F449318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 289 | 463 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10423466|Ga0307513_104234661 |
| Length | 89 |
| Sequence | MEDDRGRGQAAFAEVAMNWSHGIRQSHRWLSIVFTLTVVANFAARAVDRAEPSAWITYAPLPPLFLMLVSGLYLFALPHTTKWRSRPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 187 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 188 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 285 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 286 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 288 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.53 |
| Nodule | 0.65 |
| Rhizoplane | 5.39 |
| Rhizosphere | 70.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10028723 | 3300003320 | Bacteria | 2348 |
| 2 | rootH1_10008025 | 3300003323 | Bacteria | 2186 |
| 3 | rootH1_10013604 | 3300003323 | Bacteria | 2073 |
| 4 | Ga0065165_1072995 | 3300005262 | Bacteria | 907 |
| 5 | Ga0065715_10870444 | 3300005293 | Bacteria | 569 |
| 6 | Ga0065707_10753988 | 3300005295 | Bacteria | 617 |
| 7 | Ga0070676_10002031 | 3300005328 | Bacteria | 10277 |
| 8 | Ga0070677_10364789 | 3300005333 | Bacteria | 752 |
| 9 | Ga0068869_100035482 | 3300005334 | Bacteria | 3534 |
| 10 | Ga0068869_100055689 | 3300005334 | Bacteria | 2882 |
| 11 | Ga0070666_10143595 | 3300005335 | Bacteria | 1663 |
| 12 | Ga0070680_100003117 | 3300005336 | Bacteria | 12308 |
| 13 | Ga0070680_100377835 | 3300005336 | Bacteria | 1206 |
| 14 | Ga0068868_101229991 | 3300005338 | Bacteria | 693 |
| 15 | Ga0070689_101561033 | 3300005340 | Bacteria | 599 |
| 16 | Ga0070691_10013745 | 3300005341 | Bacteria | 3714 |
| 17 | Ga0070691_10035204 | 3300005341 | Bacteria | 2357 |
| 18 | Ga0070687_100955225 | 3300005343 | Bacteria | 618 |
| 19 | Ga0070692_10196571 | 3300005345 | Bacteria | 1178 |
| 20 | Ga0070692_11322971 | 3300005345 | Bacteria | 518 |
| 21 | Ga0070668_100013900 | 3300005347 | Bacteria | 6020 |
| 22 | Ga0070668_101107496 | 3300005347 | Bacteria | 715 |
| 23 | Ga0070669_100058453 | 3300005353 | Bacteria | 2830 |
| 24 | Ga0070671_100125245 | 3300005355 | Bacteria | 2163 |
| 25 | Ga0070674_100000038 | 3300005356 | Bacteria | 58036 |
| 26 | Ga0070674_101593276 | 3300005356 | Bacteria | 589 |
| 27 | Ga0070673_100657368 | 3300005364 | Bacteria | 960 |
| 28 | Ga0070673_101258202 | 3300005364 | Bacteria | 694 |
| 29 | Ga0070659_100598933 | 3300005366 | Bacteria | 947 |
| 30 | Ga0070703_10001384 | 3300005406 | Bacteria | 7352 |
| 31 | Ga0070705_100002172 | 3300005440 | Bacteria | 9965 |
| 32 | Ga0070705_100003122 | 3300005440 | Bacteria | 8149 |
| 33 | Ga0070700_100002573 | 3300005441 | Bacteria | 9275 |
| 34 | Ga0070700_100172261 | 3300005441 | Bacteria | 1500 |
| 35 | Ga0070694_100010879 | 3300005444 | Bacteria | 5629 |
| 36 | Ga0070694_100020471 | 3300005444 | Bacteria | 4218 |
| 37 | Ga0070708_100040322 | 3300005445 | Bacteria | 4089 |
| 38 | Ga0070663_100007077 | 3300005455 | Bacteria | 6806 |
| 39 | Ga0070663_101158112 | 3300005455 | Bacteria | 678 |
| 40 | Ga0070678_100040605 | 3300005456 | Bacteria | 3293 |
| 41 | Ga0070678_101874193 | 3300005456 | Bacteria | 566 |
| 42 | Ga0070662_100001357 | 3300005457 | Bacteria | 15034 |
| 43 | Ga0070662_100144806 | 3300005457 | Bacteria | 1845 |
| 44 | Ga0070681_10270996 | 3300005458 | Bacteria | 1609 |
| 45 | Ga0070681_10372195 | 3300005458 | Bacteria | 1339 |
| 46 | Ga0068867_100001385 | 3300005459 | Bacteria | 16768 |
| 47 | Ga0070706_101170769 | 3300005467 | Bacteria | 707 |
| 48 | Ga0070698_100298207 | 3300005471 | Bacteria | 1543 |
| 49 | Ga0070699_100000444 | 3300005518 | Bacteria | 39757 |
| 50 | Ga0070697_100524187 | 3300005536 | Bacteria | 1037 |
| 51 | Ga0068853_100043228 | 3300005539 | Bacteria | 3855 |
| 52 | Ga0068853_100450217 | 3300005539 | Bacteria | 1211 |
| 53 | Ga0070672_100031374 | 3300005543 | Bacteria | 3998 |
| 54 | Ga0070672_100711261 | 3300005543 | Bacteria | 880 |
| 55 | Ga0070686_100073482 | 3300005544 | Bacteria | 2245 |
| 56 | Ga0070686_101127663 | 3300005544 | Bacteria | 649 |
| 57 | Ga0070695_100003441 | 3300005545 | Bacteria | 9246 |
| 58 | Ga0070695_100058820 | 3300005545 | Bacteria | 2486 |
| 59 | Ga0070696_100000123 | 3300005546 | Bacteria | 40797 |
| 60 | Ga0070693_100008394 | 3300005547 | Bacteria | 5090 |
| 61 | Ga0070693_100074922 | 3300005547 | Bacteria | 2003 |
| 62 | Ga0070665_100101677 | 3300005548 | Bacteria | 2878 |
| 63 | Ga0070665_101488257 | 3300005548 | Bacteria | 686 |
| 64 | Ga0070704_100000095 | 3300005549 | Bacteria | 30467 |
| 65 | Ga0068855_100145441 | 3300005563 | Bacteria | 2699 |
| 66 | Ga0068857_100003759 | 3300005577 | Bacteria | 12760 |
| 67 | Ga0068857_100039289 | 3300005577 | Bacteria | 4191 |
| 68 | Ga0068857_101170305 | 3300005577 | Bacteria | 744 |
| 69 | Ga0068854_100003261 | 3300005578 | Bacteria | 10105 |
| 70 | Ga0068854_101081198 | 3300005578 | Bacteria | 714 |
| 71 | Ga0070702_100002667 | 3300005615 | Bacteria | 7789 |
| 72 | Ga0070702_100135943 | 3300005615 | Bacteria | 1559 |
| 73 | Ga0068852_100376380 | 3300005616 | Bacteria | 1392 |
| 74 | Ga0068859_100001820 | 3300005617 | Bacteria | 21717 |
| 75 | Ga0068864_100049303 | 3300005618 | Bacteria | 3623 |
| 76 | Ga0068864_100084423 | 3300005618 | Bacteria | 2790 |
| 77 | Ga0068866_10001243 | 3300005718 | Bacteria | 11055 |
| 78 | Ga0068861_100233098 | 3300005719 | Bacteria | 1562 |
| 79 | Ga0068870_10444217 | 3300005840 | Bacteria | 854 |
| 80 | Ga0068863_100754827 | 3300005841 | Bacteria | 969 |
| 81 | Ga0068858_100613242 | 3300005842 | Bacteria | 1056 |
| 82 | Ga0068860_100002696 | 3300005843 | Bacteria | 18484 |
| 83 | Ga0068860_100058328 | 3300005843 | Bacteria | 3670 |
| 84 | Ga0068862_100010515 | 3300005844 | Bacteria | 7645 |
| 85 | Ga0068862_100206368 | 3300005844 | Bacteria | 1774 |
| 86 | Ga0075365_10027545 | 3300006038 | Bacteria | 3617 |
| 87 | Ga0075365_10080429 | 3300006038 | Bacteria | 2206 |
| 88 | Ga0075365_10081923 | 3300006038 | Bacteria | 2187 |
| 89 | Ga0075365_10712501 | 3300006038 | Bacteria | 709 |
| 90 | Ga0075363_100017221 | 3300006048 | Bacteria | 3580 |
| 91 | Ga0075363_100030992 | 3300006048 | Bacteria | 2771 |
| 92 | Ga0075363_100390961 | 3300006048 | Bacteria | 816 |
| 93 | Ga0075363_100755360 | 3300006048 | Bacteria | 589 |
| 94 | Ga0075364_10028877 | 3300006051 | Bacteria | 3553 |
| 95 | Ga0075364_10508163 | 3300006051 | Bacteria | 824 |
| 96 | Ga0075364_10966042 | 3300006051 | Bacteria | 579 |
| 97 | Ga0075362_10120463 | 3300006177 | Bacteria | 1242 |
| 98 | Ga0075362_10138977 | 3300006177 | Bacteria | 1160 |
| 99 | Ga0075362_10577404 | 3300006177 | Bacteria | 580 |
| 100 | Ga0075367_10011839 | 3300006178 | Bacteria | 4632 |
| 101 | Ga0075367_10216779 | 3300006178 | Bacteria | 1197 |
| 102 | Ga0075367_10321563 | 3300006178 | Bacteria | 975 |
| 103 | Ga0075367_10435210 | 3300006178 | Bacteria | 831 |
| 104 | Ga0075369_10045501 | 3300006186 | Bacteria | 1887 |
| 105 | Ga0075369_10267948 | 3300006186 | Bacteria | 794 |
| 106 | Ga0075369_10552374 | 3300006186 | Bacteria | 549 |
| 107 | Ga0075369_10583693 | 3300006186 | Bacteria | 534 |
| 108 | Ga0075366_10512982 | 3300006195 | Bacteria | 741 |
| 109 | Ga0097621_100548352 | 3300006237 | Bacteria | 1052 |
| 110 | Ga0075370_10198894 | 3300006353 | Bacteria | 1182 |
| 111 | Ga0075370_10219783 | 3300006353 | Bacteria | 1123 |
| 112 | Ga0075370_10272621 | 3300006353 | Bacteria | 1004 |
| 113 | Ga0075370_10478504 | 3300006353 | Bacteria | 750 |
| 114 | Ga0068871_100333468 | 3300006358 | Bacteria | 1338 |
| 115 | Ga0075428_100117775 | 3300006844 | Bacteria | 2894 |
| 116 | Ga0075431_100068139 | 3300006847 | Bacteria | 3672 |
| 117 | Ga0075433_10924220 | 3300006852 | Bacteria | 761 |
| 118 | Ga0068865_100003522 | 3300006881 | Bacteria | 9385 |
| 119 | Ga0068865_100699304 | 3300006881 | Bacteria | 866 |
| 120 | Ga0097620_100001820 | 3300006931 | Bacteria | 21717 |
| 121 | Ga0079104_1030668 | 3300006946 | Bacteria | 1339 |
| 122 | Ga0099795_10504243 | 3300007788 | Bacteria | 565 |
