoplane 5.39
Rhizosphere 70.91
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10028723 3300003320 Bacteria 2348
2 rootH1_10008025 3300003323 Bacteria 2186
3 rootH1_10013604 3300003323 Bacteria 2073
4 Ga0065165_1072995 3300005262 Bacteria 907
5 Ga0065715_10870444 3300005293 Bacteria 569
6 Ga0065707_10753988 3300005295 Bacteria 617
7 Ga0070676_10002031 3300005328 Bacteria 10277
8 Ga0070677_10364789 3300005333 Bacteria 752
9 Ga0068869_100035482 3300005334 Bacteria 3534
10 Ga0068869_100055689 3300005334 Bacteria 2882
11 Ga0070666_10143595 3300005335 Bacteria 1663
12 Ga0070680_100003117 3300005336 Bacteria 12308
13 Ga0070680_100377835 3300005336 Bacteria 1206
14 Ga0068868_101229991 3300005338 Bacteria 693
15 Ga0070689_101561033 3300005340 Bacteria 599
16 Ga0070691_10013745 3300005341 Bacteria 3714
17 Ga0070691_10035204 3300005341 Bacteria 2357
18 Ga0070687_100955225 3300005343 Bacteria 618
19 Ga0070692_10196571 3300005345 Bacteria 1178
20 Ga0070692_11322971 3300005345 Bacteria 518
21 Ga0070668_100013900 3300005347 Bacteria 6020
22 Ga0070668_101107496 3300005347 Bacteria 715
23 Ga0070669_100058453 3300005353 Bacteria 2830
24 Ga0070671_100125245 3300005355 Bacteria 2163
25 Ga0070674_100000038 3300005356 Bacteria 58036
26 Ga0070674_101593276 3300005356 Bacteria 589
27 Ga0070673_100657368 3300005364 Bacteria 960
28 Ga0070673_101258202 3300005364 Bacteria 694
29 Ga0070659_100598933 3300005366 Bacteria 947
30 Ga0070703_10001384 3300005406 Bacteria 7352
31 Ga0070705_100002172 3300005440 Bacteria 9965
32 Ga0070705_100003122 3300005440 Bacteria 8149
33 Ga0070700_100002573 3300005441 Bacteria 9275
34 Ga0070700_100172261 3300005441 Bacteria 1500
35 Ga0070694_100010879 3300005444 Bacteria 5629
36 Ga0070694_100020471 3300005444 Bacteria 4218
37 Ga0070708_100040322 3300005445 Bacteria 4089
38 Ga0070663_100007077 3300005455 Bacteria 6806
39 Ga0070663_101158112 3300005455 Bacteria 678
40 Ga0070678_100040605 3300005456 Bacteria 3293
41 Ga0070678_101874193 3300005456 Bacteria 566
42 Ga0070662_100001357 3300005457 Bacteria 15034
43 Ga0070662_100144806 3300005457 Bacteria 1845
44 Ga0070681_10270996 3300005458 Bacteria 1609
45 Ga0070681_10372195 3300005458 Bacteria 1339
46 Ga0068867_100001385 3300005459 Bacteria 16768
47 Ga0070706_101170769 3300005467 Bacteria 707
48 Ga0070698_100298207 3300005471 Bacteria 1543
49 Ga0070699_100000444 3300005518 Bacteria 39757
50 Ga0070697_100524187 3300005536 Bacteria 1037
51 Ga0068853_100043228 3300005539 Bacteria 3855
52 Ga0068853_100450217 3300005539 Bacteria 1211
53 Ga0070672_100031374 3300005543 Bacteria 3998
54 Ga0070672_100711261 3300005543 Bacteria 880
55 Ga0070686_100073482 3300005544 Bacteria 2245
56 Ga0070686_101127663 3300005544 Bacteria 649
57 Ga0070695_100003441 3300005545 Bacteria 9246
58 Ga0070695_100058820 3300005545 Bacteria 2486
59 Ga0070696_100000123 3300005546 Bacteria 40797
60 Ga0070693_100008394 3300005547 Bacteria 5090
61 Ga0070693_100074922 3300005547 Bacteria 2003
62 Ga0070665_100101677 3300005548 Bacteria 2878
63 Ga0070665_101488257 3300005548 Bacteria 686
64 Ga0070704_100000095 3300005549 Bacteria 30467
65 Ga0068855_100145441 3300005563 Bacteria 2699
66 Ga0068857_100003759 3300005577 Bacteria 12760
67 Ga0068857_100039289 3300005577 Bacteria 4191
68 Ga0068857_101170305 3300005577 Bacteria 744
69 Ga0068854_100003261 3300005578 Bacteria 10105
70 Ga0068854_101081198 3300005578 Bacteria 714
71 Ga0070702_100002667 3300005615 Bacteria 7789
72 Ga0070702_100135943 3300005615 Bacteria 1559
73 Ga0068852_100376380 3300005616 Bacteria 1392
74 Ga0068859_100001820 3300005617 Bacteria 21717
75 Ga0068864_100049303 3300005618 Bacteria 3623
76 Ga0068864_100084423 3300005618 Bacteria 2790
77 Ga0068866_10001243 3300005718 Bacteria 11055
78 Ga0068861_100233098 3300005719 Bacteria 1562
79 Ga0068870_10444217 3300005840 Bacteria 854
80 Ga0068863_100754827 3300005841 Bacteria 969
81 Ga0068858_100613242 3300005842 Bacteria 1056
82 Ga0068860_100002696 3300005843 Bacteria 18484
83 Ga0068860_100058328 3300005843 Bacteria 3670
84 Ga0068862_100010515 3300005844 Bacteria 7645
85 Ga0068862_100206368 3300005844 Bacteria 1774
86 Ga0075365_10027545 3300006038 Bacteria 3617
87 Ga0075365_10080429 3300006038 Bacteria 2206
88 Ga0075365_10081923 3300006038 Bacteria 2187
89 Ga0075365_10712501 3300006038 Bacteria 709
90 Ga0075363_100017221 3300006048 Bacteria 3580
91 Ga0075363_100030992 3300006048 Bacteria 2771
92 Ga0075363_100390961 3300006048 Bacteria 816
93 Ga0075363_100755360 3300006048 Bacteria 589
94 Ga0075364_10028877 3300006051 Bacteria 3553
95 Ga0075364_10508163 3300006051 Bacteria 824
96 Ga0075364_10966042 3300006051 Bacteria 579
97 Ga0075362_10120463 3300006177 Bacteria 1242
98 Ga0075362_10138977 3300006177 Bacteria 1160
99 Ga0075362_10577404 3300006177 Bacteria 580
100 Ga0075367_10011839 3300006178 Bacteria 4632
101 Ga0075367_10216779 3300006178 Bacteria 1197
102 Ga0075367_10321563 3300006178 Bacteria 975
103 Ga0075367_10435210 3300006178 Bacteria 831
104 Ga0075369_10045501 3300006186 Bacteria 1887
105 Ga0075369_10267948 3300006186 Bacteria 794
106 Ga0075369_10552374 3300006186 Bacteria 549
107 Ga0075369_10583693 3300006186 Bacteria 534
108 Ga0075366_10512982 3300006195 Bacteria 741
109 Ga0097621_100548352 3300006237 Bacteria 1052
110 Ga0075370_10198894 3300006353 Bacteria 1182
111 Ga0075370_10219783 3300006353 Bacteria 1123
112 Ga0075370_10272621 3300006353 Bacteria 1004
113 Ga0075370_10478504 3300006353 Bacteria 750
114 Ga0068871_100333468 3300006358 Bacteria 1338
115 Ga0075428_100117775 3300006844 Bacteria 2894
116 Ga0075431_100068139 3300006847 Bacteria 3672
117 Ga0075433_10924220 3300006852 Bacteria 761
118 Ga0068865_100003522 3300006881 Bacteria 9385
119 Ga0068865_100699304 3300006881 Bacteria 866
120 Ga0097620_100001820 3300006931 Bacteria 21717
121 Ga0079104_1030668 3300006946 Bacteria 1339
122 Ga0099795_10504243 3300007788 Bacteria 565
123 Ga0105250_10309477 3300009092 Bacteria 685
124 Ga0105250_10578097 3300009092 Bacteria 518
125 Ga0105240_10284867 3300009093 Bacteria 1897
126 Ga0105245_10303904 3300009098 Bacteria 1566
127 Ga0105245_10683109 3300009098 Bacteria 1059
128 Ga0105245_11359499 3300009098 Bacteria 760
129 Ga0105247_11130716 3300009101 Bacteria 619
130 Ga0114129_10569367 3300009147 Bacteria 1471
131 Ga0105243_10004784 3300009148 Bacteria 10642
132 Ga0105243_10113083 3300009148 Bacteria 2276
133 Ga0105243_10133638 3300009148 Bacteria 2108
134 Ga0105243_11154379 3300009148 Bacteria 785
135 Ga0105243_11264394 3300009148 Bacteria 754