| 123 | Ga0105250_10309477 | 3300009092 | Bacteria | 685 |
| 124 | Ga0105250_10578097 | 3300009092 | Bacteria | 518 |
| 125 | Ga0105240_10284867 | 3300009093 | Bacteria | 1897 |
| 126 | Ga0105245_10303904 | 3300009098 | Bacteria | 1566 |
| 127 | Ga0105245_10683109 | 3300009098 | Bacteria | 1059 |
| 128 | Ga0105245_11359499 | 3300009098 | Bacteria | 760 |
| 129 | Ga0105247_11130716 | 3300009101 | Bacteria | 619 |
| 130 | Ga0114129_10569367 | 3300009147 | Bacteria | 1471 |
| 131 | Ga0105243_10004784 | 3300009148 | Bacteria | 10642 |
| 132 | Ga0105243_10113083 | 3300009148 | Bacteria | 2276 |
| 133 | Ga0105243_10133638 | 3300009148 | Bacteria | 2108 |
| 134 | Ga0105243_11154379 | 3300009148 | Bacteria | 785 |
| 135 | Ga0105243_11264394 | 3300009148 | Bacteria | 754 |
| 136 | Ga0105241_10008154 | 3300009174 | Bacteria | 7714 |
| 137 | Ga0105242_10001493 | 3300009176 | Bacteria | 18419 |
| 138 | Ga0105242_10703974 | 3300009176 | Bacteria | 989 |
| 139 | Ga0105237_10353992 | 3300009545 | Bacteria | 1473 |
| 140 | Ga0105238_11931123 | 3300009551 | Bacteria | 623 |
| 141 | Ga0105238_12546950 | 3300009551 | Bacteria | 548 |
| 142 | Ga0105238_12547136 | 3300009551 | Bacteria | 548 |
| 143 | Ga0105249_10006303 | 3300009553 | Bacteria | 10307 |
| 144 | Ga0105249_10010901 | 3300009553 | Bacteria | 7989 |
| 145 | Ga0099796_10460790 | 3300010159 | Bacteria | 567 |
| 146 | Ga0105239_10010913 | 3300010375 | Bacteria | 10150 |
| 147 | Ga0105239_10382828 | 3300010375 | Bacteria | 1590 |
| 148 | Ga0105239_10965635 | 3300010375 | Bacteria | 979 |
| 149 | Ga0105239_12358751 | 3300010375 | Bacteria | 619 |
| 150 | Ga0105246_10009353 | 3300011119 | Bacteria | 6039 |
| 151 | Ga0105246_10659552 | 3300011119 | Bacteria | 912 |
| 152 | Ga0105246_10894043 | 3300011119 | Bacteria | 796 |
| 153 | Ga0157371_10058318 | 3300013102 | Bacteria | 2738 |
| 154 | Ga0157370_11019091 | 3300013104 | Bacteria | 749 |
| 155 | Ga0157378_10001549 | 3300013297 | Bacteria | 20761 |
| 156 | Ga0157378_10130252 | 3300013297 | Bacteria | 2328 |
| 157 | Ga0163162_10003514 | 3300013306 | Bacteria | 14986 |
| 158 | Ga0163162_11101075 | 3300013306 | Bacteria | 900 |
| 159 | Ga0157372_10117582 | 3300013307 | Bacteria | 3049 |
| 160 | Ga0157375_10040015 | 3300013308 | Bacteria | 4515 |
| 161 | Ga0163163_10604308 | 3300014325 | Bacteria | 1160 |
| 162 | Ga0157380_11912564 | 3300014326 | Bacteria | 654 |
| 163 | Ga0157377_11107930 | 3300014745 | Bacteria | 607 |
| 164 | Ga0157379_10382894 | 3300014968 | Bacteria | 1291 |
| 165 | Ga0157379_10447854 | 3300014968 | Bacteria | 1192 |
| 166 | Ga0157376_10135900 | 3300014969 | Bacteria | 2200 |
| 167 | Ga0157376_12320629 | 3300014969 | Bacteria | 576 |
| 168 | Ga0209129_1000285 | 3300025258 | Bacteria | 48259 |
| 169 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 170 | Ga0209676_1019122 | 3300025292 | Bacteria | 2366 |
| 171 | Ga0209676_1025617 | 3300025292 | Bacteria | 1888 |
| 172 | Ga0209025_1001792 | 3300025294 | Bacteria | 25500 |
| 173 | Ga0209025_1006333 | 3300025294 | Bacteria | 9228 |
| 174 | Ga0209564_1050052 | 3300025295 | Bacteria | 1027 |
| 175 | Ga0209758_1016045 | 3300025297 | Bacteria | 3829 |
| 176 | Ga0209758_1023345 | 3300025297 | Bacteria | 2801 |
| 177 | Ga0209256_1044171 | 3300025299 | Bacteria | 1114 |
| 178 | Ga0209051_1066009 | 3300025303 | Bacteria | 1113 |
| 179 | Ga0209257_1102882 | 3300025304 | Bacteria | 693 |
| 180 | Ga0207697_10109255 | 3300025315 | Bacteria | 1183 |
| 181 | Ga0207653_10000615 | 3300025885 | Bacteria | 12418 |
| 182 | Ga0207682_10147875 | 3300025893 | Bacteria | 1058 |
| 183 | Ga0207642_10014045 | 3300025899 | Bacteria | 2942 |
| 184 | Ga0207710_10105001 | 3300025900 | Bacteria | 1336 |
| 185 | Ga0207688_10564965 | 3300025901 | Bacteria | 715 |
| 186 | Ga0207680_10162258 | 3300025903 | Bacteria | 1500 |
| 187 | Ga0207647_10141757 | 3300025904 | Bacteria | 1409 |
| 188 | Ga0207645_10001747 | 3300025907 | Bacteria | 17636 |
| 189 | Ga0207643_10011863 | 3300025908 | Bacteria | 4703 |
| 190 | Ga0207684_10513434 | 3300025910 | Bacteria | 1027 |
| 191 | Ga0207654_10005872 | 3300025911 | Bacteria | 6186 |
| 192 | Ga0207707_10046627 | 3300025912 | Bacteria | 3775 |
| 193 | Ga0207707_10371148 | 3300025912 | Bacteria | 1231 |
| 194 | Ga0207695_10258001 | 3300025913 | Bacteria | 1641 |
| 195 | Ga0207671_11156716 | 3300025914 | Bacteria | 606 |
| 196 | Ga0207660_10001673 | 3300025917 | Bacteria | 14857 |
| 197 | Ga0207660_10377012 | 3300025917 | Bacteria | 1140 |
| 198 | Ga0207652_11618715 | 3300025921 | Bacteria | 552 |
| 199 | Ga0207681_10028994 | 3300025923 | Bacteria | 3589 |
| 200 | Ga0207681_11461737 | 3300025923 | Bacteria | 573 |
| 201 | Ga0207694_10830246 | 3300025924 | Bacteria | 781 |
| 202 | Ga0207694_11635789 | 3300025924 | Bacteria | 542 |
| 203 | Ga0207687_10008002 | 3300025927 | Bacteria | 6920 |
| 204 | Ga0207687_10486315 | 3300025927 | Bacteria | 1028 |
| 205 | Ga0207690_10572061 | 3300025932 | Bacteria | 920 |
| 206 | Ga0207706_10000153 | 3300025933 | Bacteria | 75743 |
| 207 | Ga0207706_10046830 | 3300025933 | Bacteria | 3828 |
| 208 | Ga0207686_10000844 | 3300025934 | Bacteria | 18615 |
| 209 | Ga0207686_10542446 | 3300025934 | Bacteria | 908 |
| 210 | Ga0207709_10010489 | 3300025935 | Bacteria | 5102 |
| 211 | Ga0207709_10392143 | 3300025935 | Bacteria | 1059 |
| 212 | Ga0207709_11101100 | 3300025935 | Bacteria | 652 |
| 213 | Ga0207669_10000659 | 3300025937 | Bacteria | 14927 |
| 214 | Ga0207669_11080163 | 3300025937 | Bacteria | 677 |
| 215 | Ga0207704_10000636 | 3300025938 | Bacteria | 15497 |
| 216 | Ga0207704_10590792 | 3300025938 | Bacteria | 908 |
| 217 | Ga0207704_10898725 | 3300025938 | Bacteria | 745 |
| 218 | Ga0207691_10044496 | 3300025940 | Bacteria | 4086 |
| 219 | Ga0207691_10793483 | 3300025940 | Bacteria | 796 |
| 220 | Ga0207711_10001813 | 3300025941 | Bacteria | 19515 |
| 221 | Ga0207689_10016325 | 3300025942 | Bacteria | 6289 |
| 222 | Ga0207689_10083686 | 3300025942 | Bacteria | 2623 |
| 223 | Ga0207667_10060333 | 3300025949 | Bacteria | 3970 |
| 224 | Ga0207651_10519815 | 3300025960 | Bacteria | 1031 |
| 225 | Ga0207712_10006141 | 3300025961 | Bacteria | 7572 |
| 226 | Ga0207712_10018438 | 3300025961 | Bacteria | 4546 |
| 227 | Ga0207668_10010167 | 3300025972 | Bacteria | 5675 |
| 228 | Ga0207640_10004393 | 3300025981 | Bacteria | 7642 |
| 229 | Ga0207640_10547834 | 3300025981 | Bacteria | 971 |
| 230 | Ga0207640_11944468 | 3300025981 | Bacteria | 532 |
| 231 | Ga0207703_10021228 | 3300026035 | Bacteria | 5083 |
| 232 | Ga0207639_10268270 | 3300026041 | Bacteria | 1496 |
| 233 | Ga0207639_10476083 | 3300026041 | Bacteria | 1137 |
| 234 | Ga0207639_10592661 | 3300026041 | Bacteria | 1021 |
| 235 | Ga0207678_10006547 | 3300026067 | Bacteria | 10327 |
| 236 | Ga0207678_10532033 | 3300026067 | Bacteria | 1026 |
| 237 | Ga0207678_10840679 | 3300026067 | Bacteria | 811 |
| 238 | Ga0207708_10000488 | 3300026075 | Bacteria | 30463 |
| 239 | Ga0207708_10165940 | 3300026075 | Bacteria | 1746 |
| 240 | Ga0207702_10089828 | 3300026078 | Bacteria | 2687 |
| 241 | Ga0207641_10190145 | 3300026088 | Bacteria | 1886 |
| 242 | Ga0207648_10000028 | 3300026089 | Bacteria | 130116 |
| 243 | Ga0207648_10431822 | 3300026089 | Bacteria | 1197 |
| 244 | Ga0207648_10684926 | 3300026089 | Bacteria | 949 |
| 245 | Ga0207676_10011695 | 3300026095 | Bacteria | 6278 |
| 246 | Ga0207676_10062225 | 3300026095 | Bacteria | 2959 |
| 247 | Ga0207674_10004426 | 3300026116 | Bacteria | 16895 |
| 248 | Ga0207674_10006635 | 3300026116 | Bacteria | 13598 |
| 249 | Ga0207674_10812520 | 3300026116 | Bacteria | 902 |
| 250 | Ga0207675_100026163 | 3300026118 | Bacteria | 5432 |
| 251 | Ga0207683_10015033 | 3300026121 | Bacteria | 6587 |
| 252 | Ga0207683_11065341 | 3300026121 | Bacteria | 750 |
| 253 | Ga0207698_10194452 | 3300026142 | Bacteria | 1811 |
| 254 | Ga0209281_1000190 | 3300027111 | Bacteria | 140658 |
| 255 | Ga0209179_1155862 | 3300027512 | Bacteria | 510 |
| 256 | Ga0209813_10321878 | 3300027866 | Bacteria | 606 |
| 257 | Ga0207428_10222236 | 3300027907 | Bacteria | 1415 |
| 258 | Ga0268266_10020817 | 3300028379 | Bacteria | 5593 |
| 259 | Ga0268266_10890911 | 3300028379 | Bacteria | 860 |
| 260 | Ga0268265_10007219 | 3300028380 | Bacteria | 7508 |
| 261 | Ga0268265_10186006 | 3300028380 | Bacteria | 1789 |
| 262 | Ga0268264_10002359 | 3300028381 | Bacteria | 16660 |
| 263 | Ga0268264_10016842 | 3300028381 | Bacteria | 5983 |
| 264 | Ga0307513_10216130 | 3300031456 | Bacteria | 1743 |
| 265 | Ga0307513_10423466 | 3300031456 | Bacteria | 1061 |
| 266 | Ga0307408_100284312 | 3300031548 | Bacteria | 1379 |
| 267 | Ga0307516_10002523 | 3300031730 | Bacteria | 24368 |
| 268 | Ga0307413_10137762 | 3300031824 | Bacteria | 1681 |
| 269 | Ga0307406_10175388 | 3300031901 | Bacteria | 1556 |
| 270 | Ga0307412_10544402 | 3300031911 | Bacteria | 974 |
| 271 | Ga0307412_10628889 | 3300031911 | Unclassified | 913 |
| 272 | Ga0307409_100236557 | 3300031995 | Bacteria | 1660 |
| 273 | Ga0307409_102943271 | 3300031995 | Bacteria | 503 |
| 274 | Ga0307416_100658552 | 3300032002 | Bacteria | 1133 |
| 275 | Ga0307414_10612709 | 3300032004 | Bacteria | 977 |
| 276 | Ga0307414_11300459 | 3300032004 | Bacteria | 675 |
| 277 | Ga0307415_101442637 | 3300032126 | Bacteria | 657 |
| 278 | Ga0373958_0019203 | 3300034819 | Bacteria | 1247 |
| 279 | Ga0373928_0153183 | 3300035084 | Bacteria | 640 |
| 280 | Ga0373949_0175064 | 3300035090 | Bacteria | 633 |
| 281 | Ga0373960_0291309 | 3300035121 | Bacteria | 604 |
| 282 | Ga0373931_0168852 | 3300035691 | Bacteria | 1288 |
| 283 | Ga0436364_0788347 | 3300037853 | Bacteria | 2708 |
| 284 | Ga0436364_1069531 | 3300037853 | Bacteria | 964 |
| 285 | Ga0436365_1881913 | 3300039437 | Bacteria | 821 |
| 286 | Ga0436361_0695951 | 3300039447 | Bacteria | 2551 |
| 287 | Ga0436363_1614222 | 3300039450 | Bacteria | 1511 |
| 288 | Ga0436362_0489910 | 3300039453 | Bacteria | 549 |
| 289 | Ga0439465_0098276 | 3300041413 | Bacteria | 1008 |
| 290 | Ga0439465_0340117 | 3300041413 | Bacteria | 566 |
| 291 | Ga0451793_0344856 | 3300041452 | Bacteria | 3656 |
| 292 | Ga0451795_1461890 | 3300041456 | Bacteria | 961 |
| 293 | Ga0451845_0754173 | 3300041501 | Bacteria | 593 |
| 294 | Ga0451851_1362650 | 3300041507 | Bacteria | 990 |
| 295 | Ga0451855_0327471 | 3300041511 | Unclassified | 837 |
| 296 | Ga0451853_2376861 | 3300041512 | Bacteria | 952 |
| 297 | Ga0495617_000346 | 3300046452 | Bacteria | 25591 |
| 298 | Ga0495584_0000824 | 3300046491 | Bacteria | 20361 |
| 299 | Ga0495585_0003992 | 3300046492 | Bacteria | 9722 |
| 300 | Ga0495607_0020935 | 3300046501 | Bacteria | 4121 |
| 301 | Ga0495606_0007401 | 3300046507 | Bacteria | 9843 |
| 302 | Ga0495606_0396091 | 3300046507 | Bacteria | 720 |
| 303 | Ga0495610_0121028 | 3300046512 | Bacteria | 1147 |
| 304 | Ga0495632_0093516 | 3300046519 | Bacteria | 1423 |
| 305 | Ga0495637_0088599 | 3300046520 | Bacteria | 1224 |
| 306 | Ga0495643_0358412 | 3300046522 | Bacteria | 651 |
| 307 | Ga0495644_0002261 | 3300046523 | Bacteria | 7705 |
| 308 | Ga0495648_0409056 | 3300046524 | Bacteria | 604 |
| 309 | Ga0495609_0006047 | 3300046538 | Bacteria | 6234 |
| 310 | Ga0495597_0025540 | 3300046542 | Bacteria | 2719 |
| 311 | Ga0495622_0065829 | 3300046557 | Bacteria | 1675 |
| 312 | Ga0495633_0005455 | 3300046558 | Bacteria | 7765 |
| 313 | Ga0495668_0191516 | 3300046616 | Bacteria | 1120 |
| 314 | Ga0495668_0393728 | 3300046616 | Bacteria | 761 |
| 315 | Ga0495611_0003718 | 3300046648 | Bacteria | 6671 |
| 316 | Ga0495611_0445936 | 3300046648 | Bacteria | 590 |
| 317 | Ga0495625_0022295 | 3300046660 | Bacteria | 4859 |
| 318 | Ga0495625_0098989 | 3300046660 | Bacteria | 2005 |
| 319 | Ga0495625_0448966 | 3300046660 | Bacteria | 797 |
| 320 | Ga0495625_0560212 | 3300046660 | Bacteria | 691 |
| 321 | Ga0495659_0008881 | 3300046664 | Bacteria | 3201 |
| 322 | Ga0495661_0536861 | 3300046665 | Bacteria | 554 |
| 323 | Ga0495669_0445643 | 3300046684 | Bacteria | 629 |
| 324 | Ga0495670_0149831 | 3300046691 | Bacteria | 1223 |
| 325 | Ga0495671_0017506 | 3300046692 | Bacteria | 3814 |
| 326 | Ga0495660_0125107 | 3300046810 | Bacteria | 1296 |
| 327 | Ga0495636_0042879 | 3300047318 | Bacteria | 1881 |
| 328 | Ga0495672_0007995 | 3300047320 | Bacteria | 7875 |
| 329 | Ga0495677_0001383 | 3300047445 | Bacteria | 9700 |
| 330 | Ga0495677_0114894 | 3300047445 | Bacteria | 1024 |
| 331 | Ga0495686_0266995 | 3300047472 | Bacteria | 956 |
| 332 | Ga0495686_0285335 | 3300047472 | Bacteria | 916 |
| 333 | Ga0496100_0819656 | 3300048903 | Bacteria | 729 |
| 334 | Ga0496101_0178353 | 3300048904 | Bacteria | 1635 |
| 335 | Ga0496102_0050758 | 3300048905 | Bacteria | 3778 |
| 336 | Ga0496102_0357845 | 3300048905 | Bacteria | 1374 |
| 337 | Ga0496102_1446771 | 3300048905 | Bacteria | 606 |
| 338 | Ga0496103_0179539 | 3300048906 | Bacteria | 1360 |
| 339 | Ga0496103_0677765 | 3300048906 | Bacteria | 654 |
| 340 | Ga0496104_0120954 | 3300048907 | Bacteria | 2514 |
| 341 | Ga0496104_0318332 | 3300048907 | Bacteria | 1469 |
| 342 | Ga0496104_0440572 | 3300048907 | Bacteria | 1215 |
| 343 | Ga0496104_0743192 | 3300048907 | Bacteria | 888 |
| 344 | Ga0496105_0562410 | 3300048908 | Bacteria | 889 |
| 345 | Ga0496106_0002352 | 3300048909 | Bacteria | 14089 |
| 346 | Ga0496106_0018206 | 3300048909 | Bacteria | 5194 |
| 347 | Ga0496107_0008206 | 3300048910 | Bacteria | 7222 |
| 348 | Ga0496108_0135187 | 3300048911 | Bacteria | 2121 |
| 349 | Ga0496108_0688560 | 3300048911 | Bacteria | 887 |
| 350 | Ga0496109_0324926 | 3300048912 | Bacteria | 1452 |
| 351 | Ga0496112_0363809 | 3300048915 | Bacteria | 1388 |
| 352 | Ga0496112_1035585 | 3300048915 | Bacteria | 740 |
| 353 | Ga0496113_0288695 | 3300048916 | Bacteria | 1312 |
| 354 | Ga0496113_1364366 | 3300048916 | Bacteria | 550 |
| 355 | Ga0496114_0012892 | 3300048917 | Bacteria | 6696 |
| 356 | Ga0496116_0128347 | 3300048919 | Bacteria | 1451 |
| 357 | Ga0496117_0172411 | 3300048920 | Bacteria | 1254 |
| 358 | Ga0496121_0023145 | 3300048924 | Bacteria | 5997 |
| 359 | Ga0496123_0032061 | 3300048926 | Bacteria | 3812 |
| 360 | Ga0496124_0573414 | 3300048927 | Bacteria | 740 |
| 361 | Ga0496125_0223535 | 3300048928 | Bacteria | 1211 |
| 362 | Ga0496126_0160952 | 3300048929 | Bacteria | 1918 |
| 363 | Ga0495682_0000089 | 3300049460 | Bacteria | 80020 |
| 364 | Ga0501031_0000018 | 3300049568 | Bacteria | 106734 |
| 365 | Ga0501032_0000003 | 3300049569 | Bacteria | 317700 |
| 366 | Ga0501032_0331269 | 3300049569 | Bacteria | 982 |
| 367 | Ga0501033_0000132 | 3300049570 | Bacteria | 72558 |
| 368 | Ga0501033_0312025 | 3300049570 | Bacteria | 1105 |
| 369 | Ga0501033_0680752 | 3300049570 | Bacteria | 701 |
| 370 | Ga0501034_0000005 | 3300049571 | Bacteria | 367512 |
| 371 | Ga0501034_0039740 | 3300049571 | Bacteria | 4765 |
| 372 | Ga0501034_0044128 | 3300049571 | Bacteria | 4509 |
| 373 | Ga0501036_0000005 | 3300049572 | Bacteria | 246420 |
| 374 | Ga0501036_0012728 | 3300049572 | Bacteria | 6979 |
| 375 | Ga0501037_0000045 | 3300049573 | Bacteria | 117148 |
| 376 | Ga0501038_0000001 | 3300049574 | Bacteria | 375481 |
| 377 | Ga0501038_0022297 | 3300049574 | Bacteria | 5676 |
| 378 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 379 | Ga0501039_0050623 | 3300049575 | Bacteria | 3214 |
| 380 | Ga0501040_0002864 | 3300049576 | Bacteria | 11141 |
| 381 | Ga0501042_1376653 | 3300049578 | Bacteria | 514 |
| 382 | Ga0501043_0000333 | 3300049579 | Bacteria | 42740 |
| 383 | Ga0501043_0081647 | 3300049579 | Bacteria | 2540 |
| 384 | Ga0501046_0025781 | 3300049580 | Bacteria | 4807 |
| 385 | Ga0501046_0581427 | 3300049580 | Bacteria | 796 |
| 386 | Ga0501047_0000708 | 3300049581 | Bacteria | 34744 |
| 387 | Ga0501047_0027552 | 3300049581 | Bacteria | 5474 |
| 388 | Ga0501047_0067470 | 3300049581 | Bacteria | 3447 |
| 389 | Ga0501047_0131075 | 3300049581 | Bacteria | 2388 |
| 390 | Ga0501047_1022487 | 3300049581 | Bacteria | 640 |