136 Ga0105241_10008154 3300009174 Bacteria 7714
137 Ga0105242_10001493 3300009176 Bacteria 18419
138 Ga0105242_10703974 3300009176 Bacteria 989
139 Ga0105237_10353992 3300009545 Bacteria 1473
140 Ga0105238_11931123 3300009551 Bacteria 623
141 Ga0105238_12546950 3300009551 Bacteria 548
142 Ga0105238_12547136 3300009551 Bacteria 548
143 Ga0105249_10006303 3300009553 Bacteria 10307
144 Ga0105249_10010901 3300009553 Bacteria 7989
145 Ga0099796_10460790 3300010159 Bacteria 567
146 Ga0105239_10010913 3300010375 Bacteria 10150
147 Ga0105239_10382828 3300010375 Bacteria 1590
148 Ga0105239_10965635 3300010375 Bacteria 979
149 Ga0105239_12358751 3300010375 Bacteria 619
150 Ga0105246_10009353 3300011119 Bacteria 6039
151 Ga0105246_10659552 3300011119 Bacteria 912
152 Ga0105246_10894043 3300011119 Bacteria 796
153 Ga0157371_10058318 3300013102 Bacteria 2738
154 Ga0157370_11019091 3300013104 Bacteria 749
155 Ga0157378_10001549 3300013297 Bacteria 20761
156 Ga0157378_10130252 3300013297 Bacteria 2328
157 Ga0163162_10003514 3300013306 Bacteria 14986
158 Ga0163162_11101075 3300013306 Bacteria 900
159 Ga0157372_10117582 3300013307 Bacteria 3049
160 Ga0157375_10040015 3300013308 Bacteria 4515
161 Ga0163163_10604308 3300014325 Bacteria 1160
162 Ga0157380_11912564 3300014326 Bacteria 654
163 Ga0157377_11107930 3300014745 Bacteria 607
164 Ga0157379_10382894 3300014968 Bacteria 1291
165 Ga0157379_10447854 3300014968 Bacteria 1192
166 Ga0157376_10135900 3300014969 Bacteria 2200
167 Ga0157376_12320629 3300014969 Bacteria 576
168 Ga0209129_1000285 3300025258 Bacteria 48259
169 Ga0209233_1000028 3300025261 Bacteria 642062
170 Ga0209676_1019122 3300025292 Bacteria 2366
171 Ga0209676_1025617 3300025292 Bacteria 1888
172 Ga0209025_1001792 3300025294 Bacteria 25500
173 Ga0209025_1006333 3300025294 Bacteria 9228
174 Ga0209564_1050052 3300025295 Bacteria 1027
175 Ga0209758_1016045 3300025297 Bacteria 3829
176 Ga0209758_1023345 3300025297 Bacteria 2801
177 Ga0209256_1044171 3300025299 Bacteria 1114
178 Ga0209051_1066009 3300025303 Bacteria 1113
179 Ga0209257_1102882 3300025304 Bacteria 693
180 Ga0207697_10109255 3300025315 Bacteria 1183
181 Ga0207653_10000615 3300025885 Bacteria 12418
182 Ga0207682_10147875 3300025893 Bacteria 1058
183 Ga0207642_10014045 3300025899 Bacteria 2942
184 Ga0207710_10105001 3300025900 Bacteria 1336
185 Ga0207688_10564965 3300025901 Bacteria 715
186 Ga0207680_10162258 3300025903 Bacteria 1500
187 Ga0207647_10141757 3300025904 Bacteria 1409
188 Ga0207645_10001747 3300025907 Bacteria 17636
189 Ga0207643_10011863 3300025908 Bacteria 4703
190 Ga0207684_10513434 3300025910 Bacteria 1027
191 Ga0207654_10005872 3300025911 Bacteria 6186
192 Ga0207707_10046627 3300025912 Bacteria 3775
193 Ga0207707_10371148 3300025912 Bacteria 1231
194 Ga0207695_10258001 3300025913 Bacteria 1641
195 Ga0207671_11156716 3300025914 Bacteria 606
196 Ga0207660_10001673 3300025917 Bacteria 14857
197 Ga0207660_10377012 3300025917 Bacteria 1140
198 Ga0207652_11618715 3300025921 Bacteria 552
199 Ga0207681_10028994 3300025923 Bacteria 3589
200 Ga0207681_11461737 3300025923 Bacteria 573
201 Ga0207694_10830246 3300025924 Bacteria 781
202 Ga0207694_11635789 3300025924 Bacteria 542
203 Ga0207687_10008002 3300025927 Bacteria 6920
204 Ga0207687_10486315 3300025927 Bacteria 1028
205 Ga0207690_10572061 3300025932 Bacteria 920
206 Ga0207706_10000153 3300025933 Bacteria 75743
207 Ga0207706_10046830 3300025933 Bacteria 3828
208 Ga0207686_10000844 3300025934 Bacteria 18615
209 Ga0207686_10542446 3300025934 Bacteria 908
210 Ga0207709_10010489 3300025935 Bacteria 5102
211 Ga0207709_10392143 3300025935 Bacteria 1059
212 Ga0207709_11101100 3300025935 Bacteria 652
213 Ga0207669_10000659 3300025937 Bacteria 14927
214 Ga0207669_11080163 3300025937 Bacteria 677
215 Ga0207704_10000636 3300025938 Bacteria 15497
216 Ga0207704_10590792 3300025938 Bacteria 908
217 Ga0207704_10898725 3300025938 Bacteria 745
218 Ga0207691_10044496 3300025940 Bacteria 4086
219 Ga0207691_10793483 3300025940 Bacteria 796
220 Ga0207711_10001813 3300025941 Bacteria 19515
221 Ga0207689_10016325 3300025942 Bacteria 6289
222 Ga0207689_10083686 3300025942 Bacteria 2623
223 Ga0207667_10060333 3300025949 Bacteria 3970
224 Ga0207651_10519815 3300025960 Bacteria 1031
225 Ga0207712_10006141 3300025961 Bacteria 7572
226 Ga0207712_10018438 3300025961 Bacteria 4546
227 Ga0207668_10010167 3300025972 Bacteria 5675
228 Ga0207640_10004393 3300025981 Bacteria 7642
229 Ga0207640_10547834 3300025981 Bacteria 971
230 Ga0207640_11944468 3300025981 Bacteria 532
231 Ga0207703_10021228 3300026035 Bacteria 5083
232 Ga0207639_10268270 3300026041 Bacteria 1496
233 Ga0207639_10476083 3300026041 Bacteria 1137
234 Ga0207639_10592661 3300026041 Bacteria 1021
235 Ga0207678_10006547 3300026067 Bacteria 10327
236 Ga0207678_10532033 3300026067 Bacteria 1026
237 Ga0207678_10840679 3300026067 Bacteria 811
238 Ga0207708_10000488 3300026075 Bacteria 30463
239 Ga0207708_10165940 3300026075 Bacteria 1746
240 Ga0207702_10089828 3300026078 Bacteria 2687
241 Ga0207641_10190145 3300026088 Bacteria 1886
242 Ga0207648_10000028 3300026089 Bacteria 130116
243 Ga0207648_10431822 3300026089 Bacteria 1197
244 Ga0207648_10684926 3300026089 Bacteria 949
245 Ga0207676_10011695 3300026095 Bacteria 6278
246 Ga0207676_10062225 3300026095 Bacteria 2959
247 Ga0207674_10004426 3300026116 Bacteria 16895
248 Ga0207674_10006635 3300026116 Bacteria 13598
249 Ga0207674_10812520 3300026116 Bacteria 902
250 Ga0207675_100026163 3300026118 Bacteria 5432
251 Ga0207683_10015033 3300026121 Bacteria 6587
252 Ga0207683_11065341 3300026121 Bacteria 750
253 Ga0207698_10194452 3300026142 Bacteria 1811
254 Ga0209281_1000190 3300027111 Bacteria 140658
255 Ga0209179_1155862 3300027512 Bacteria 510
256 Ga0209813_10321878 3300027866 Bacteria 606
257 Ga0207428_10222236 3300027907 Bacteria 1415
258 Ga0268266_10020817 3300028379 Bacteria 5593
259 Ga0268266_10890911 3300028379 Bacteria 860
260 Ga0268265_10007219 3300028380 Bacteria 7508
261 Ga0268265_10186006 3300028380 Bacteria 1789
262 Ga0268264_10002359 3300028381 Bacteria 16660
263 Ga0268264_10016842 3300028381 Bacteria 5983
264 Ga0307513_10216130 3300031456 Bacteria 1743
265 Ga0307513_10423466 3300031456 Bacteria 1061
266 Ga0307408_100284312 3300031548 Bacteria 1379
267 Ga0307516_10002523 3300031730 Bacteria 24368
268 Ga0307413_10137762 3300031824 Bacteria 1681
269 Ga0307406_10175388 3300031901 Bacteria 1556
270 Ga0307412_10544402 3300031911 Bacteria 974
271 Ga0307412_10628889 3300031911 Unclassified 913
272 Ga0307409_100236557 3300031995 Bacteria 1660
273 Ga0307409_102943271 3300031995 Bacteria 503
274 Ga0307416_100658552 3300032002 Bacteria 1133
275 Ga0307414_10612709 3300032004 Bacteria 977
276 Ga0307414_11300459 3300032004 Bacteria 675
277 Ga0307415_101442637 3300032126 Bacteria 657
278 Ga0373958_0019203 3300034819 Bacteria 1247
279 Ga0373928_0153183 3300035084 Bacteria 640
280 Ga0373949_0175064 3300035090 Bacteria 633
281 Ga0373960_0291309 3300035121 Bacteria 604
282 Ga0373931_0168852 3300035691 Bacteria 1288
283 Ga0436364_0788347 3300037853 Bacteria 2708
284 Ga0436364_1069531 3300037853 Bacteria 964
285 Ga0436365_1881913 3300039437 Bacteria 821
286 Ga0436361_0695951 3300039447 Bacteria 2551
287 Ga0436363_1614222 3300039450 Bacteria 1511
288 Ga0436362_0489910 3300039453 Bacteria 549
289 Ga0439465_0098276 3300041413 Bacteria 1008
290 Ga0439465_0340117 3300041413 Bacteria 566
291 Ga0451793_0344856 3300041452 Bacteria 3656
292 Ga0451795_1461890 3300041456 Bacteria 961
293 Ga0451845_0754173 3300041501 Bacteria 593
294 Ga0451851_1362650 3300041507 Bacteria 990
295 Ga0451855_0327471 3300041511 Unclassified 837
296 Ga0451853_2376861 3300041512 Bacteria 952
297 Ga0495617_000346 3300046452 Bacteria 25591
298 Ga0495584_0000824 3300046491 Bacteria 20361
299 Ga0495585_0003992 3300046492 Bacteria 9722
300 Ga0495607_0020935 3300046501 Bacteria 4121
301 Ga0495606_0007401 3300046507 Bacteria 9843
302 Ga0495606_0396091 3300046507 Bacteria 720
303 Ga0495610_0121028 3300046512 Bacteria 1147
304 Ga0495632_0093516 3300046519 Bacteria 1423
305 Ga0495637_0088599 3300046520 Bacteria 1224
306 Ga0495643_0358412 3300046522 Bacteria 651
307 Ga0495644_0002261 3300046523 Bacteria 7705
308 Ga0495648_0409056 3300046524 Bacteria 604
309 Ga0495609_0006047 3300046538 Bacteria 6234
310 Ga0495597_0025540 3300046542 Bacteria 2719
311 Ga0495622_0065829 3300046557 Bacteria 1675
312 Ga0495633_0005455 3300046558 Bacteria 7765
313 Ga0495668_0191516 3300046616 Bacteria 1120
314 Ga0495668_0393728 3300046616 Bacteria 761
315 Ga0495611_0003718 3300046648 Bacteria 6671
316 Ga0495611_0445936 3300046648 Bacteria 590
317 Ga0495625_0022295 3300046660 Bacteria 4859
318 Ga0495625_0098989 3300046660 Bacteria 2005
319 Ga0495625_0448966 3300046660 Bacteria 797
320 Ga0495625_0560212 3300046660 Bacteria 691
321 Ga0495659_0008881 3300046664 Bacteria 3201
322 Ga0495661_0536861 3300046665 Bacteria 554
323 Ga0495669_0445643 3300046684 Bacteria 629
324 Ga0495670_0149831 3300046691 Bacteria 1223
325 Ga0495671_0017506 3300046692 Bacteria 3814
326 Ga0495660_0125107 3300046810 Bacteria 1296
327 Ga0495636_0042879 3300047318 Bacteria 1881
328 Ga0495672_0007995 3300047320 Bacteria 7875
329 Ga0495677_0001383 3300047445 Bacteria 9700
330 Ga0495677_0114894 3300047445 Bacteria 1024
331 Ga0495686_0266995 3300047472 Bacteria 956
332 Ga0495686_0285335 3300047472 Bacteria 916
333 Ga0496100_0819656 3300048903 Bacteria 729
334 Ga0496101_0178353 3300048904 Bacteria 1635
335 Ga0496102_0050758 3300048905 Bacteria 3778
336 Ga0496102_0357845 3300048905 Bacteria 1374
337 Ga0496102_1446771 3300048905 Bacteria 606
338 Ga0496103_0179539 3300048906 Bacteria 1360
339 Ga0496103_0677765 3300048906 Bacteria 654
340 Ga0496104_0120954 3300048907 Bacteria 2514
341 Ga0496104_0318332 3300048907 Bacteria 1469
342 Ga0496104_0440572 3300048907 Bacteria 1215
343 Ga0496104_0743192 3300048907 Bacteria 888
344 Ga0496105_0562410 3300048908 Bacteria 889
345 Ga0496106_0002352 3300048909 Bacteria 14089
346 Ga0496106_0018206 3300048909 Bacteria 5194
347 Ga0496107_0008206 3300048910 Bacteria 7222
348 Ga0496108_0135187 3300048911 Bacteria 2121
349 Ga0496108_0688560 3300048911 Bacteria 887
350 Ga0496109_0324926 3300048912 Bacteria 1452
351 Ga0496112_0363809 3300048915 Bacteria 1388
352 Ga0496112_1035585 3300048915 Bacteria 740
353 Ga0496113_0288695 3300048916 Bacteria 1312
354 Ga0496113_1364366 3300048916 Bacteria 550
355 Ga0496114_0012892 3300048917 Bacteria 6696
356 Ga0496116_0128347 3300048919 Bacteria 1451
357 Ga0496117_0172411 3300048920 Bacteria 1254
358 Ga0496121_0023145 3300048924 Bacteria 5997
359 Ga0496123_0032061 3300048926 Bacteria 3812
360 Ga0496124_0573414 3300048927 Bacteria 740
361 Ga0496125_0223535 3300048928 Bacteria 1211
362 Ga0496126_0160952 3300048929 Bacteria 1918
363 Ga0495682_0000089 3300049460 Bacteria 80020
364 Ga0501031_0000018 3300049568 Bacteria 106734
365 Ga0501032_0000003 3300049569 Bacteria 317700
366 Ga0501032_0331269 3300049569 Bacteria 982
367 Ga0501033_0000132 3300049570 Bacteria 72558
368 Ga0501033_0312025 3300049570 Bacteria 1105
369 Ga0501033_0680752 3300049570 Bacteria 701
370 Ga0501034_0000005 3300049571 Bacteria 367512
371 Ga0501034_0039740 3300049571 Bacteria 4765
372 Ga0501034_0044128 3300049571 Bacteria 4509
373 Ga0501036_0000005 3300049572 Bacteria 246420
374 Ga0501036_0012728 3300049572 Bacteria 6979
375 Ga0501037_0000045 3300049573 Bacteria 117148
376 Ga0501038_0000001 3300049574 Bacteria 375481
377 Ga0501038_0022297 3300049574 Bacteria 5676
378 Ga0501039_0000007 3300049575 Bacteria 277831
379 Ga0501039_0050623 3300049575 Bacteria 3214
380 Ga0501040_0002864 3300049576 Bacteria 11141
381 Ga0501042_1376653 3300049578 Bacteria 514
382 Ga0501043_0000333 3300049579 Bacteria 42740
383 Ga0501043_0081647 3300049579 Bacteria 2540
384 Ga0501046_0025781 3300049580 Bacteria 4807
385 Ga0501046_0581427 3300049580 Bacteria 796
386 Ga0501047_0000708 3300049581 Bacteria 34744
387 Ga0501047_0027552 3300049581 Bacteria 5474
388 Ga0501047_0067470 3300049581 Bacteria 3447
389 Ga0501047_0131075 3300049581 Bacteria 2388
390 Ga0501047_1022487 3300049581 Bacteria 640
391 Ga0501048_0011113 3300049582 Bacteria 6712
392 Ga0501067_0052213 3300049583 Bacteria 2265
393 Ga0501069_0046832 3300049585 Bacteria 2399
394 Ga0501070_0040496 3300049586 Bacteria 3884
395 Ga0501070_0140077 3300049586 Bacteria 1997
396 Ga0501070_1020633 3300049586 Bacteria 641
397 Ga0501071_0017824 3300049587 Bacteria 4906
398 Ga0501073_0025654 3300049589 Bacteria 4224
399 Ga0501074_0036804 3300049590 Bacteria 3545
400 Ga0501079_0626898 3300049741 Bacteria 846
401 Ga0501081_1402653 3300049743 Bacteria 530
402 Ga0501083_0123857 3300049744 Bacteria 1695
403 Ga0501083_0208141 3300049744 Bacteria 1275
404 Ga0501083_0629922 3300049744 Bacteria 698
405 Ga0501035_0000008 3300049822 Bacteria 313425
406 Ga0501035_0006060 3300049822 Bacteria 11385
407 Ga0501035_0382772 3300049822 Bacteria 1173
408 Ga0501044_0000001 3300049823 Bacteria 418087