| 391 | Ga0501048_0011113 | 3300049582 | Bacteria | 6712 |
| 392 | Ga0501067_0052213 | 3300049583 | Bacteria | 2265 |
| 393 | Ga0501069_0046832 | 3300049585 | Bacteria | 2399 |
| 394 | Ga0501070_0040496 | 3300049586 | Bacteria | 3884 |
| 395 | Ga0501070_0140077 | 3300049586 | Bacteria | 1997 |
| 396 | Ga0501070_1020633 | 3300049586 | Bacteria | 641 |
| 397 | Ga0501071_0017824 | 3300049587 | Bacteria | 4906 |
| 398 | Ga0501073_0025654 | 3300049589 | Bacteria | 4224 |
| 399 | Ga0501074_0036804 | 3300049590 | Bacteria | 3545 |
| 400 | Ga0501079_0626898 | 3300049741 | Bacteria | 846 |
| 401 | Ga0501081_1402653 | 3300049743 | Bacteria | 530 |
| 402 | Ga0501083_0123857 | 3300049744 | Bacteria | 1695 |
| 403 | Ga0501083_0208141 | 3300049744 | Bacteria | 1275 |
| 404 | Ga0501083_0629922 | 3300049744 | Bacteria | 698 |
| 405 | Ga0501035_0000008 | 3300049822 | Bacteria | 313425 |
| 406 | Ga0501035_0006060 | 3300049822 | Bacteria | 11385 |
| 407 | Ga0501035_0382772 | 3300049822 | Bacteria | 1173 |
| 408 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 409 | Ga0501044_0898798 | 3300049823 | Bacteria | 760 |
| 410 | nmdc:mga03683_123728_c1 | 3300050489 | Bacteria | 1152 |
| 411 | nmdc:mga03683_329117_c1 | 3300050489 | Bacteria | 720 |
| 412 | nmdc:mga03n38_132271_c1 | 3300050490 | Bacteria | 1238 |
| 413 | nmdc:mga03n38_176614_c1 | 3300050490 | Bacteria | 1091 |
| 414 | nmdc:mga03n38_31248_c1 | 3300050490 | Bacteria | 2245 |
| 415 | nmdc:mga03n38_819593_c1 | 3300050490 | Bacteria | 543 |
| 416 | nmdc:mga00v17_172769_c1 | 3300050491 | Bacteria | 1394 |
| 417 | nmdc:mga00v17_275713_c1 | 3300050491 | Bacteria | 1091 |
| 418 | nmdc:mga00v17_477679_c1 | 3300050491 | Bacteria | 809 |
| 419 | nmdc:mga0yw44_1051339_c1 | 3300050492 | Bacteria | 551 |
| 420 | nmdc:mga0yw44_136862_c1 | 3300050492 | Bacteria | 1590 |
| 421 | nmdc:mga0yw44_27585_c1 | 3300050492 | Bacteria | 3255 |
| 422 | nmdc:mga0yw44_31499_c1 | 3300050492 | Bacteria | 3084 |
| 423 | nmdc:mga0yw44_40628_c1 | 3300050492 | Bacteria | 2765 |
| 424 | nmdc:mga0yw44_813359_c1 | 3300050492 | Bacteria | 634 |
| 425 | nmdc:mga0k408_241855_c1 | 3300050493 | Bacteria | 1078 |
| 426 | nmdc:mga0k408_594732_c1 | 3300050493 | Bacteria | 653 |
| 427 | nmdc:mga06z11_176173_c1 | 3300050494 | Bacteria | 1231 |
| 428 | nmdc:mga06z11_432088_c1 | 3300050494 | Bacteria | 794 |
| 429 | nmdc:mga06z11_435201_c1 | 3300050494 | Bacteria | 791 |
| 430 | nmdc:mga06z11_447249_c1 | 3300050494 | Bacteria | 780 |
| 431 | nmdc:mga06z11_455408_c1 | 3300050494 | Bacteria | 773 |
| 432 | nmdc:mga06z11_610861_c1 | 3300050494 | Bacteria | 663 |
| 433 | nmdc:mga06z11_723661_c1 | 3300050494 | Bacteria | 606 |
| 434 | nmdc:mga07m45_501521_c1 | 3300050496 | Bacteria | 703 |
| 435 | nmdc:mga07m45_685588_c1 | 3300050496 | Bacteria | 590 |
| 436 | nmdc:mga07m45_829171_c1 | 3300050496 | Unclassified | 530 |
| 437 | nmdc:mga05p37_761041_c1 | 3300050507 | Bacteria | 1066 |
| 438 | nmdc:mga06r32_413308_c1 | 3300050510 | Bacteria | 1331 |
| 439 | nmdc:mga08y16_178555_c1 | 3300050511 | Bacteria | 2205 |
| 440 | nmdc:mga0a205_1025195_c1 | 3300050515 | Bacteria | 672 |
| 441 | nmdc:mga0sz30_143009_c1 | 3300050516 | Bacteria | 1056 |
| 442 | nmdc:mga0sz30_189624_c1 | 3300050516 | Bacteria | 913 |
| 443 | nmdc:mga0sz30_259377_c1 | 3300050516 | Bacteria | 774 |
| 444 | nmdc:mga0sz30_34186_c1 | 3300050516 | Bacteria | 1363 |
| 445 | nmdc:mga0sz30_60396_c1 | 3300050516 | Bacteria | 1619 |
| 446 | Ga0495655_0040997 | 3300053083 | Bacteria | 1182 |
| 447 | Ga0495655_0142739 | 3300053083 | Bacteria | 747 |
| 448 | Ga0495655_0334696 | 3300053083 | Bacteria | 527 |
| 449 | Ga0500562_045892 | 3300053108 | Bacteria | 1165 |
| 450 | Ga0500562_056714 | 3300053108 | Bacteria | 1050 |
| 451 | Ga0500595_166235 | 3300053119 | Bacteria | 614 |
| 452 | Ga0500618_014442 | 3300053125 | Bacteria | 2016 |
| 453 | Ga0500658_0027919 | 3300053134 | Bacteria | 2186 |
| 454 | Ga0500564_180429 | 3300053138 | Bacteria | 881 |
| 455 | Ga0500568_0182487 | 3300053139 | Bacteria | 771 |
| 456 | Ga0500604_0031803 | 3300053151 | Bacteria | 1551 |
| 457 | Ga0500620_000248 | 3300053155 | Bacteria | 10498 |
| 458 | Ga0500622_0000697 | 3300053156 | Bacteria | 29561 |
| 459 | Ga0500627_0070824 | 3300053158 | Bacteria | 1544 |
| 460 | Ga0500627_0439212 | 3300053158 | Bacteria | 551 |
| 461 | Ga0500611_044176 | 3300053727 | Bacteria | 992 |
| 462 | Ga0587089_050373 | 3300059509 | Bacteria | 667 |
| 463 | Ga0501082_0144077 | 3300060353 | Bacteria | 2068 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10753988 | Ga0065707_107539882 | 65 |
| 2 | 3300005334 | Ga0068869_100055689 | Ga0068869_1000556894 | 65 |
| 3 | 3300005336 | Ga0070680_100003117 | Ga0070680_1000031174 | 65 |
| 4 | 3300005341 | Ga0070691_10013745 | Ga0070691_100137454 | 65 |
| 5 | 3300005345 | Ga0070692_10196571 | Ga0070692_101965712 | 65 |
| 6 | 3300005364 | Ga0070673_101258202 | Ga0070673_1012582022 | 65 |
| 7 | 3300005366 | Ga0070659_100598933 | Ga0070659_1005989331 | 65 |
| 8 | 3300005406 | Ga0070703_10001384 | Ga0070703_100013848 | 65 |
| 9 | 3300005440 | Ga0070705_100002172 | Ga0070705_1000021727 | 65 |
| 10 | 3300005441 | Ga0070700_100002573 | Ga0070700_1000025734 | 65 |
| 11 | 3300005444 | Ga0070694_100010879 | Ga0070694_1000108794 | 65 |
| 12 | 3300005445 | Ga0070708_100040322 | Ga0070708_1000403222 | 65 |
| 13 | 3300005455 | Ga0070663_100007077 | Ga0070663_1000070777 | 65 |
| 14 | 3300005457 | Ga0070662_100144806 | Ga0070662_1001448062 | 65 |
| 15 | 3300005458 | Ga0070681_10270996 | Ga0070681_102709962 | 65 |
| 16 | 3300005467 | Ga0070706_101170769 | Ga0070706_1011707691 | 65 |
| 17 | 3300005471 | Ga0070698_100298207 | Ga0070698_1002982071 | 65 |
| 18 | 3300005518 | Ga0070699_100000444 | Ga0070699_10000044416 | 65 |
| 19 | 3300005536 | Ga0070697_100524187 | Ga0070697_1005241871 | 65 |
| 20 | 3300005539 | Ga0068853_100450217 | Ga0068853_1004502172 | 65 |
| 21 | 3300005544 | Ga0070686_100073482 | Ga0070686_1000734824 | 65 |
| 22 | 3300005545 | Ga0070695_100003441 | Ga0070695_1000034417 | 65 |
| 23 | 3300005546 | Ga0070696_100000123 | Ga0070696_10000012311 | 65 |
| 24 | 3300005547 | Ga0070693_100008394 | Ga0070693_1000083944 | 65 |
| 25 | 3300005549 | Ga0070704_100000095 | Ga0070704_1000000954 | 65 |
| 26 | 3300005577 | Ga0068857_100003759 | Ga0068857_1000037594 | 65 |
| 27 | 3300005578 | Ga0068854_101081198 | Ga0068854_1010811982 | 65 |
| 28 | 3300005615 | Ga0070702_100135943 | Ga0070702_1001359432 | 65 |
| 29 | 3300005617 | Ga0068859_100001820 | Ga0068859_10000182011 | 65 |
| 30 | 3300005618 | Ga0068864_100049303 | Ga0068864_1000493034 | 65 |
| 31 | 3300005841 | Ga0068863_100754827 | Ga0068863_1007548271 | 65 |
| 32 | 3300005842 | Ga0068858_100613242 | Ga0068858_1006132421 | 65 |
| 33 | 3300005843 | Ga0068860_100002696 | Ga0068860_10000269610 | 65 |
| 34 | 3300005844 | Ga0068862_100010515 | Ga0068862_1000105152 | 65 |
| 35 | 3300006931 | Ga0097620_100001820 | Ga0097620_10000182011 | 65 |
| 36 | 3300009092 | Ga0105250_10309477 | Ga0105250_103094771 | 65 |
| 37 | 3300009148 | Ga0105243_10133638 | Ga0105243_101336384 | 65 |
| 38 | 3300009553 | Ga0105249_10006303 | Ga0105249_100063033 | 65 |
| 39 | 3300010375 | Ga0105239_10382828 | Ga0105239_103828282 | 65 |
| 40 | 3300011119 | Ga0105246_10659552 | Ga0105246_106595523 | 65 |
| 41 | 3300014326 | Ga0157380_11912564 | Ga0157380_119125642 | 65 |
| 42 | 3300014968 | Ga0157379_10447854 | Ga0157379_104478542 | 65 |
| 43 | 3300025297 | Ga0209758_1023345 | Ga0209758_10233455 | 65 |
| 44 | 3300025885 | Ga0207653_10000615 | Ga0207653_100006159 | 65 |
| 45 | 3300025901 | Ga0207688_10564965 | Ga0207688_105649651 | 65 |
| 46 | 3300025904 | Ga0207647_10141757 | Ga0207647_101417571 | 65 |
| 47 | 3300025910 | Ga0207684_10513434 | Ga0207684_105134342 | 65 |
| 48 | 3300025912 | Ga0207707_10046627 | Ga0207707_100466271 | 65 |
| 49 | 3300025917 | Ga0207660_10001673 | Ga0207660_100016738 | 65 |
| 50 | 3300025923 | Ga0207681_11461737 | Ga0207681_114617371 | 65 |