409 Ga0501044_0898798 3300049823 Bacteria 760
410 nmdc:mga03683_123728_c1 3300050489 Bacteria 1152
411 nmdc:mga03683_329117_c1 3300050489 Bacteria 720
412 nmdc:mga03n38_132271_c1 3300050490 Bacteria 1238
413 nmdc:mga03n38_176614_c1 3300050490 Bacteria 1091
414 nmdc:mga03n38_31248_c1 3300050490 Bacteria 2245
415 nmdc:mga03n38_819593_c1 3300050490 Bacteria 543
416 nmdc:mga00v17_172769_c1 3300050491 Bacteria 1394
417 nmdc:mga00v17_275713_c1 3300050491 Bacteria 1091
418 nmdc:mga00v17_477679_c1 3300050491 Bacteria 809
419 nmdc:mga0yw44_1051339_c1 3300050492 Bacteria 551
420 nmdc:mga0yw44_136862_c1 3300050492 Bacteria 1590
421 nmdc:mga0yw44_27585_c1 3300050492 Bacteria 3255
422 nmdc:mga0yw44_31499_c1 3300050492 Bacteria 3084
423 nmdc:mga0yw44_40628_c1 3300050492 Bacteria 2765
424 nmdc:mga0yw44_813359_c1 3300050492 Bacteria 634
425 nmdc:mga0k408_241855_c1 3300050493 Bacteria 1078
426 nmdc:mga0k408_594732_c1 3300050493 Bacteria 653
427 nmdc:mga06z11_176173_c1 3300050494 Bacteria 1231
428 nmdc:mga06z11_432088_c1 3300050494 Bacteria 794
429 nmdc:mga06z11_435201_c1 3300050494 Bacteria 791
430 nmdc:mga06z11_447249_c1 3300050494 Bacteria 780
431 nmdc:mga06z11_455408_c1 3300050494 Bacteria 773
432 nmdc:mga06z11_610861_c1 3300050494 Bacteria 663
433 nmdc:mga06z11_723661_c1 3300050494 Bacteria 606
434 nmdc:mga07m45_501521_c1 3300050496 Bacteria 703
435 nmdc:mga07m45_685588_c1 3300050496 Bacteria 590
436 nmdc:mga07m45_829171_c1 3300050496 Unclassified 530
437 nmdc:mga05p37_761041_c1 3300050507 Bacteria 1066
438 nmdc:mga06r32_413308_c1 3300050510 Bacteria 1331
439 nmdc:mga08y16_178555_c1 3300050511 Bacteria 2205
440 nmdc:mga0a205_1025195_c1 3300050515 Bacteria 672
441 nmdc:mga0sz30_143009_c1 3300050516 Bacteria 1056
442 nmdc:mga0sz30_189624_c1 3300050516 Bacteria 913
443 nmdc:mga0sz30_259377_c1 3300050516 Bacteria 774
444 nmdc:mga0sz30_34186_c1 3300050516 Bacteria 1363
445 nmdc:mga0sz30_60396_c1 3300050516 Bacteria 1619
446 Ga0495655_0040997 3300053083 Bacteria 1182
447 Ga0495655_0142739 3300053083 Bacteria 747
448 Ga0495655_0334696 3300053083 Bacteria 527
449 Ga0500562_045892 3300053108 Bacteria 1165
450 Ga0500562_056714 3300053108 Bacteria 1050
451 Ga0500595_166235 3300053119 Bacteria 614
452 Ga0500618_014442 3300053125 Bacteria 2016
453 Ga0500658_0027919 3300053134 Bacteria 2186
454 Ga0500564_180429 3300053138 Bacteria 881
455 Ga0500568_0182487 3300053139 Bacteria 771
456 Ga0500604_0031803 3300053151 Bacteria 1551
457 Ga0500620_000248 3300053155 Bacteria 10498
458 Ga0500622_0000697 3300053156 Bacteria 29561
459 Ga0500627_0070824 3300053158 Bacteria 1544
460 Ga0500627_0439212 3300053158 Bacteria 551
461 Ga0500611_044176 3300053727 Bacteria 992
462 Ga0587089_050373 3300059509 Bacteria 667
463 Ga0501082_0144077 3300060353 Bacteria 2068

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10753988 Ga0065707_107539882 65
2 3300005334 Ga0068869_100055689 Ga0068869_1000556894 65
3 3300005336 Ga0070680_100003117 Ga0070680_1000031174 65
4 3300005341 Ga0070691_10013745 Ga0070691_100137454 65
5 3300005345 Ga0070692_10196571 Ga0070692_101965712 65
6 3300005364 Ga0070673_101258202 Ga0070673_1012582022 65
7 3300005366 Ga0070659_100598933 Ga0070659_1005989331 65
8 3300005406 Ga0070703_10001384 Ga0070703_100013848 65
9 3300005440 Ga0070705_100002172 Ga0070705_1000021727 65
10 3300005441 Ga0070700_100002573 Ga0070700_1000025734 65
11 3300005444 Ga0070694_100010879 Ga0070694_1000108794 65
12 3300005445 Ga0070708_100040322 Ga0070708_1000403222 65
13 3300005455 Ga0070663_100007077 Ga0070663_1000070777 65
14 3300005457 Ga0070662_100144806 Ga0070662_1001448062 65
15 3300005458 Ga0070681_10270996 Ga0070681_102709962 65
16 3300005467 Ga0070706_101170769 Ga0070706_1011707691 65
17 3300005471 Ga0070698_100298207 Ga0070698_1002982071 65
18 3300005518 Ga0070699_100000444 Ga0070699_10000044416 65
19 3300005536 Ga0070697_100524187 Ga0070697_1005241871 65
20 3300005539 Ga0068853_100450217 Ga0068853_1004502172 65
21 3300005544 Ga0070686_100073482 Ga0070686_1000734824 65
22 3300005545 Ga0070695_100003441 Ga0070695_1000034417 65
23 3300005546 Ga0070696_100000123 Ga0070696_10000012311 65
24 3300005547 Ga0070693_100008394 Ga0070693_1000083944 65
25 3300005549 Ga0070704_100000095 Ga0070704_1000000954 65
26 3300005577 Ga0068857_100003759 Ga0068857_1000037594 65
27 3300005578 Ga0068854_101081198 Ga0068854_1010811982 65
28 3300005615 Ga0070702_100135943 Ga0070702_1001359432 65
29 3300005617 Ga0068859_100001820 Ga0068859_10000182011 65
30 3300005618 Ga0068864_100049303 Ga0068864_1000493034 65
31 3300005841 Ga0068863_100754827 Ga0068863_1007548271 65
32 3300005842 Ga0068858_100613242 Ga0068858_1006132421 65
33 3300005843 Ga0068860_100002696 Ga0068860_10000269610 65
34 3300005844 Ga0068862_100010515 Ga0068862_1000105152 65
35 3300006931 Ga0097620_100001820 Ga0097620_10000182011 65
36 3300009092 Ga0105250_10309477 Ga0105250_103094771 65
37 3300009148 Ga0105243_10133638 Ga0105243_101336384 65
38 3300009553 Ga0105249_10006303 Ga0105249_100063033 65
39 3300010375 Ga0105239_10382828 Ga0105239_103828282 65
40 3300011119 Ga0105246_10659552 Ga0105246_106595523 65
41 3300014326 Ga0157380_11912564 Ga0157380_119125642 65
42 3300014968 Ga0157379_10447854 Ga0157379_104478542 65
43 3300025297 Ga0209758_1023345 Ga0209758_10233455 65
44 3300025885 Ga0207653_10000615 Ga0207653_100006159 65
45 3300025901 Ga0207688_10564965 Ga0207688_105649651 65
46 3300025904 Ga0207647_10141757 Ga0207647_101417571 65
47 3300025910 Ga0207684_10513434 Ga0207684_105134342 65
48 3300025912 Ga0207707_10046627 Ga0207707_100466271 65
49 3300025917 Ga0207660_10001673 Ga0207660_100016738 65
50 3300025923 Ga0207681_11461737 Ga0207681_114617371 65
51 3300025932 Ga0207690_10572061 Ga0207690_105720612 65
52 3300025933 Ga0207706_10046830 Ga0207706_100468304 65
53 3300025938 Ga0207704_10898725 Ga0207704_108987252 65
54 3300025942 Ga0207689_10083686 Ga0207689_100836864 65
55 3300025961 Ga0207712_10006141 Ga0207712_100061416 65
56 3300025981 Ga0207640_11944468 Ga0207640_119444682 65
57 3300026041 Ga0207639_10476083 Ga0207639_104760831 65
58 3300026067 Ga0207678_10006547 Ga0207678_100065473 65
59 3300026075 Ga0207708_10000488 Ga0207708_1000048818 65
60 3300026088 Ga0207641_10190145 Ga0207641_101901451 65
61 3300026095 Ga0207676_10011695 Ga0207676_100116957 65
62 3300026116 Ga0207674_10004426 Ga0207674_100044268 65
63 3300028380 Ga0268265_10007219 Ga0268265_100072194 65
64 3300028381 Ga0268264_10016842 Ga0268264_100168424 65
65 3300034819 Ga0373958_0019203 Ga0373958_0019203_227_445 65