| 51 | 3300025932 | Ga0207690_10572061 | Ga0207690_105720612 | 65 |
| 52 | 3300025933 | Ga0207706_10046830 | Ga0207706_100468304 | 65 |
| 53 | 3300025938 | Ga0207704_10898725 | Ga0207704_108987252 | 65 |
| 54 | 3300025942 | Ga0207689_10083686 | Ga0207689_100836864 | 65 |
| 55 | 3300025961 | Ga0207712_10006141 | Ga0207712_100061416 | 65 |
| 56 | 3300025981 | Ga0207640_11944468 | Ga0207640_119444682 | 65 |
| 57 | 3300026041 | Ga0207639_10476083 | Ga0207639_104760831 | 65 |
| 58 | 3300026067 | Ga0207678_10006547 | Ga0207678_100065473 | 65 |
| 59 | 3300026075 | Ga0207708_10000488 | Ga0207708_1000048818 | 65 |
| 60 | 3300026088 | Ga0207641_10190145 | Ga0207641_101901451 | 65 |
| 61 | 3300026095 | Ga0207676_10011695 | Ga0207676_100116957 | 65 |
| 62 | 3300026116 | Ga0207674_10004426 | Ga0207674_100044268 | 65 |
| 63 | 3300028380 | Ga0268265_10007219 | Ga0268265_100072194 | 65 |
| 64 | 3300028381 | Ga0268264_10016842 | Ga0268264_100168424 | 65 |
| 65 | 3300034819 | Ga0373958_0019203 | Ga0373958_0019203_227_445 | 65 |
| 66 | 3300035084 | Ga0373928_0153183 | Ga0373928_0153183_395_613 | 65 |
| 67 | 3300035121 | Ga0373960_0291309 | Ga0373960_0291309_321_539 | 65 |
| 68 | 3300048904 | Ga0496101_0178353 | Ga0496101_0178353_234_452 | 65 |
| 69 | 3300048905 | Ga0496102_0050758 | Ga0496102_0050758_2501_2719 | 65 |
| 70 | 3300048906 | Ga0496103_0179539 | Ga0496103_0179539_588_806 | 65 |
| 71 | 3300048907 | Ga0496104_0120954 | Ga0496104_0120954_64_282 | 65 |
| 72 | 3300048909 | Ga0496106_0002352 | Ga0496106_0002352_5255_5473 | 65 |
| 73 | 3300048910 | Ga0496107_0008206 | Ga0496107_0008206_2753_2971 | 65 |
| 74 | 3300048911 | Ga0496108_0135187 | Ga0496108_0135187_703_921 | 65 |
| 75 | 3300049568 | Ga0501031_0000018 | Ga0501031_0000018_50979_51197 | 65 |
| 76 | 3300049569 | Ga0501032_0000003 | Ga0501032_0000003_311639_311857 | 65 |
| 77 | 3300049569 | Ga0501032_0331269 | Ga0501032_0331269_244_462 | 65 |
| 78 | 3300049570 | Ga0501033_0000132 | Ga0501033_0000132_61985_62203 | 65 |
| 79 | 3300049570 | Ga0501033_0680752 | Ga0501033_0680752_296_514 | 65 |
| 80 | 3300049571 | Ga0501034_0000005 | Ga0501034_0000005_311639_311857 | 65 |
| 81 | 3300049572 | Ga0501036_0000005 | Ga0501036_0000005_190507_190725 | 65 |
| 82 | 3300049573 | Ga0501037_0000045 | Ga0501037_0000045_61386_61604 | 65 |
| 83 | 3300049574 | Ga0501038_0000001 | Ga0501038_0000001_311639_311857 | 65 |
| 84 | 3300049575 | Ga0501039_0000007 | Ga0501039_0000007_185318_185536 | 65 |
| 85 | 3300049576 | Ga0501040_0002864 | Ga0501040_0002864_9725_9943 | 65 |
| 86 | 3300049579 | Ga0501043_0000333 | Ga0501043_0000333_8402_8620 | 65 |
| 87 | 3300049580 | Ga0501046_0581427 | Ga0501046_0581427_356_574 | 65 |
| 88 | 3300049581 | Ga0501047_0000708 | Ga0501047_0000708_3128_3346 | 65 |
| 89 | 3300049581 | Ga0501047_1022487 | Ga0501047_1022487_197_415 | 65 |
| 90 | 3300049586 | Ga0501070_0140077 | Ga0501070_0140077_1294_1512 | 65 |
| 91 | 3300049744 | Ga0501083_0629922 | Ga0501083_0629922_365_583 | 65 |
| 92 | 3300049822 | Ga0501035_0000008 | Ga0501035_0000008_257518_257736 | 65 |
| 93 | 3300049822 | Ga0501035_0382772 | Ga0501035_0382772_688_906 | 65 |
| 94 | 3300049823 | Ga0501044_0000001 | Ga0501044_0000001_106231_106449 | 65 |
| 95 | 3300005293 | Ga0065715_10870444 | Ga0065715_108704442 | 66 |
| 96 | 3300005328 | Ga0070676_10002031 | Ga0070676_100020316 | 66 |
| 97 | 3300005333 | Ga0070677_10364789 | Ga0070677_103647891 | 66 |
| 98 | 3300005334 | Ga0068869_100035482 | Ga0068869_1000354824 | 66 |
| 99 | 3300005335 | Ga0070666_10143595 | Ga0070666_101435952 | 66 |
| 100 | 3300005336 | Ga0070680_100377835 | Ga0070680_1003778352 | 66 |
| 101 | 3300005338 | Ga0068868_101229991 | Ga0068868_1012299912 | 66 |
| 102 | 3300005340 | Ga0070689_101561033 | Ga0070689_1015610331 | 66 |
| 103 | 3300005341 | Ga0070691_10035204 | Ga0070691_100352044 | 66 |
| 104 | 3300005343 | Ga0070687_100955225 | Ga0070687_1009552252 | 66 |
| 105 | 3300005345 | Ga0070692_11322971 | Ga0070692_113229711 | 66 |
| 106 | 3300005347 | Ga0070668_100013900 | Ga0070668_1000139008 | 66 |
| 107 | 3300005347 | Ga0070668_101107496 | Ga0070668_1011074962 | 66 |
| 108 | 3300005353 | Ga0070669_100058453 | Ga0070669_1000584532 | 66 |
| 109 | 3300005355 | Ga0070671_100125245 | Ga0070671_1001252452 | 66 |
| 110 | 3300005356 | Ga0070674_100000038 | Ga0070674_10000003860 | 66 |
| 111 | 3300005356 | Ga0070674_101593276 | Ga0070674_1015932762 | 66 |
| 112 | 3300005364 | Ga0070673_100657368 | Ga0070673_1006573682 | 66 |
| 113 | 3300005440 | Ga0070705_100003122 | Ga0070705_10000312210 | 66 |
| 114 | 3300005441 | Ga0070700_100172261 | Ga0070700_1001722612 | 66 |
| 115 | 3300005444 | Ga0070694_100020471 | Ga0070694_1000204714 | 66 |
| 116 | 3300005455 | Ga0070663_101158112 | Ga0070663_1011581122 | 66 |
| 117 | 3300005456 | Ga0070678_100040605 | Ga0070678_1000406054 | 66 |
| 118 | 3300005456 | Ga0070678_101874193 | Ga0070678_1018741931 | 66 |
| 119 | 3300005457 | Ga0070662_100001357 | Ga0070662_1000013573 | 66 |
| 120 | 3300005458 | Ga0070681_10372195 | Ga0070681_103721953 | 66 |
| 121 | 3300005459 | Ga0068867_100001385 | Ga0068867_1000013855 | 66 |
| 122 | 3300005539 | Ga0068853_100043228 | Ga0068853_1000432286 | 66 |
| 123 | 3300005543 | Ga0070672_100031374 | Ga0070672_1000313746 | 66 |
| 124 | 3300005543 | Ga0070672_100711261 | Ga0070672_1007112612 | 66 |
| 125 | 3300005544 | Ga0070686_101127663 | Ga0070686_1011276632 | 66 |
| 126 | 3300005545 | Ga0070695_100058820 | Ga0070695_1000588204 | 66 |
| 127 | 3300005547 | Ga0070693_100074922 | Ga0070693_1000749224 | 66 |
| 128 | 3300005548 | Ga0070665_100101677 | Ga0070665_1001016773 | 66 |
| 129 | 3300005548 | Ga0070665_101488257 | Ga0070665_1014882572 | 66 |
| 130 | 3300005563 | Ga0068855_100145441 | Ga0068855_1001454411 | 66 |
| 131 | 3300005577 | Ga0068857_100039289 | Ga0068857_1000392894 | 66 |
| 132 | 3300005577 | Ga0068857_101170305 | Ga0068857_1011703051 | 66 |
| 133 | 3300005578 | Ga0068854_100003261 | Ga0068854_10000326111 | 66 |
| 134 | 3300005615 | Ga0070702_100002667 | Ga0070702_10000266711 | 66 |
| 135 | 3300005616 | Ga0068852_100376380 | Ga0068852_1003763803 | 66 |
| 136 | 3300005618 | Ga0068864_100084423 | Ga0068864_1000844234 | 66 |
| 137 | 3300005718 | Ga0068866_10001243 | Ga0068866_100012436 | 66 |
| 138 | 3300005719 | Ga0068861_100233098 | Ga0068861_1002330982 | 66 |
| 139 | 3300005840 | Ga0068870_10444217 | Ga0068870_104442172 | 66 |
| 140 | 3300005843 | Ga0068860_100058328 | Ga0068860_1000583284 | 66 |
| 141 | 3300005844 | Ga0068862_100206368 | Ga0068862_1002063684 | 66 |
| 142 | 3300006038 | Ga0075365_10027545 | Ga0075365_100275453 | 66 |
| 143 | 3300006038 | Ga0075365_10080429 | Ga0075365_100804294 | 66 |
| 144 | 3300006038 | Ga0075365_10081923 | Ga0075365_100819235 | 66 |
| 145 | 3300006038 | Ga0075365_10712501 | Ga0075365_107125012 | 66 |
| 146 | 3300006048 | Ga0075363_100017221 | Ga0075363_1000172214 | 66 |
| 147 | 3300006048 | Ga0075363_100030992 | Ga0075363_1000309924 | 66 |
| 148 | 3300006048 | Ga0075363_100390961 | Ga0075363_1003909612 | 66 |
| 149 | 3300006048 | Ga0075363_100755360 | Ga0075363_1007553601 | 66 |
| 150 | 3300006051 | Ga0075364_10028877 | Ga0075364_100288772 | 66 |
| 151 | 3300006051 | Ga0075364_10508163 | Ga0075364_105081633 | 66 |
| 152 | 3300006051 | Ga0075364_10966042 | Ga0075364_109660422 | 66 |
| 153 | 3300006177 | Ga0075362_10120463 | Ga0075362_101204633 | 66 |
| 154 | 3300006177 | Ga0075362_10138977 | Ga0075362_101389773 | 66 |
| 155 | 3300006177 | Ga0075362_10577404 | Ga0075362_105774042 | 66 |
| 156 | 3300006178 | Ga0075367_10011839 | Ga0075367_100118392 | 66 |
| 157 | 3300006178 | Ga0075367_10216779 | Ga0075367_102167793 | 66 |
| 158 | 3300006178 | Ga0075367_10321563 | Ga0075367_103215632 | 66 |
| 159 | 3300006178 | Ga0075367_10435210 | Ga0075367_104352102 | 66 |
| 160 | 3300006186 | Ga0075369_10045501 | Ga0075369_100455011 | 66 |
| 161 | 3300006186 | Ga0075369_10267948 | Ga0075369_102679481 | 66 |
| 162 | 3300006186 | Ga0075369_10552374 | Ga0075369_105523742 | 66 |