66 3300035084 Ga0373928_0153183 Ga0373928_0153183_395_613 65
67 3300035121 Ga0373960_0291309 Ga0373960_0291309_321_539 65
68 3300048904 Ga0496101_0178353 Ga0496101_0178353_234_452 65
69 3300048905 Ga0496102_0050758 Ga0496102_0050758_2501_2719 65
70 3300048906 Ga0496103_0179539 Ga0496103_0179539_588_806 65
71 3300048907 Ga0496104_0120954 Ga0496104_0120954_64_282 65
72 3300048909 Ga0496106_0002352 Ga0496106_0002352_5255_5473 65
73 3300048910 Ga0496107_0008206 Ga0496107_0008206_2753_2971 65
74 3300048911 Ga0496108_0135187 Ga0496108_0135187_703_921 65
75 3300049568 Ga0501031_0000018 Ga0501031_0000018_50979_51197 65
76 3300049569 Ga0501032_0000003 Ga0501032_0000003_311639_311857 65
77 3300049569 Ga0501032_0331269 Ga0501032_0331269_244_462 65
78 3300049570 Ga0501033_0000132 Ga0501033_0000132_61985_62203 65
79 3300049570 Ga0501033_0680752 Ga0501033_0680752_296_514 65
80 3300049571 Ga0501034_0000005 Ga0501034_0000005_311639_311857 65
81 3300049572 Ga0501036_0000005 Ga0501036_0000005_190507_190725 65
82 3300049573 Ga0501037_0000045 Ga0501037_0000045_61386_61604 65
83 3300049574 Ga0501038_0000001 Ga0501038_0000001_311639_311857 65
84 3300049575 Ga0501039_0000007 Ga0501039_0000007_185318_185536 65
85 3300049576 Ga0501040_0002864 Ga0501040_0002864_9725_9943 65
86 3300049579 Ga0501043_0000333 Ga0501043_0000333_8402_8620 65
87 3300049580 Ga0501046_0581427 Ga0501046_0581427_356_574 65
88 3300049581 Ga0501047_0000708 Ga0501047_0000708_3128_3346 65
89 3300049581 Ga0501047_1022487 Ga0501047_1022487_197_415 65
90 3300049586 Ga0501070_0140077 Ga0501070_0140077_1294_1512 65
91 3300049744 Ga0501083_0629922 Ga0501083_0629922_365_583 65
92 3300049822 Ga0501035_0000008 Ga0501035_0000008_257518_257736 65
93 3300049822 Ga0501035_0382772 Ga0501035_0382772_688_906 65
94 3300049823 Ga0501044_0000001 Ga0501044_0000001_106231_106449 65
95 3300005293 Ga0065715_10870444 Ga0065715_108704442 66
96 3300005328 Ga0070676_10002031 Ga0070676_100020316 66
97 3300005333 Ga0070677_10364789 Ga0070677_103647891 66
98 3300005334 Ga0068869_100035482 Ga0068869_1000354824 66
99 3300005335 Ga0070666_10143595 Ga0070666_101435952 66
100 3300005336 Ga0070680_100377835 Ga0070680_1003778352 66
101 3300005338 Ga0068868_101229991 Ga0068868_1012299912 66
102 3300005340 Ga0070689_101561033 Ga0070689_1015610331 66
103 3300005341 Ga0070691_10035204 Ga0070691_100352044 66
104 3300005343 Ga0070687_100955225 Ga0070687_1009552252 66
105 3300005345 Ga0070692_11322971 Ga0070692_113229711 66
106 3300005347 Ga0070668_100013900 Ga0070668_1000139008 66
107 3300005347 Ga0070668_101107496 Ga0070668_1011074962 66
108 3300005353 Ga0070669_100058453 Ga0070669_1000584532 66
109 3300005355 Ga0070671_100125245 Ga0070671_1001252452 66
110 3300005356 Ga0070674_100000038 Ga0070674_10000003860 66
111 3300005356 Ga0070674_101593276 Ga0070674_1015932762 66
112 3300005364 Ga0070673_100657368 Ga0070673_1006573682 66
113 3300005440 Ga0070705_100003122 Ga0070705_10000312210 66
114 3300005441 Ga0070700_100172261 Ga0070700_1001722612 66
115 3300005444 Ga0070694_100020471 Ga0070694_1000204714 66
116 3300005455 Ga0070663_101158112 Ga0070663_1011581122 66
117 3300005456 Ga0070678_100040605 Ga0070678_1000406054 66
118 3300005456 Ga0070678_101874193 Ga0070678_1018741931 66
119 3300005457 Ga0070662_100001357 Ga0070662_1000013573 66
120 3300005458 Ga0070681_10372195 Ga0070681_103721953 66
121 3300005459 Ga0068867_100001385 Ga0068867_1000013855 66
122 3300005539 Ga0068853_100043228 Ga0068853_1000432286 66
123 3300005543 Ga0070672_100031374 Ga0070672_1000313746 66
124 3300005543 Ga0070672_100711261 Ga0070672_1007112612 66
125 3300005544 Ga0070686_101127663 Ga0070686_1011276632 66
126 3300005545 Ga0070695_100058820 Ga0070695_1000588204 66
127 3300005547 Ga0070693_100074922 Ga0070693_1000749224 66
128 3300005548 Ga0070665_100101677 Ga0070665_1001016773 66
129 3300005548 Ga0070665_101488257 Ga0070665_1014882572 66
130 3300005563 Ga0068855_100145441 Ga0068855_1001454411 66
131 3300005577 Ga0068857_100039289 Ga0068857_1000392894 66
132 3300005577 Ga0068857_101170305 Ga0068857_1011703051 66
133 3300005578 Ga0068854_100003261 Ga0068854_10000326111 66
134 3300005615 Ga0070702_100002667 Ga0070702_10000266711 66
135 3300005616 Ga0068852_100376380 Ga0068852_1003763803 66
136 3300005618 Ga0068864_100084423 Ga0068864_1000844234 66
137 3300005718 Ga0068866_10001243 Ga0068866_100012436 66
138 3300005719 Ga0068861_100233098 Ga0068861_1002330982 66
139 3300005840 Ga0068870_10444217 Ga0068870_104442172 66
140 3300005843 Ga0068860_100058328 Ga0068860_1000583284 66
141 3300005844 Ga0068862_100206368 Ga0068862_1002063684 66
142 3300006038 Ga0075365_10027545 Ga0075365_100275453 66
143 3300006038 Ga0075365_10080429 Ga0075365_100804294 66
144 3300006038 Ga0075365_10081923 Ga0075365_100819235 66
145 3300006038 Ga0075365_10712501 Ga0075365_107125012 66
146 3300006048 Ga0075363_100017221 Ga0075363_1000172214 66
147 3300006048 Ga0075363_100030992 Ga0075363_1000309924 66
148 3300006048 Ga0075363_100390961 Ga0075363_1003909612 66
149 3300006048 Ga0075363_100755360 Ga0075363_1007553601 66
150 3300006051 Ga0075364_10028877 Ga0075364_100288772 66
151 3300006051 Ga0075364_10508163 Ga0075364_105081633 66
152 3300006051 Ga0075364_10966042 Ga0075364_109660422 66
153 3300006177 Ga0075362_10120463 Ga0075362_101204633 66
154 3300006177 Ga0075362_10138977 Ga0075362_101389773 66
155 3300006177 Ga0075362_10577404 Ga0075362_105774042 66
156 3300006178 Ga0075367_10011839 Ga0075367_100118392 66
157 3300006178 Ga0075367_10216779 Ga0075367_102167793 66
158 3300006178 Ga0075367_10321563 Ga0075367_103215632 66
159 3300006178 Ga0075367_10435210 Ga0075367_104352102 66
160 3300006186 Ga0075369_10045501 Ga0075369_100455011 66
161 3300006186 Ga0075369_10267948 Ga0075369_102679481 66
162 3300006186 Ga0075369_10552374 Ga0075369_105523742 66
163 3300006186 Ga0075369_10583693 Ga0075369_105836932 66
164 3300006195 Ga0075366_10512982 Ga0075366_105129822 66
165 3300006237 Ga0097621_100548352 Ga0097621_1005483523 66
166 3300006353 Ga0075370_10198894 Ga0075370_101988942 66
167 3300006353 Ga0075370_10219783 Ga0075370_102197832 66
168 3300006353 Ga0075370_10272621 Ga0075370_102726212 66
169 3300006353 Ga0075370_10478504 Ga0075370_104785041 66
170 3300006358 Ga0068871_100333468 Ga0068871_1003334683 66
171 3300006844 Ga0075428_100117775 Ga0075428_1001177756 66
172 3300006847 Ga0075431_100068139 Ga0075431_1000681394 66
173 3300006852 Ga0075433_10924220 Ga0075433_109242202 66
174 3300006881 Ga0068865_100003522 Ga0068865_10000352211 66
175 3300006881 Ga0068865_100699304 Ga0068865_1006993042 66
176 3300006946 Ga0079104_1030668 Ga0079104_10306682 66
177 3300007788 Ga0099795_10504243 Ga0099795_105042432 66
178 3300009092 Ga0105250_10578097 Ga0105250_105780972 66
179 3300009093 Ga0105240_10284867 Ga0105240_102848673 66
180 3300009098 Ga0105245_10303904 Ga0105245_103039042 66
181 3300009098 Ga0105245_10683109 Ga0105245_106831093 66
182 3300009098 Ga0105245_11359499 Ga0105245_113594992 66
183 3300009101 Ga0105247_11130716 Ga0105247_111307162 66
184 3300009147 Ga0114129_10569367 Ga0114129_105693673 66
185 3300009148 Ga0105243_10004784 Ga0105243_100047847 66
186 3300009148 Ga0105243_10113083 Ga0105243_101130832 66
187 3300009148 Ga0105243_11154379 Ga0105243_111543792 66
188 3300009148 Ga0105243_11264394 Ga0105243_112643942 66
189 3300009174 Ga0105241_10008154 Ga0105241_100081545 66
190 3300009176 Ga0105242_10001493 Ga0105242_1000149317 66
191 3300009176 Ga0105242_10703974 Ga0105242_107039742 66
192 3300009545 Ga0105237_10353992 Ga0105237_103539923 66
193 3300009551 Ga0105238_11931123 Ga0105238_119311232 66
194 3300009551 Ga0105238_12546950 Ga0105238_125469502 66
195 3300009551 Ga0105238_12547136 Ga0105238_125471361 66
196 3300009553 Ga0105249_10010901 Ga0105249_100109012 66
197 3300010159 Ga0099796_10460790 Ga0099796_104607902 66
198 3300010375 Ga0105239_10010913 Ga0105239_100109132 66
199 3300010375 Ga0105239_10965635 Ga0105239_109656353 66
200 3300010375 Ga0105239_12358751 Ga0105239_123587512 66
201 3300011119 Ga0105246_10009353 Ga0105246_100093532 66
202 3300011119 Ga0105246_10894043 Ga0105246_108940433 66
203 3300013102 Ga0157371_10058318 Ga0157371_100583185 66
204 3300013297 Ga0157378_10001549 Ga0157378_1000154925 66
205 3300013297 Ga0157378_10130252 Ga0157378_101302522 66
206 3300013306 Ga0163162_10003514 Ga0163162_100035143 66
207 3300013306 Ga0163162_11101075 Ga0163162_111010753 66
208 3300013307 Ga0157372_10117582 Ga0157372_101175823 66
209 3300013308 Ga0157375_10040015 Ga0157375_100400156 66
210 3300014325 Ga0163163_10604308 Ga0163163_106043082 66
211 3300014968 Ga0157379_10382894 Ga0157379_103828943 66
212 3300014969 Ga0157376_10135900 Ga0157376_101359003 66
213 3300014969 Ga0157376_12320629 Ga0157376_123206292 66
214 3300025261 Ga0209233_1000028 Ga0209233_1000028210 66
215 3300025292 Ga0209676_1019122 Ga0209676_10191222 66
216 3300025304 Ga0209257_1102882 Ga0209257_11028822 66
217 3300025315 Ga0207697_10109255 Ga0207697_101092552 66
218 3300025893 Ga0207682_10147875 Ga0207682_101478753 66
219 3300025899 Ga0207642_10014045 Ga0207642_100140453 66
220 3300025900 Ga0207710_10105001 Ga0207710_101050013 66
221 3300025903 Ga0207680_10162258 Ga0207680_101622582 66
222 3300025907 Ga0207645_10001747 Ga0207645_1000174715 66
223 3300025908 Ga0207643_10011863 Ga0207643_100118632 66
224 3300025911 Ga0207654_10005872 Ga0207654_100058725 66
225 3300025912 Ga0207707_10371148 Ga0207707_103711483 66
226 3300025913 Ga0207695_10258001 Ga0207695_102580013 66
227 3300025914 Ga0207671_11156716 Ga0207671_111567161 66
228 3300025917 Ga0207660_10377012 Ga0207660_103770122 66
229 3300025921 Ga0207652_11618715 Ga0207652_116187151 66
230 3300025923 Ga0207681_10028994 Ga0207681_100289944 66
231 3300025924 Ga0207694_10830246 Ga0207694_108302462 66
232 3300025924 Ga0207694_11635789 Ga0207694_116357892 66
233 3300025927 Ga0207687_10008002 Ga0207687_100080026 66
234 3300025927 Ga0207687_10486315 Ga0207687_104863152 66
235 3300025933 Ga0207706_10000153 Ga0207706_1000015381 66
236 3300025934 Ga0207686_10000844 Ga0207686_1000084417 66
237 3300025934 Ga0207686_10542446 Ga0207686_105424462 66
238 3300025935 Ga0207709_10010489 Ga0207709_100104897 66
239 3300025935 Ga0207709_10392143 Ga0207709_103921432 66
240 3300025935 Ga0207709_11101100 Ga0207709_111011002 66
241 3300025937 Ga0207669_10000659 Ga0207669_1000065917 66
242 3300025937 Ga0207669_11080163 Ga0207669_110801632 66
243 3300025938 Ga0207704_10000636 Ga0207704_1000063615 66
244 3300025938 Ga0207704_10590792 Ga0207704_105907922 66
245 3300025940 Ga0207691_10044496 Ga0207691_100444964 66
246 3300025940 Ga0207691_10793483 Ga0207691_107934832 66
247 3300025941 Ga0207711_10001813 Ga0207711_100018136 66
248 3300025942 Ga0207689_10016325 Ga0207689_1001632511 66
249 3300025949 Ga0207667_10060333 Ga0207667_100603337 66
250 3300025960 Ga0207651_10519815 Ga0207651_105198152 66
251 3300025961 Ga0207712_10018438 Ga0207712_100184388 66
252 3300025972 Ga0207668_10010167 Ga0207668_100101679 66
253 3300025981 Ga0207640_10004393 Ga0207640_1000439312 66
254 3300025981 Ga0207640_10547834 Ga0207640_105478341 66
255 3300026035 Ga0207703_10021228 Ga0207703_100212282 66
256 3300026041 Ga0207639_10268270 Ga0207639_102682701 66
257 3300026041 Ga0207639_10592661 Ga0207639_105926613 66
258 3300026067 Ga0207678_10532033 Ga0207678_105320332 66
259 3300026067 Ga0207678_10840679 Ga0207678_108406791 66
260 3300026075 Ga0207708_10165940 Ga0207708_101659403 66
261 3300026078 Ga0207702_10089828 Ga0207702_100898285 66
262 3300026089 Ga0207648_10000028 Ga0207648_10000028152 66
263 3300026089 Ga0207648_10431822 Ga0207648_104318222 66
264 3300026089 Ga0207648_10684926 Ga0207648_106849262 66
265 3300026095 Ga0207676_10062225 Ga0207676_100622252 66
266 3300026116 Ga0207674_10006635 Ga0207674_1000663514 66
267 3300026116 Ga0207674_10812520 Ga0207674_108125202 66
268 3300026118 Ga0207675_100026163 Ga0207675_1000261632 66
269 3300026121 Ga0207683_10015033 Ga0207683_100150334 66
270 3300026121 Ga0207683_11065341 Ga0207683_110653412 66
271 3300026142 Ga0207698_10194452 Ga0207698_101944521 66
272 3300027111 Ga0209281_1000190 Ga0209281_1000190102 66
273 3300027512 Ga0209179_1155862 Ga0209179_11558621 66
274 3300027866 Ga0209813_10321878 Ga0209813_103218781 66
275 3300027907 Ga0207428_10222236 Ga0207428_102222362 66
276 3300028379 Ga0268266_10020817 Ga0268266_100208178 66
277 3300028379 Ga0268266_10890911 Ga0268266_108909113 66
278 3300028380 Ga0268265_10186006 Ga0268265_101860062 66
279 3300028381 Ga0268264_10002359 Ga0268264_1000235913 66
280 3300031456 Ga0307513_10216130 Ga0307513_102161303 66
281 3300031548 Ga0307408_100284312 Ga0307408_1002843122 66
282 3300031730 Ga0307516_10002523 Ga0307516_1000252318 66
283 3300031824 Ga0307413_10137762 Ga0307413_101377622 66
284 3300031901 Ga0307406_10175388 Ga0307406_101753883 66
285 3300031911 Ga0307412_10544402 Ga0307412_105444022 66
286 3300031911 Ga0307412_10628889 Ga0307412_106288892 66
287 3300031995 Ga0307409_100236557 Ga0307409_1002365573 66