| 163 | 3300006186 | Ga0075369_10583693 | Ga0075369_105836932 | 66 |
| 164 | 3300006195 | Ga0075366_10512982 | Ga0075366_105129822 | 66 |
| 165 | 3300006237 | Ga0097621_100548352 | Ga0097621_1005483523 | 66 |
| 166 | 3300006353 | Ga0075370_10198894 | Ga0075370_101988942 | 66 |
| 167 | 3300006353 | Ga0075370_10219783 | Ga0075370_102197832 | 66 |
| 168 | 3300006353 | Ga0075370_10272621 | Ga0075370_102726212 | 66 |
| 169 | 3300006353 | Ga0075370_10478504 | Ga0075370_104785041 | 66 |
| 170 | 3300006358 | Ga0068871_100333468 | Ga0068871_1003334683 | 66 |
| 171 | 3300006844 | Ga0075428_100117775 | Ga0075428_1001177756 | 66 |
| 172 | 3300006847 | Ga0075431_100068139 | Ga0075431_1000681394 | 66 |
| 173 | 3300006852 | Ga0075433_10924220 | Ga0075433_109242202 | 66 |
| 174 | 3300006881 | Ga0068865_100003522 | Ga0068865_10000352211 | 66 |
| 175 | 3300006881 | Ga0068865_100699304 | Ga0068865_1006993042 | 66 |
| 176 | 3300006946 | Ga0079104_1030668 | Ga0079104_10306682 | 66 |
| 177 | 3300007788 | Ga0099795_10504243 | Ga0099795_105042432 | 66 |
| 178 | 3300009092 | Ga0105250_10578097 | Ga0105250_105780972 | 66 |
| 179 | 3300009093 | Ga0105240_10284867 | Ga0105240_102848673 | 66 |
| 180 | 3300009098 | Ga0105245_10303904 | Ga0105245_103039042 | 66 |
| 181 | 3300009098 | Ga0105245_10683109 | Ga0105245_106831093 | 66 |
| 182 | 3300009098 | Ga0105245_11359499 | Ga0105245_113594992 | 66 |
| 183 | 3300009101 | Ga0105247_11130716 | Ga0105247_111307162 | 66 |
| 184 | 3300009147 | Ga0114129_10569367 | Ga0114129_105693673 | 66 |
| 185 | 3300009148 | Ga0105243_10004784 | Ga0105243_100047847 | 66 |
| 186 | 3300009148 | Ga0105243_10113083 | Ga0105243_101130832 | 66 |
| 187 | 3300009148 | Ga0105243_11154379 | Ga0105243_111543792 | 66 |
| 188 | 3300009148 | Ga0105243_11264394 | Ga0105243_112643942 | 66 |
| 189 | 3300009174 | Ga0105241_10008154 | Ga0105241_100081545 | 66 |
| 190 | 3300009176 | Ga0105242_10001493 | Ga0105242_1000149317 | 66 |
| 191 | 3300009176 | Ga0105242_10703974 | Ga0105242_107039742 | 66 |
| 192 | 3300009545 | Ga0105237_10353992 | Ga0105237_103539923 | 66 |
| 193 | 3300009551 | Ga0105238_11931123 | Ga0105238_119311232 | 66 |
| 194 | 3300009551 | Ga0105238_12546950 | Ga0105238_125469502 | 66 |
| 195 | 3300009551 | Ga0105238_12547136 | Ga0105238_125471361 | 66 |
| 196 | 3300009553 | Ga0105249_10010901 | Ga0105249_100109012 | 66 |
| 197 | 3300010159 | Ga0099796_10460790 | Ga0099796_104607902 | 66 |
| 198 | 3300010375 | Ga0105239_10010913 | Ga0105239_100109132 | 66 |
| 199 | 3300010375 | Ga0105239_10965635 | Ga0105239_109656353 | 66 |
| 200 | 3300010375 | Ga0105239_12358751 | Ga0105239_123587512 | 66 |
| 201 | 3300011119 | Ga0105246_10009353 | Ga0105246_100093532 | 66 |
| 202 | 3300011119 | Ga0105246_10894043 | Ga0105246_108940433 | 66 |
| 203 | 3300013102 | Ga0157371_10058318 | Ga0157371_100583185 | 66 |
| 204 | 3300013297 | Ga0157378_10001549 | Ga0157378_1000154925 | 66 |
| 205 | 3300013297 | Ga0157378_10130252 | Ga0157378_101302522 | 66 |
| 206 | 3300013306 | Ga0163162_10003514 | Ga0163162_100035143 | 66 |
| 207 | 3300013306 | Ga0163162_11101075 | Ga0163162_111010753 | 66 |
| 208 | 3300013307 | Ga0157372_10117582 | Ga0157372_101175823 | 66 |
| 209 | 3300013308 | Ga0157375_10040015 | Ga0157375_100400156 | 66 |
| 210 | 3300014325 | Ga0163163_10604308 | Ga0163163_106043082 | 66 |
| 211 | 3300014968 | Ga0157379_10382894 | Ga0157379_103828943 | 66 |
| 212 | 3300014969 | Ga0157376_10135900 | Ga0157376_101359003 | 66 |
| 213 | 3300014969 | Ga0157376_12320629 | Ga0157376_123206292 | 66 |
| 214 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028210 | 66 |
| 215 | 3300025292 | Ga0209676_1019122 | Ga0209676_10191222 | 66 |
| 216 | 3300025304 | Ga0209257_1102882 | Ga0209257_11028822 | 66 |
| 217 | 3300025315 | Ga0207697_10109255 | Ga0207697_101092552 | 66 |
| 218 | 3300025893 | Ga0207682_10147875 | Ga0207682_101478753 | 66 |
| 219 | 3300025899 | Ga0207642_10014045 | Ga0207642_100140453 | 66 |
| 220 | 3300025900 | Ga0207710_10105001 | Ga0207710_101050013 | 66 |
| 221 | 3300025903 | Ga0207680_10162258 | Ga0207680_101622582 | 66 |
| 222 | 3300025907 | Ga0207645_10001747 | Ga0207645_1000174715 | 66 |
| 223 | 3300025908 | Ga0207643_10011863 | Ga0207643_100118632 | 66 |
| 224 | 3300025911 | Ga0207654_10005872 | Ga0207654_100058725 | 66 |
| 225 | 3300025912 | Ga0207707_10371148 | Ga0207707_103711483 | 66 |
| 226 | 3300025913 | Ga0207695_10258001 | Ga0207695_102580013 | 66 |
| 227 | 3300025914 | Ga0207671_11156716 | Ga0207671_111567161 | 66 |
| 228 | 3300025917 | Ga0207660_10377012 | Ga0207660_103770122 | 66 |
| 229 | 3300025921 | Ga0207652_11618715 | Ga0207652_116187151 | 66 |
| 230 | 3300025923 | Ga0207681_10028994 | Ga0207681_100289944 | 66 |
| 231 | 3300025924 | Ga0207694_10830246 | Ga0207694_108302462 | 66 |
| 232 | 3300025924 | Ga0207694_11635789 | Ga0207694_116357892 | 66 |
| 233 | 3300025927 | Ga0207687_10008002 | Ga0207687_100080026 | 66 |
| 234 | 3300025927 | Ga0207687_10486315 | Ga0207687_104863152 | 66 |
| 235 | 3300025933 | Ga0207706_10000153 | Ga0207706_1000015381 | 66 |
| 236 | 3300025934 | Ga0207686_10000844 | Ga0207686_1000084417 | 66 |
| 237 | 3300025934 | Ga0207686_10542446 | Ga0207686_105424462 | 66 |
| 238 | 3300025935 | Ga0207709_10010489 | Ga0207709_100104897 | 66 |
| 239 | 3300025935 | Ga0207709_10392143 | Ga0207709_103921432 | 66 |
| 240 | 3300025935 | Ga0207709_11101100 | Ga0207709_111011002 | 66 |
| 241 | 3300025937 | Ga0207669_10000659 | Ga0207669_1000065917 | 66 |
| 242 | 3300025937 | Ga0207669_11080163 | Ga0207669_110801632 | 66 |
| 243 | 3300025938 | Ga0207704_10000636 | Ga0207704_1000063615 | 66 |
| 244 | 3300025938 | Ga0207704_10590792 | Ga0207704_105907922 | 66 |
| 245 | 3300025940 | Ga0207691_10044496 | Ga0207691_100444964 | 66 |
| 246 | 3300025940 | Ga0207691_10793483 | Ga0207691_107934832 | 66 |
| 247 | 3300025941 | Ga0207711_10001813 | Ga0207711_100018136 | 66 |
| 248 | 3300025942 | Ga0207689_10016325 | Ga0207689_1001632511 | 66 |
| 249 | 3300025949 | Ga0207667_10060333 | Ga0207667_100603337 | 66 |
| 250 | 3300025960 | Ga0207651_10519815 | Ga0207651_105198152 | 66 |
| 251 | 3300025961 | Ga0207712_10018438 | Ga0207712_100184388 | 66 |
| 252 | 3300025972 | Ga0207668_10010167 | Ga0207668_100101679 | 66 |
| 253 | 3300025981 | Ga0207640_10004393 | Ga0207640_1000439312 | 66 |
| 254 | 3300025981 | Ga0207640_10547834 | Ga0207640_105478341 | 66 |
| 255 | 3300026035 | Ga0207703_10021228 | Ga0207703_100212282 | 66 |
| 256 | 3300026041 | Ga0207639_10268270 | Ga0207639_102682701 | 66 |
| 257 | 3300026041 | Ga0207639_10592661 | Ga0207639_105926613 | 66 |
| 258 | 3300026067 | Ga0207678_10532033 | Ga0207678_105320332 | 66 |
| 259 | 3300026067 | Ga0207678_10840679 | Ga0207678_108406791 | 66 |
| 260 | 3300026075 | Ga0207708_10165940 | Ga0207708_101659403 | 66 |
| 261 | 3300026078 | Ga0207702_10089828 | Ga0207702_100898285 | 66 |
| 262 | 3300026089 | Ga0207648_10000028 | Ga0207648_10000028152 | 66 |
| 263 | 3300026089 | Ga0207648_10431822 | Ga0207648_104318222 | 66 |
| 264 | 3300026089 | Ga0207648_10684926 | Ga0207648_106849262 | 66 |
| 265 | 3300026095 | Ga0207676_10062225 | Ga0207676_100622252 | 66 |
| 266 | 3300026116 | Ga0207674_10006635 | Ga0207674_1000663514 | 66 |
| 267 | 3300026116 | Ga0207674_10812520 | Ga0207674_108125202 | 66 |
| 268 | 3300026118 | Ga0207675_100026163 | Ga0207675_1000261632 | 66 |
| 269 | 3300026121 | Ga0207683_10015033 | Ga0207683_100150334 | 66 |
| 270 | 3300026121 | Ga0207683_11065341 | Ga0207683_110653412 | 66 |
| 271 | 3300026142 | Ga0207698_10194452 | Ga0207698_101944521 | 66 |
| 272 | 3300027111 | Ga0209281_1000190 | Ga0209281_1000190102 | 66 |
| 273 | 3300027512 | Ga0209179_1155862 | Ga0209179_11558621 | 66 |
| 274 | 3300027866 | Ga0209813_10321878 | Ga0209813_103218781 | 66 |
| 275 | 3300027907 | Ga0207428_10222236 | Ga0207428_102222362 | 66 |
| 276 | 3300028379 | Ga0268266_10020817 | Ga0268266_100208178 | 66 |
| 277 | 3300028379 | Ga0268266_10890911 | Ga0268266_108909113 | 66 |