288 3300031995 Ga0307409_102943271 Ga0307409_1029432711 66
289 3300032002 Ga0307416_100658552 Ga0307416_1006585522 66
290 3300032004 Ga0307414_10612709 Ga0307414_106127092 66
291 3300032004 Ga0307414_11300459 Ga0307414_113004592 66
292 3300032126 Ga0307415_101442637 Ga0307415_1014426371 66
293 3300035090 Ga0373949_0175064 Ga0373949_0175064_313_546 66
294 3300035691 Ga0373931_0168852 Ga0373931_0168852_595_828 66
295 3300037853 Ga0436364_0788347 Ga0436364_0788347_2120_2347 66
296 3300037853 Ga0436364_1069531 Ga0436364_1069531_570_791 66
297 3300039437 Ga0436365_1881913 Ga0436365_1881913_15_242 66
298 3300039447 Ga0436361_0695951 Ga0436361_0695951_626_847 66
299 3300039450 Ga0436363_1614222 Ga0436363_1614222_324_545 66
300 3300039453 Ga0436362_0489910 Ga0436362_0489910_220_441 66
301 3300041413 Ga0439465_0098276 Ga0439465_0098276_603_824 66
302 3300041413 Ga0439465_0340117 Ga0439465_0340117_253_474 66
303 3300041452 Ga0451793_0344856 Ga0451793_0344856_1453_1674 66
304 3300041456 Ga0451795_1461890 Ga0451795_1461890_98_319 66
305 3300041501 Ga0451845_0754173 Ga0451845_0754173_106_327 66
306 3300041507 Ga0451851_1362650 Ga0451851_1362650_637_858 66
307 3300041511 Ga0451855_0327471 Ga0451855_0327471_70_291 66
308 3300041512 Ga0451853_2376861 Ga0451853_2376861_37_258 66
309 3300046452 Ga0495617_000346 Ga0495617_000346_15734_15955 66
310 3300046491 Ga0495584_0000824 Ga0495584_0000824_19753_19974 66
311 3300046492 Ga0495585_0003992 Ga0495585_0003992_1753_1974 66
312 3300046507 Ga0495606_0396091 Ga0495606_0396091_360_581 66
313 3300046512 Ga0495610_0121028 Ga0495610_0121028_326_547 66
314 3300046519 Ga0495632_0093516 Ga0495632_0093516_287_508 66
315 3300046520 Ga0495637_0088599 Ga0495637_0088599_562_783 66
316 3300046522 Ga0495643_0358412 Ga0495643_0358412_25_246 66
317 3300046523 Ga0495644_0002261 Ga0495644_0002261_7066_7287 66
318 3300046524 Ga0495648_0409056 Ga0495648_0409056_199_420 66
319 3300046542 Ga0495597_0025540 Ga0495597_0025540_427_648 66
320 3300046557 Ga0495622_0065829 Ga0495622_0065829_1008_1229 66
321 3300046558 Ga0495633_0005455 Ga0495633_0005455_1960_2181 66
322 3300046616 Ga0495668_0191516 Ga0495668_0191516_181_402 66
323 3300046616 Ga0495668_0393728 Ga0495668_0393728_26_247 66
324 3300046648 Ga0495611_0445936 Ga0495611_0445936_31_249 66
325 3300046660 Ga0495625_0022295 Ga0495625_0022295_935_1156 66
326 3300046660 Ga0495625_0448966 Ga0495625_0448966_186_413 66
327 3300046660 Ga0495625_0560212 Ga0495625_0560212_80_301 66
328 3300046684 Ga0495669_0445643 Ga0495669_0445643_93_314 66
329 3300046691 Ga0495670_0149831 Ga0495670_0149831_567_785 66
330 3300046810 Ga0495660_0125107 Ga0495660_0125107_246_467 66
331 3300047318 Ga0495636_0042879 Ga0495636_0042879_571_789 66
332 3300047445 Ga0495677_0001383 Ga0495677_0001383_8416_8637 66
333 3300047445 Ga0495677_0114894 Ga0495677_0114894_339_560 66
334 3300047472 Ga0495686_0266995 Ga0495686_0266995_507_728 66
335 3300048903 Ga0496100_0819656 Ga0496100_0819656_481_699 66
336 3300048905 Ga0496102_0357845 Ga0496102_0357845_212_430 66
337 3300048905 Ga0496102_1446771 Ga0496102_1446771_161_382 66
338 3300048906 Ga0496103_0677765 Ga0496103_0677765_377_595 66
339 3300048907 Ga0496104_0318332 Ga0496104_0318332_651_884 66
340 3300048907 Ga0496104_0440572 Ga0496104_0440572_617_838 66
341 3300048907 Ga0496104_0743192 Ga0496104_0743192_34_255 66
342 3300048908 Ga0496105_0562410 Ga0496105_0562410_395_628 66
343 3300048909 Ga0496106_0018206 Ga0496106_0018206_1729_1947 66
344 3300048911 Ga0496108_0688560 Ga0496108_0688560_70_291 66
345 3300048912 Ga0496109_0324926 Ga0496109_0324926_567_800 66
346 3300048915 Ga0496112_0363809 Ga0496112_0363809_352_585 66
347 3300048915 Ga0496112_1035585 Ga0496112_1035585_436_654 66
348 3300048916 Ga0496113_0288695 Ga0496113_0288695_632_865 66
349 3300048916 Ga0496113_1364366 Ga0496113_1364366_28_249 66
350 3300048917 Ga0496114_0012892 Ga0496114_0012892_6411_6629 66
351 3300048920 Ga0496117_0172411 Ga0496117_0172411_806_1027 66
352 3300048926 Ga0496123_0032061 Ga0496123_0032061_2413_2634 66
353 3300048928 Ga0496125_0223535 Ga0496125_0223535_43_282 66
354 3300048929 Ga0496126_0160952 Ga0496126_0160952_931_1170 66
355 3300049460 Ga0495682_0000089 Ga0495682_0000089_66950_67171 66
356 3300049571 Ga0501034_0039740 Ga0501034_0039740_4363_4590 66
357 3300049581 Ga0501047_0027552 Ga0501047_0027552_49_270 66
358 3300049581 Ga0501047_0131075 Ga0501047_0131075_363_590 66
359 3300049586 Ga0501070_1020633 Ga0501070_1020633_108_329 66
360 3300049743 Ga0501081_1402653 Ga0501081_1402653_100_327 66
361 3300049744 Ga0501083_0208141 Ga0501083_0208141_65_286 66
362 3300050489 nmdc:mga03683_123728_c1 nmdc:mga03683_123728_c1_223_444 66
363 3300050489 nmdc:mga03683_329117_c1 nmdc:mga03683_329117_c1_367_588 66
364 3300050490 nmdc:mga03n38_132271_c1 nmdc:mga03n38_132271_c1_643_864 66
365 3300050490 nmdc:mga03n38_31248_c1 nmdc:mga03n38_31248_c1_858_1079 66
366 3300050490 nmdc:mga03n38_819593_c1 nmdc:mga03n38_819593_c1_302_523 66
367 3300050491 nmdc:mga00v17_172769_c1 nmdc:mga00v17_172769_c1_393_614 66
368 3300050491 nmdc:mga00v17_275713_c1 nmdc:mga00v17_275713_c1_329_550 66
369 3300050491 nmdc:mga00v17_477679_c1 nmdc:mga00v17_477679_c1_13_231 66
370 3300050492 nmdc:mga0yw44_1051339_c1 nmdc:mga0yw44_1051339_c1_119_340 66
371 3300050492 nmdc:mga0yw44_136862_c1 nmdc:mga0yw44_136862_c1_758_979 66
372 3300050492 nmdc:mga0yw44_27585_c1 nmdc:mga0yw44_27585_c1_2767_2985 66
373 3300050492 nmdc:mga0yw44_31499_c1 nmdc:mga0yw44_31499_c1_1046_1267 66
374 3300050492 nmdc:mga0yw44_40628_c1 nmdc:mga0yw44_40628_c1_1817_2038 66
375 3300050492 nmdc:mga0yw44_813359_c1 nmdc:mga0yw44_813359_c1_210_431 66
376 3300050493 nmdc:mga0k408_241855_c1 nmdc:mga0k408_241855_c1_766_987 66
377 3300050493 nmdc:mga0k408_594732_c1 nmdc:mga0k408_594732_c1_39_260 66
378 3300050494 nmdc:mga06z11_176173_c1 nmdc:mga06z11_176173_c1_125_346 66
379 3300050494 nmdc:mga06z11_432088_c1 nmdc:mga06z11_432088_c1_481_702 66
380 3300050494 nmdc:mga06z11_435201_c1 nmdc:mga06z11_435201_c1_187_405 66
381 3300050494 nmdc:mga06z11_610861_c1 nmdc:mga06z11_610861_c1_247_468 66
382 3300050494 nmdc:mga06z11_723661_c1 nmdc:mga06z11_723661_c1_126_347 66
383 3300050496 nmdc:mga07m45_685588_c1 nmdc:mga07m45_685588_c1_359_580 66
384 3300050496 nmdc:mga07m45_829171_c1 nmdc:mga07m45_829171_c1_47_268 66
385 3300050507 nmdc:mga05p37_761041_c1 nmdc:mga05p37_761041_c1_737_955 66
386 3300050510 nmdc:mga06r32_413308_c1 nmdc:mga06r32_413308_c1_445_663 66
387 3300050511 nmdc:mga08y16_178555_c1 nmdc:mga08y16_178555_c1_156_377 66
388 3300050515 nmdc:mga0a205_1025195_c1 nmdc:mga0a205_1025195_c1_344_571 66
389 3300050516 nmdc:mga0sz30_189624_c1 nmdc:mga0sz30_189624_c1_431_652 66
390 3300050516 nmdc:mga0sz30_259377_c1 nmdc:mga0sz30_259377_c1_254_493 66
391 3300050516 nmdc:mga0sz30_34186_c1 nmdc:mga0sz30_34186_c1_1113_1334 66
392 3300050516 nmdc:mga0sz30_60396_c1 nmdc:mga0sz30_60396_c1_1158_1376 66
393 3300053083 Ga0495655_0040997 Ga0495655_0040997_325_546 66
394 3300053083 Ga0495655_0334696 Ga0495655_0334696_261_482 66
395 3300053108 Ga0500562_045892 Ga0500562_045892_356_583 66
396 3300053108 Ga0500562_056714 Ga0500562_056714_680_901 66
397 3300053119 Ga0500595_166235 Ga0500595_166235_359_604 66
398 3300053125 Ga0500618_014442 Ga0500618_014442_1754_1981 66
399 3300053134 Ga0500658_0027919 Ga0500658_0027919_261_482 66
400 3300053138 Ga0500564_180429 Ga0500564_180429_502_720 66
401 3300053139 Ga0500568_0182487 Ga0500568_0182487_257_478 66
402 3300053151 Ga0500604_0031803 Ga0500604_0031803_178_399 66
403 3300053155 Ga0500620_000248 Ga0500620_000248_9632_9853 66
404 3300053158 Ga0500627_0070824 Ga0500627_0070824_1125_1346 66
405 3300053158 Ga0500627_0439212 Ga0500627_0439212_249_470 66
406 3300053727 Ga0500611_044176 Ga0500611_044176_345_572 66
407 3300059509 Ga0587089_050373 Ga0587089_050373_273_494 66
408 3300060353 Ga0501082_0144077 Ga0501082_0144077_790_1011 66
409 3300003323 rootH1_10013604 rootH1_100136043 68
410 3300050516 nmdc:mga0sz30_143009_c1 nmdc:mga0sz30_143009_c1_407_631 70
411 iso_pu_bacteria 2961127735 2961133588 70
412 3300050494 nmdc:mga06z11_447249_c1 nmdc:mga06z11_447249_c1_275_538 71
413 3300046507 Ga0495606_0007401 Ga0495606_0007401_4817_5059 73
414 3300047472 Ga0495686_0285335 Ga0495686_0285335_312_554 73
415 3300048924 Ga0496121_0023145 Ga0496121_0023145_2597_2839 73
416 3300014745 Ga0157377_11107930 Ga0157377_111079302 74
417 3300050496 nmdc:mga07m45_501521_c1 nmdc:mga07m45_501521_c1_178_423 74
418 3300053156 Ga0500622_0000697 Ga0500622_0000697_19595_19879 74
419 3300003320 rootH2_10028723 rootH2_100287233 77
420 3300003323 rootH1_10008025 rootH1_100080252 77
421 3300005262 Ga0065165_1072995 Ga0065165_10729952 77
422 3300013104 Ga0157370_11019091 Ga0157370_110190912 77
423 3300025258 Ga0209129_1000285 Ga0209129_100028519 77
424 3300025292 Ga0209676_1025617 Ga0209676_10256174 77
425 3300025294 Ga0209025_1001792 Ga0209025_100179231 77
426 3300025294 Ga0209025_1006333 Ga0209025_10063334 77
427 3300025295 Ga0209564_1050052 Ga0209564_10500522 77
428 3300025297 Ga0209758_1016045 Ga0209758_10160454 77
429 3300025299 Ga0209256_1044171 Ga0209256_10441712 77
430 3300025303 Ga0209051_1066009 Ga0209051_10660092 77
431 3300031456 Ga0307513_10423466 Ga0307513_104234661 77
432 3300046501 Ga0495607_0020935 Ga0495607_0020935_3282_3551 77
433 3300046538 Ga0495609_0006047 Ga0495609_0006047_70_339 77
434 3300046648 Ga0495611_0003718 Ga0495611_0003718_81_350 77
435 3300046660 Ga0495625_0098989 Ga0495625_0098989_1667_1936 77
436 3300046664 Ga0495659_0008881 Ga0495659_0008881_42_311 77
437 3300046665 Ga0495661_0536861 Ga0495661_0536861_213_482 77
438 3300046692 Ga0495671_0017506 Ga0495671_0017506_70_339 77
439 3300047320 Ga0495672_0007995 Ga0495672_0007995_7557_7826 77
440 3300048919 Ga0496116_0128347 Ga0496116_0128347_387_620 77
441 3300048927 Ga0496124_0573414 Ga0496124_0573414_29_367 77
442 3300049570 Ga0501033_0312025 Ga0501033_0312025_269_532 77
443 3300049571 Ga0501034_0044128 Ga0501034_0044128_3592_3855 77
444 3300049572 Ga0501036_0012728 Ga0501036_0012728_1504_1767 77
445 3300049574 Ga0501038_0022297 Ga0501038_0022297_589_852 77
446 3300049575 Ga0501039_0050623 Ga0501039_0050623_706_969 77
447 3300049578 Ga0501042_1376653 Ga0501042_1376653_59_322 77
448 3300049579 Ga0501043_0081647 Ga0501043_0081647_2045_2308 77
449 3300049580 Ga0501046_0025781 Ga0501046_0025781_785_1048 77
450 3300049581 Ga0501047_0067470 Ga0501047_0067470_571_834 77
451 3300049582 Ga0501048_0011113 Ga0501048_0011113_278_541 77
452 3300049583 Ga0501067_0052213 Ga0501067_0052213_1036_1299 77
453 3300049585 Ga0501069_0046832 Ga0501069_0046832_585_848 77
454 3300049586 Ga0501070_0040496 Ga0501070_0040496_269_532 77
455 3300049587 Ga0501071_0017824 Ga0501071_0017824_4305_4568 77
456 3300049589 Ga0501073_0025654 Ga0501073_0025654_2336_2599 77
457 3300049590 Ga0501074_0036804 Ga0501074_0036804_1338_1601 77
458 3300049741 Ga0501079_0626898 Ga0501079_0626898_46_309 77
459 3300049744 Ga0501083_0123857 Ga0501083_0123857_896_1159 77
460 3300049822 Ga0501035_0006060 Ga0501035_0006060_6122_6385 77
461 3300049823 Ga0501044_0898798 Ga0501044_0898798_229_492 77
462 3300050490 nmdc:mga03n38_176614_c1 nmdc:mga03n38_176614_c1_363_608 77
463 3300050494 nmdc:mga06z11_455408_c1 nmdc:mga06z11_455408_c1_403_648 77
464 3300053083 Ga0495655_0142739 Ga0495655_0142739_207_479 77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v7u-assembly1.cif.gz_A structure of a phage-encoded quorum sensing anti-activator, aqs1 0.8135 16 77
5hyl-assembly1.cif.gz_C crystal structure of dr2231_e47a mutant in complex with dumpnpp and magnesium 0.7862 16 64
4wwb-assembly1.cif.gz_A high-resolution structure of the ni-bound form of the y135f mutant of c. metallidurans cnrxs 0.7827 8 66
4wwf-assembly1.cif.gz_A-3 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7531 8 66
7nhq-assembly1.cif.gz_Z structure of psii-i prime (psii with psb28, and psb34) 0.7515 16 73
ID Description Score Start End Superfamily
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.866 16 72 1.20.120.550
2y39A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8169 8 66 1.20.120.1490
3ae3D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8143 15 73 1.20.1300.10
af_Q16512_13_98_1.10.287.160 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7877 2 64 1.10.287.160
af_A8DYA9_1_129_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7839 11 66 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A849VSM7-F1-model_v4 Uncharacterized protein 0.9884 15 68 GO:0016020
AF-A0A6H0ZYP2-F1-model_v4 Transmembrane protein 0.9638 6 73 GO:0016020
AF-A0A7C6IG58-F1-model_v4 Uncharacterized protein 0.9174 8 63 GO:0016020
AF-A0A1V5WYV3-F1-model_v4 ATP-dependent Clp protease ATP-binding subunit ClpE 0.9139 16 77 GO:0005524
GO:0005737
GO:0006508
GO:0008233
GO:0016020
GO:0016887
GO:0034605
AF-A0A849VSM7-F1-model_v4 Uncharacterized protein 0.8766 15 68 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.59 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map