| 278 | 3300028380 | Ga0268265_10186006 | Ga0268265_101860062 | 66 |
| 279 | 3300028381 | Ga0268264_10002359 | Ga0268264_1000235913 | 66 |
| 280 | 3300031456 | Ga0307513_10216130 | Ga0307513_102161303 | 66 |
| 281 | 3300031548 | Ga0307408_100284312 | Ga0307408_1002843122 | 66 |
| 282 | 3300031730 | Ga0307516_10002523 | Ga0307516_1000252318 | 66 |
| 283 | 3300031824 | Ga0307413_10137762 | Ga0307413_101377622 | 66 |
| 284 | 3300031901 | Ga0307406_10175388 | Ga0307406_101753883 | 66 |
| 285 | 3300031911 | Ga0307412_10544402 | Ga0307412_105444022 | 66 |
| 286 | 3300031911 | Ga0307412_10628889 | Ga0307412_106288892 | 66 |
| 287 | 3300031995 | Ga0307409_100236557 | Ga0307409_1002365573 | 66 |
| 288 | 3300031995 | Ga0307409_102943271 | Ga0307409_1029432711 | 66 |
| 289 | 3300032002 | Ga0307416_100658552 | Ga0307416_1006585522 | 66 |
| 290 | 3300032004 | Ga0307414_10612709 | Ga0307414_106127092 | 66 |
| 291 | 3300032004 | Ga0307414_11300459 | Ga0307414_113004592 | 66 |
| 292 | 3300032126 | Ga0307415_101442637 | Ga0307415_1014426371 | 66 |
| 293 | 3300035090 | Ga0373949_0175064 | Ga0373949_0175064_313_546 | 66 |
| 294 | 3300035691 | Ga0373931_0168852 | Ga0373931_0168852_595_828 | 66 |
| 295 | 3300037853 | Ga0436364_0788347 | Ga0436364_0788347_2120_2347 | 66 |
| 296 | 3300037853 | Ga0436364_1069531 | Ga0436364_1069531_570_791 | 66 |
| 297 | 3300039437 | Ga0436365_1881913 | Ga0436365_1881913_15_242 | 66 |
| 298 | 3300039447 | Ga0436361_0695951 | Ga0436361_0695951_626_847 | 66 |
| 299 | 3300039450 | Ga0436363_1614222 | Ga0436363_1614222_324_545 | 66 |
| 300 | 3300039453 | Ga0436362_0489910 | Ga0436362_0489910_220_441 | 66 |
| 301 | 3300041413 | Ga0439465_0098276 | Ga0439465_0098276_603_824 | 66 |
| 302 | 3300041413 | Ga0439465_0340117 | Ga0439465_0340117_253_474 | 66 |
| 303 | 3300041452 | Ga0451793_0344856 | Ga0451793_0344856_1453_1674 | 66 |
| 304 | 3300041456 | Ga0451795_1461890 | Ga0451795_1461890_98_319 | 66 |
| 305 | 3300041501 | Ga0451845_0754173 | Ga0451845_0754173_106_327 | 66 |
| 306 | 3300041507 | Ga0451851_1362650 | Ga0451851_1362650_637_858 | 66 |
| 307 | 3300041511 | Ga0451855_0327471 | Ga0451855_0327471_70_291 | 66 |
| 308 | 3300041512 | Ga0451853_2376861 | Ga0451853_2376861_37_258 | 66 |
| 309 | 3300046452 | Ga0495617_000346 | Ga0495617_000346_15734_15955 | 66 |
| 310 | 3300046491 | Ga0495584_0000824 | Ga0495584_0000824_19753_19974 | 66 |
| 311 | 3300046492 | Ga0495585_0003992 | Ga0495585_0003992_1753_1974 | 66 |
| 312 | 3300046507 | Ga0495606_0396091 | Ga0495606_0396091_360_581 | 66 |
| 313 | 3300046512 | Ga0495610_0121028 | Ga0495610_0121028_326_547 | 66 |
| 314 | 3300046519 | Ga0495632_0093516 | Ga0495632_0093516_287_508 | 66 |
| 315 | 3300046520 | Ga0495637_0088599 | Ga0495637_0088599_562_783 | 66 |
| 316 | 3300046522 | Ga0495643_0358412 | Ga0495643_0358412_25_246 | 66 |
| 317 | 3300046523 | Ga0495644_0002261 | Ga0495644_0002261_7066_7287 | 66 |
| 318 | 3300046524 | Ga0495648_0409056 | Ga0495648_0409056_199_420 | 66 |
| 319 | 3300046542 | Ga0495597_0025540 | Ga0495597_0025540_427_648 | 66 |
| 320 | 3300046557 | Ga0495622_0065829 | Ga0495622_0065829_1008_1229 | 66 |
| 321 | 3300046558 | Ga0495633_0005455 | Ga0495633_0005455_1960_2181 | 66 |
| 322 | 3300046616 | Ga0495668_0191516 | Ga0495668_0191516_181_402 | 66 |
| 323 | 3300046616 | Ga0495668_0393728 | Ga0495668_0393728_26_247 | 66 |
| 324 | 3300046648 | Ga0495611_0445936 | Ga0495611_0445936_31_249 | 66 |
| 325 | 3300046660 | Ga0495625_0022295 | Ga0495625_0022295_935_1156 | 66 |
| 326 | 3300046660 | Ga0495625_0448966 | Ga0495625_0448966_186_413 | 66 |
| 327 | 3300046660 | Ga0495625_0560212 | Ga0495625_0560212_80_301 | 66 |
| 328 | 3300046684 | Ga0495669_0445643 | Ga0495669_0445643_93_314 | 66 |
| 329 | 3300046691 | Ga0495670_0149831 | Ga0495670_0149831_567_785 | 66 |
| 330 | 3300046810 | Ga0495660_0125107 | Ga0495660_0125107_246_467 | 66 |
| 331 | 3300047318 | Ga0495636_0042879 | Ga0495636_0042879_571_789 | 66 |
| 332 | 3300047445 | Ga0495677_0001383 | Ga0495677_0001383_8416_8637 | 66 |
| 333 | 3300047445 | Ga0495677_0114894 | Ga0495677_0114894_339_560 | 66 |
| 334 | 3300047472 | Ga0495686_0266995 | Ga0495686_0266995_507_728 | 66 |
| 335 | 3300048903 | Ga0496100_0819656 | Ga0496100_0819656_481_699 | 66 |
| 336 | 3300048905 | Ga0496102_0357845 | Ga0496102_0357845_212_430 | 66 |
| 337 | 3300048905 | Ga0496102_1446771 | Ga0496102_1446771_161_382 | 66 |
| 338 | 3300048906 | Ga0496103_0677765 | Ga0496103_0677765_377_595 | 66 |
| 339 | 3300048907 | Ga0496104_0318332 | Ga0496104_0318332_651_884 | 66 |
| 340 | 3300048907 | Ga0496104_0440572 | Ga0496104_0440572_617_838 | 66 |
| 341 | 3300048907 | Ga0496104_0743192 | Ga0496104_0743192_34_255 | 66 |
| 342 | 3300048908 | Ga0496105_0562410 | Ga0496105_0562410_395_628 | 66 |
| 343 | 3300048909 | Ga0496106_0018206 | Ga0496106_0018206_1729_1947 | 66 |
| 344 | 3300048911 | Ga0496108_0688560 | Ga0496108_0688560_70_291 | 66 |
| 345 | 3300048912 | Ga0496109_0324926 | Ga0496109_0324926_567_800 | 66 |
| 346 | 3300048915 | Ga0496112_0363809 | Ga0496112_0363809_352_585 | 66 |
| 347 | 3300048915 | Ga0496112_1035585 | Ga0496112_1035585_436_654 | 66 |
| 348 | 3300048916 | Ga0496113_0288695 | Ga0496113_0288695_632_865 | 66 |
| 349 | 3300048916 | Ga0496113_1364366 | Ga0496113_1364366_28_249 | 66 |
| 350 | 3300048917 | Ga0496114_0012892 | Ga0496114_0012892_6411_6629 | 66 |
| 351 | 3300048920 | Ga0496117_0172411 | Ga0496117_0172411_806_1027 | 66 |
| 352 | 3300048926 | Ga0496123_0032061 | Ga0496123_0032061_2413_2634 | 66 |
| 353 | 3300048928 | Ga0496125_0223535 | Ga0496125_0223535_43_282 | 66 |
| 354 | 3300048929 | Ga0496126_0160952 | Ga0496126_0160952_931_1170 | 66 |
| 355 | 3300049460 | Ga0495682_0000089 | Ga0495682_0000089_66950_67171 | 66 |
| 356 | 3300049571 | Ga0501034_0039740 | Ga0501034_0039740_4363_4590 | 66 |
| 357 | 3300049581 | Ga0501047_0027552 | Ga0501047_0027552_49_270 | 66 |
| 358 | 3300049581 | Ga0501047_0131075 | Ga0501047_0131075_363_590 | 66 |
| 359 | 3300049586 | Ga0501070_1020633 | Ga0501070_1020633_108_329 | 66 |
| 360 | 3300049743 | Ga0501081_1402653 | Ga0501081_1402653_100_327 | 66 |
| 361 | 3300049744 | Ga0501083_0208141 | Ga0501083_0208141_65_286 | 66 |
| 362 | 3300050489 | nmdc:mga03683_123728_c1 | nmdc:mga03683_123728_c1_223_444 | 66 |
| 363 | 3300050489 | nmdc:mga03683_329117_c1 | nmdc:mga03683_329117_c1_367_588 | 66 |
| 364 | 3300050490 | nmdc:mga03n38_132271_c1 | nmdc:mga03n38_132271_c1_643_864 | 66 |
| 365 | 3300050490 | nmdc:mga03n38_31248_c1 | nmdc:mga03n38_31248_c1_858_1079 | 66 |
| 366 | 3300050490 | nmdc:mga03n38_819593_c1 | nmdc:mga03n38_819593_c1_302_523 | 66 |
| 367 | 3300050491 | nmdc:mga00v17_172769_c1 | nmdc:mga00v17_172769_c1_393_614 | 66 |
| 368 | 3300050491 | nmdc:mga00v17_275713_c1 | nmdc:mga00v17_275713_c1_329_550 | 66 |
| 369 | 3300050491 | nmdc:mga00v17_477679_c1 | nmdc:mga00v17_477679_c1_13_231 | 66 |
| 370 | 3300050492 | nmdc:mga0yw44_1051339_c1 | nmdc:mga0yw44_1051339_c1_119_340 | 66 |
| 371 | 3300050492 | nmdc:mga0yw44_136862_c1 | nmdc:mga0yw44_136862_c1_758_979 | 66 |
| 372 | 3300050492 | nmdc:mga0yw44_27585_c1 | nmdc:mga0yw44_27585_c1_2767_2985 | 66 |
| 373 | 3300050492 | nmdc:mga0yw44_31499_c1 | nmdc:mga0yw44_31499_c1_1046_1267 | 66 |
| 374 | 3300050492 | nmdc:mga0yw44_40628_c1 | nmdc:mga0yw44_40628_c1_1817_2038 | 66 |
| 375 | 3300050492 | nmdc:mga0yw44_813359_c1 | nmdc:mga0yw44_813359_c1_210_431 | 66 |
| 376 | 3300050493 | nmdc:mga0k408_241855_c1 | nmdc:mga0k408_241855_c1_766_987 | 66 |
| 377 | 3300050493 | nmdc:mga0k408_594732_c1 | nmdc:mga0k408_594732_c1_39_260 | 66 |
| 378 | 3300050494 | nmdc:mga06z11_176173_c1 | nmdc:mga06z11_176173_c1_125_346 | 66 |
| 379 | 3300050494 | nmdc:mga06z11_432088_c1 | nmdc:mga06z11_432088_c1_481_702 | 66 |
| 380 | 3300050494 | nmdc:mga06z11_435201_c1 | nmdc:mga06z11_435201_c1_187_405 | 66 |
| 381 | 3300050494 | nmdc:mga06z11_610861_c1 | nmdc:mga06z11_610861_c1_247_468 | 66 |
| 382 | 3300050494 | nmdc:mga06z11_723661_c1 | nmdc:mga06z11_723661_c1_126_347 | 66 |
| 383 | 3300050496 | nmdc:mga07m45_685588_c1 | nmdc:mga07m45_685588_c1_359_580 | 66 |
| 384 | 3300050496 | nmdc:mga07m45_829171_c1 | nmdc:mga07m45_829171_c1_47_268 | 66 |
| 385 | 3300050507 | nmdc:mga05p37_761041_c1 | nmdc:mga05p37_761041_c1_737_955 | 66 |
| 386 | 3300050510 | nmdc:mga06r32_413308_c1 | nmdc:mga06r32_413308_c1_445_663 | 66 |
| 387 | 3300050511 | nmdc:mga08y16_178555_c1 | nmdc:mga08y16_178555_c1_156_377 | 66 |
| 388 | 3300050515 | nmdc:mga0a205_1025195_c1 | nmdc:mga0a205_1025195_c1_344_571 | 66 |
| 389 | 3300050516 | nmdc:mga0sz30_189624_c1 | nmdc:mga0sz30_189624_c1_431_652 | 66 |
| 390 | 3300050516 | nmdc:mga0sz30_259377_c1 | nmdc:mga0sz30_259377_c1_254_493 | 66 |
| 391 | 3300050516 | nmdc:mga0sz30_34186_c1 | nmdc:mga0sz30_34186_c1_1113_1334 | 66 |
| 392 | 3300050516 | nmdc:mga0sz30_60396_c1 | nmdc:mga0sz30_60396_c1_1158_1376 | 66 |
| 393 | 3300053083 | Ga0495655_0040997 | Ga0495655_0040997_325_546 | 66 |
| 394 | 3300053083 | Ga0495655_0334696 | Ga0495655_0334696_261_482 | 66 |
| 395 | 3300053108 | Ga0500562_045892 | Ga0500562_045892_356_583 | 66 |
| 396 | 3300053108 | Ga0500562_056714 | Ga0500562_056714_680_901 | 66 |
| 397 | 3300053119 | Ga0500595_166235 | Ga0500595_166235_359_604 | 66 |
| 398 | 3300053125 | Ga0500618_014442 | Ga0500618_014442_1754_1981 | 66 |
| 399 | 3300053134 | Ga0500658_0027919 | Ga0500658_0027919_261_482 | 66 |
| 400 | 3300053138 | Ga0500564_180429 | Ga0500564_180429_502_720 | 66 |
| 401 | 3300053139 | Ga0500568_0182487 | Ga0500568_0182487_257_478 | 66 |
| 402 | 3300053151 | Ga0500604_0031803 | Ga0500604_0031803_178_399 | 66 |
| 403 | 3300053155 | Ga0500620_000248 | Ga0500620_000248_9632_9853 | 66 |
| 404 | 3300053158 | Ga0500627_0070824 | Ga0500627_0070824_1125_1346 | 66 |
| 405 | 3300053158 | Ga0500627_0439212 | Ga0500627_0439212_249_470 | 66 |
| 406 | 3300053727 | Ga0500611_044176 | Ga0500611_044176_345_572 | 66 |
| 407 | 3300059509 | Ga0587089_050373 | Ga0587089_050373_273_494 | 66 |
| 408 | 3300060353 | Ga0501082_0144077 | Ga0501082_0144077_790_1011 | 66 |
| 409 | 3300003323 | rootH1_10013604 | rootH1_100136043 | 68 |
| 410 | 3300050516 | nmdc:mga0sz30_143009_c1 | nmdc:mga0sz30_143009_c1_407_631 | 70 |
| 411 | iso_pu_bacteria | 2961127735 | 2961133588 | 70 |
| 412 | 3300050494 | nmdc:mga06z11_447249_c1 | nmdc:mga06z11_447249_c1_275_538 | 71 |
| 413 | 3300046507 | Ga0495606_0007401 | Ga0495606_0007401_4817_5059 | 73 |
| 414 | 3300047472 | Ga0495686_0285335 | Ga0495686_0285335_312_554 | 73 |
| 415 | 3300048924 | Ga0496121_0023145 | Ga0496121_0023145_2597_2839 | 73 |
| 416 | 3300014745 | Ga0157377_11107930 | Ga0157377_111079302 | 74 |
| 417 | 3300050496 | nmdc:mga07m45_501521_c1 | nmdc:mga07m45_501521_c1_178_423 | 74 |
| 418 | 3300053156 | Ga0500622_0000697 | Ga0500622_0000697_19595_19879 | 74 |
| 419 | 3300003320 | rootH2_10028723 | rootH2_100287233 | 77 |
| 420 | 3300003323 | rootH1_10008025 | rootH1_100080252 | 77 |
| 421 | 3300005262 | Ga0065165_1072995 | Ga0065165_10729952 | 77 |
| 422 | 3300013104 | Ga0157370_11019091 | Ga0157370_110190912 | 77 |
| 423 | 3300025258 | Ga0209129_1000285 | Ga0209129_100028519 | 77 |
| 424 | 3300025292 | Ga0209676_1025617 | Ga0209676_10256174 | 77 |
| 425 | 3300025294 | Ga0209025_1001792 | Ga0209025_100179231 | 77 |
| 426 | 3300025294 | Ga0209025_1006333 | Ga0209025_10063334 | 77 |
| 427 | 3300025295 | Ga0209564_1050052 | Ga0209564_10500522 | 77 |
| 428 | 3300025297 | Ga0209758_1016045 | Ga0209758_10160454 | 77 |
| 429 | 3300025299 | Ga0209256_1044171 | Ga0209256_10441712 | 77 |
| 430 | 3300025303 | Ga0209051_1066009 | Ga0209051_10660092 | 77 |
| 431 | 3300031456 | Ga0307513_10423466 | Ga0307513_104234661 | 77 |
| 432 | 3300046501 | Ga0495607_0020935 | Ga0495607_0020935_3282_3551 | 77 |
| 433 | 3300046538 | Ga0495609_0006047 | Ga0495609_0006047_70_339 | 77 |
| 434 | 3300046648 | Ga0495611_0003718 | Ga0495611_0003718_81_350 | 77 |
| 435 | 3300046660 | Ga0495625_0098989 | Ga0495625_0098989_1667_1936 | 77 |
| 436 | 3300046664 | Ga0495659_0008881 | Ga0495659_0008881_42_311 | 77 |
| 437 | 3300046665 | Ga0495661_0536861 | Ga0495661_0536861_213_482 | 77 |
| 438 | 3300046692 | Ga0495671_0017506 | Ga0495671_0017506_70_339 | 77 |
| 439 | 3300047320 | Ga0495672_0007995 | Ga0495672_0007995_7557_7826 | 77 |
| 440 | 3300048919 | Ga0496116_0128347 | Ga0496116_0128347_387_620 | 77 |
| 441 | 3300048927 | Ga0496124_0573414 | Ga0496124_0573414_29_367 | 77 |
| 442 | 3300049570 | Ga0501033_0312025 | Ga0501033_0312025_269_532 | 77 |
| 443 | 3300049571 | Ga0501034_0044128 | Ga0501034_0044128_3592_3855 | 77 |
| 444 | 3300049572 | Ga0501036_0012728 | Ga0501036_0012728_1504_1767 | 77 |
| 445 | 3300049574 | Ga0501038_0022297 | Ga0501038_0022297_589_852 | 77 |
| 446 | 3300049575 | Ga0501039_0050623 | Ga0501039_0050623_706_969 | 77 |
| 447 | 3300049578 | Ga0501042_1376653 | Ga0501042_1376653_59_322 | 77 |
| 448 | 3300049579 | Ga0501043_0081647 | Ga0501043_0081647_2045_2308 | 77 |
| 449 | 3300049580 | Ga0501046_0025781 | Ga0501046_0025781_785_1048 | 77 |
| 450 | 3300049581 | Ga0501047_0067470 | Ga0501047_0067470_571_834 | 77 |
| 451 | 3300049582 | Ga0501048_0011113 | Ga0501048_0011113_278_541 | 77 |
| 452 | 3300049583 | Ga0501067_0052213 | Ga0501067_0052213_1036_1299 | 77 |
| 453 | 3300049585 | Ga0501069_0046832 | Ga0501069_0046832_585_848 | 77 |
| 454 | 3300049586 | Ga0501070_0040496 | Ga0501070_0040496_269_532 | 77 |
| 455 | 3300049587 | Ga0501071_0017824 | Ga0501071_0017824_4305_4568 | 77 |
| 456 | 3300049589 | Ga0501073_0025654 | Ga0501073_0025654_2336_2599 | 77 |
| 457 | 3300049590 | Ga0501074_0036804 | Ga0501074_0036804_1338_1601 | 77 |
| 458 | 3300049741 | Ga0501079_0626898 | Ga0501079_0626898_46_309 | 77 |
| 459 | 3300049744 | Ga0501083_0123857 | Ga0501083_0123857_896_1159 | 77 |
| 460 | 3300049822 | Ga0501035_0006060 | Ga0501035_0006060_6122_6385 | 77 |
| 461 | 3300049823 | Ga0501044_0898798 | Ga0501044_0898798_229_492 | 77 |
| 462 | 3300050490 | nmdc:mga03n38_176614_c1 | nmdc:mga03n38_176614_c1_363_608 | 77 |
| 463 | 3300050494 | nmdc:mga06z11_455408_c1 | nmdc:mga06z11_455408_c1_403_648 | 77 |
| 464 | 3300053083 | Ga0495655_0142739 | Ga0495655_0142739_207_479 | 77 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v7u-assembly1.cif.gz_A | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.8135 | 16 | 77 |
| 5hyl-assembly1.cif.gz_C | crystal structure of dr2231_e47a mutant in complex with dumpnpp and magnesium | 0.7862 | 16 | 64 |
| 4wwb-assembly1.cif.gz_A | high-resolution structure of the ni-bound form of the y135f mutant of c. metallidurans cnrxs | 0.7827 | 8 | 66 |
| 4wwf-assembly1.cif.gz_A-3 | high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs | 0.7531 | 8 | 66 |
| 7nhq-assembly1.cif.gz_Z | structure of psii-i prime (psii with psb28, and psb34) | 0.7515 | 16 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46755_4_127_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.866 | 16 | 72 | 1.20.120.550 |
| 2y39A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8169 | 8 | 66 | 1.20.120.1490 |
| 3ae3D00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8143 | 15 | 73 | 1.20.1300.10 |
| af_Q16512_13_98_1.10.287.160 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat | 0.7877 | 2 | 64 | 1.10.287.160 |
| af_A8DYA9_1_129_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7839 | 11 | 66 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849VSM7-F1-model_v4 | Uncharacterized protein | 0.9884 | 15 | 68 |
GO:0016020
|
| AF-A0A6H0ZYP2-F1-model_v4 | Transmembrane protein | 0.9638 | 6 | 73 |
GO:0016020
|
| AF-A0A7C6IG58-F1-model_v4 | Uncharacterized protein | 0.9174 | 8 | 63 |
GO:0016020
|
| AF-A0A1V5WYV3-F1-model_v4 | ATP-dependent Clp protease ATP-binding subunit ClpE | 0.9139 | 16 | 77 |
GO:0005524
GO:0005737 GO:0006508 GO:0008233 GO:0016020 GO:0016887 GO:0034605 |
| AF-A0A849VSM7-F1-model_v4 | Uncharacterized protein | 0.8766 | 15 | 68 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar