F449256

General Info

Members Datasets Scaffolds Average Seq Length
464 259 928 252

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100127760|Ga0070697_1001277603
Length 282
Sequence LINLKTAHEIDLMARAGALLASVLPPLKDACEPGVKTNELDRIAEKLIRDGGATPGFLGYHGYPKSICVSINDEAVHGIPGSRKIAAGDLVSLDLGLVLDGFWADVGITVGVGKITKEADRLVKVTEEALYVGIDKAQPGGWLGDVSSAIQKHVEKAGFSVIRQFVGHGIGRQMHEDPQVPNFGTPGTPPRLKPGMTLAIEPMVNAGSHEVYMKADGWTICTVDGALSAYFEHTVAITDKGPLILTAQGSPLAGSSRRAEGAPGVGTSAPKASNGRANGAAH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
187 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0.22
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100127760 3300005536 Bacteria 2130
2 SwRhRL2b_contig_3021854 2162886007 Unclassified 1179
3 JGI24746J21847_1000439 3300001977 Bacteria 6214
4 Ga0058862_12677821 3300004803 Unclassified 1696
5 Ga0058862_12781598 3300004803 Bacteria 1552
6 Ga0065704_10094280 3300005289 Bacteria 2551
7 Ga0065707_10117488 3300005295 Bacteria 2176
8 Ga0065707_10124509 3300005295 Unclassified 2042
9 Ga0065707_10157277 3300005295 Bacteria 1596
10 Ga0070676_10002352 3300005328 Bacteria 9683
11 Ga0070676_10089255 3300005328 Bacteria 1885
12 Ga0070683_100029138 3300005329 Bacteria 4995
13 Ga0070690_100001487 3300005330 Bacteria 12272
14 Ga0070690_100025120 3300005330 Bacteria 3667
15 Ga0070670_100007145 3300005331 Bacteria 9456
16 Ga0070677_10000876 3300005333 Bacteria 9918
17 Ga0068869_100002424 3300005334 Bacteria 11243
18 Ga0070666_10056014 3300005335 Bacteria 2661
19 Ga0070680_100001398 3300005336 Bacteria 17425
20 Ga0070682_100039950 3300005337 Bacteria 2885
21 Ga0068868_100436321 3300005338 Bacteria 1136
22 Ga0070660_100018135 3300005339 Bacteria 5136
23 Ga0070689_100047490 3300005340 Bacteria 3310
24 Ga0070691_10034998 3300005341 Bacteria 2364
25 Ga0070687_100018120 3300005343 Bacteria 3250
26 Ga0070687_100220404 3300005343 Bacteria 1161
27 Ga0070661_100004891 3300005344 Bacteria 9227
28 Ga0070661_100025478 3300005344 Bacteria 4251
29 Ga0070692_10105828 3300005345 Unclassified 1549
30 Ga0070668_100039054 3300005347 Bacteria 3631
31 Ga0070669_100070016 3300005353 Bacteria 2592
32 Ga0070671_100021110 3300005355 Bacteria 5317
33 Ga0070674_100011117 3300005356 Bacteria 5466
34 Ga0070673_100028371 3300005364 Bacteria 4162
35 Ga0070673_100746429 3300005364 Bacteria 901
36 Ga0070659_100118915 3300005366 Bacteria 2138
37 Ga0070703_10005450 3300005406 Bacteria 3558
38 Ga0070714_100027086 3300005435 Bacteria 4743
39 Ga0070714_100091616 3300005435 Bacteria 2664
40 Ga0070714_100272636 3300005435 Bacteria 1569
41 Ga0070714_100321409 3300005435 Bacteria 1447
42 Ga0070713_100021996 3300005436 Bacteria 4918
43 Ga0070710_10306865 3300005437 Bacteria 1037
44 Ga0070711_100457267 3300005439 Bacteria 1046
45 Ga0070705_100015576 3300005440 Bacteria 3935
46 Ga0070705_100025577 3300005440 Bacteria 3201
47 Ga0070705_100030655 3300005440 Bacteria 2971
48 Ga0070705_100091803 3300005440 Bacteria 1894
49 Ga0070705_100125705 3300005440 Bacteria 1664
50 Ga0070705_100261142 3300005440 Bacteria 1221
51 Ga0070700_100007161 3300005441 Bacteria 6007
52 Ga0070694_100033008 3300005444 Bacteria 3402
53 Ga0070694_100050477 3300005444 Bacteria 2804
54 Ga0070708_100000027 3300005445 Bacteria 97468
55 Ga0070708_100001490 3300005445 Bacteria 17884
56 Ga0070708_100049189 3300005445 Bacteria 3729
57 Ga0070708_100059463 3300005445 Bacteria 3407
58 Ga0070708_100170936 3300005445 Bacteria 2029
59 Ga0070708_100234209 3300005445 Bacteria 1723
60 Ga0070663_100110033 3300005455 Unclassified 2069
61 Ga0070678_100000687 3300005456 Bacteria 16686
62 Ga0070681_10007331 3300005458 Bacteria 10773
63 Ga0068867_100000218 3300005459 Bacteria 37862
64 Ga0068867_100002011 3300005459 Bacteria 14198
65 Ga0070706_100000117 3300005467 Bacteria 97475
66 Ga0070706_100000547 3300005467 Bacteria 43712
67 Ga0070706_100001931 3300005467 Bacteria 21364
68 Ga0070706_100009741 3300005467 Bacteria 8929
69 Ga0070706_100011793 3300005467 Bacteria 8112
70 Ga0070706_100016257 3300005467 Bacteria 6873
71 Ga0070707_100000060 3300005468 Bacteria 97475
72 Ga0070707_100001828 3300005468 Bacteria 20464
73 Ga0070707_100010596 3300005468 Bacteria 8585
74 Ga0070707_100043111 3300005468 Bacteria 4319
75 Ga0070707_100064893 3300005468 Bacteria 3507
76 Ga0070707_100102186 3300005468 Bacteria 2777
77 Ga0070707_100250604 3300005468 Bacteria 1723
78 Ga0070707_100256847 3300005468 Bacteria 1700
79 Ga0070707_100294316 3300005468 Bacteria 1577
80 Ga0070707_100578572 3300005468 Bacteria 1085
81 Ga0070698_100018273 3300005471 Bacteria 7382
82 Ga0070698_100023059 3300005471 Bacteria 6509
83 Ga0070698_100102838 3300005471 Bacteria 2827
84 Ga0070698_100201083 3300005471 Bacteria 1928
85 Ga0070698_100456312 3300005471 Bacteria 1214
86 Ga0070698_100473801 3300005471 Bacteria 1188
87 Ga0070698_100558399 3300005471 Bacteria 1084
88 Ga0070698_100659716 3300005471 Unclassified 987
89 Ga0070699_100000685 3300005518 Bacteria 31595
90 Ga0070699_100000784 3300005518 Bacteria 29316
91 Ga0070699_100002925 3300005518 Bacteria 15183
92 Ga0070699_100046351 3300005518 Bacteria 3761
93 Ga0070699_100053088 3300005518 Bacteria 3508
94 Ga0070699_100065427 3300005518 Bacteria 3155
95 Ga0070699_100221941 3300005518 Bacteria 1684
96 Ga0070699_100378282 3300005518 Bacteria 1278
97 Ga0070684_100092388 3300005535 Bacteria 2693
98 Ga0070697_100000351 3300005536 Bacteria 36223
99 Ga0070697_100001474 3300005536 Bacteria 17878
100 Ga0070697_100014335 3300005536 Bacteria 6228
101 Ga0070697_100016182 3300005536 Bacteria 5864
102 Ga0070697_100052182 3300005536 Bacteria 3322
103 Ga0070697_100077619 3300005536 Bacteria 2733
104 Ga0070697_100095218 3300005536 Bacteria 2468
105 Ga0070697_100219435 3300005536 Bacteria 1620
106 Ga0070697_100231399 3300005536 Bacteria 1577
107 Ga0070697_100445092 3300005536 Bacteria 1128
108 Ga0070672_100010522 3300005543 Bacteria 6420
109 Ga0070672_100016350 3300005543 Bacteria 5311
110 Ga0070686_100027236 3300005544 Bacteria 3458
111 Ga0070695_100005251 3300005545 Bacteria 7628
112 Ga0070695_100029506 3300005545 Bacteria 3408
113 Ga0070695_100471286 3300005545 Unclassified 966
114 Ga0070696_100051210 3300005546 Bacteria 2871
115 Ga0070696_100403131 3300005546 Bacteria 1070
116 Ga0070693_100203796 3300005547 Unclassified 1286
117 Ga0070693_100363412 3300005547 Bacteria 994
118 Ga0070704_100004934 3300005549 Bacteria 7747
119 Ga0070704_100006043 3300005549 Bacteria 7100
120 Ga0070704_100130670 3300005549 Bacteria 1946
121 Ga0070664_100004346 3300005564 Bacteria 11393
122 Ga0068857_100091178 3300005577 Bacteria 2727
123 Ga0068864_100106443 3300005618 Bacteria 2494
124 Ga0068864_100191261 3300005618 Bacteria 1876
125 Ga0068866_10018240 3300005718 Bacteria 3170
126 Ga0068866_10025428 3300005718 Bacteria 2783
127 Ga0068858_100131773 3300005842 Unclassified 2345
128 Ga0068860_100029433 3300005843 Bacteria 5283
129 Ga0068862_100007798 3300005844 Bacteria 8853
130 Ga0081455_10003827 3300005937 Bacteria 17166
131 Ga0081538_10020098 3300005981 Bacteria 4932
132 Ga0081538_10022736 3300005981 Bacteria 4532
133 Ga0081538_10082674 3300005981 Bacteria 1701
134 Ga0081539_10000187 3300005985 Bacteria 145407
135 Ga0081539_10023492 3300005985 Bacteria 4039
136 Ga0070717_10000007 3300006028 Bacteria 304340
137 Ga0070717_10008688 3300006028 Bacteria 7600
138 Ga0070717_10034873 3300006028 Bacteria 4069
139 Ga0075364_10047604 3300006051 Bacteria 2794
140 Ga0070716_100076540 3300006173 Bacteria 1983
141 Ga0075367_10010858 3300006178 Bacteria 4799
142 Ga0097621_100030761 3300006237 Bacteria 4254
143 Ga0097621_100037374 3300006237 Bacteria 3890
144 Ga0068871_100285934 3300006358 Unclassified 1444
145 Ga0075428_100123908 3300006844 Unclassified 2813
146 Ga0075428_100289686 3300006844 Unclassified 1761
147 Ga0075430_100003584 3300006846 Bacteria 13009
148 Ga0075430_100011986 3300006846 Bacteria 7378
149 Ga0075431_100009425 3300006847 Bacteria 9799
150 Ga0075431_100009466 3300006847 Bacteria 9782
151 Ga0075433_10012940 3300006852 Bacteria 6763
152 Ga0075433_10137694 3300006852 Bacteria 2170
153 Ga0075434_100163257 3300006871 Bacteria 2247
154 Ga0075434_100207960 3300006871 Bacteria 1978
155 Ga0075434_100364703 3300006871 Bacteria 1465
156 Ga0075429_100030783 3300006880 Bacteria 4663
157 Ga0068865_100001372 3300006881 Bacteria 14168
158 Ga0075436_100038296 3300006914 Bacteria 3309
159 Ga0075436_100041209 3300006914 Bacteria 3185
160 Ga0075436_100160869 3300006914 Bacteria 1583
161 Ga0075435_100061967 3300007076 Bacteria 3035
162 Ga0075435_100140037 3300007076 Bacteria 2029
163 Ga0075435_100181585 3300007076 Bacteria 1778
164 Ga0099794_10000117 3300007265 Bacteria 29179
165 Ga0099794_10004600 3300007265 Bacteria 5445
166 Ga0099794_10225257 3300007265 Bacteria 964
167 Ga0111539_10493398 3300009094 Bacteria 1426
168 Ga0105245_10002155 3300009098 Bacteria 17830
169 Ga0114129_10015428 3300009147 Bacteria 10869
170 Ga0114129_10025977 3300009147 Bacteria 8293
171 Ga0114129_10033158 3300009147 Bacteria 7298
172 Ga0114129_10119665 3300009147 Bacteria 3627
173 Ga0114129_10270489 3300009147 Bacteria 2273
174 Ga0114129_10418863 3300009147 Bacteria 1762
175 Ga0114129_10630303 3300009147 Bacteria 1386
176 Ga0105243_10000049 3300009148 Bacteria 145575
177 Ga0105243_10002596 3300009148 Bacteria 15060
178 Ga0105242_10001315 3300009176 Bacteria 19631
179 Ga0105249_10001784 3300009553 Bacteria 18752
180 Ga0105239_10132652 3300010375 Bacteria 2771
181 Ga0105246_10000933 3300011119 Bacteria 16728
182 Ga0157369_10031128 3300013105 Bacteria 5879
183 Ga0157369_10667919 3300013105 Bacteria 1071
184 Ga0157374_10004664 3300013296 Bacteria 11502
185 Ga0157378_10017169 3300013297 Bacteria 6344
186 Ga0163162_10226389 3300013306 Bacteria 2000
187 Ga0157380_10015563 3300014326 Bacteria 5593
188 Ga0157380_10032645 3300014326 Bacteria 4007
189 Ga0157377_10040483 3300014745 Bacteria 2580
190 Ga0157377_10043021 3300014745 Bacteria 2512
191 Ga0157376_10000962 3300014969 Bacteria 18762
192 Ga0157376_10011279 3300014969 Bacteria 6579
193 Ga0213876_10009713 3300021384 Bacteria 5178
194 Ga0213876_10016993 3300021384 Bacteria 3843
195 Ga0213875_10006988 3300021388 Bacteria 5875
196 Ga0224712_10179793 3300022467 Bacteria 952
197 Ga0207653_10001462 3300025885 Bacteria 7662
198 Ga0207682_10030281 3300025893 Bacteria 2167
199 Ga0207692_10263003 3300025898 Bacteria 1038
200 Ga0207642_10245301 3300025899 Bacteria 1013
201 Ga0207688_10001296 3300025901 Bacteria 12973
202 Ga0207680_10004142 3300025903 Bacteria 6866
203 Ga0207680_10025370 3300025903 Bacteria 3269
204 Ga0207647_10095905 3300025904 Bacteria 1766
205 Ga0207645_10001331 3300025907 Bacteria 20306
206 Ga0207645_10193102 3300025907 Bacteria 1338
207 Ga0207684_10000002 3300025910 Bacteria 1042751
208 Ga0207684_10000026 3300025910 Bacteria 316711
209 Ga0207684_10000148 3300025910 Bacteria 124604
210 Ga0207684_10000222 3300025910 Bacteria 87705
211 Ga0207684_10002609 3300025910 Bacteria 18023
212 Ga0207684_10022921 3300025910 Bacteria 5332
213 Ga0207684_10067051 3300025910 Bacteria 3049
214 Ga0207684_10139657 3300025910 Bacteria 2082
215 Ga0207684_10225000 3300025910 Bacteria 1619
216 Ga0207684_10285644 3300025910 Bacteria 1423
217 Ga0207684_10296857 3300025910 Bacteria 1393
218 Ga0207707_10005817 3300025912 Bacteria 10774
219 Ga0207707_10037560 3300025912 Bacteria 4233
220 Ga0207693_10131173 3300025915 Unclassified 1970
221 Ga0207663_10365566 3300025916 Bacteria 1096
222 Ga0207660_10034701 3300025917 Bacteria 3497
223 Ga0207660_10047074 3300025917 Bacteria 3047
224 Ga0207662_10023453 3300025918 Bacteria 3545
225 Ga0207657_10003006 3300025919 Bacteria 18068
226 Ga0207649_10003938 3300025920 Bacteria 8099
227 Ga0207649_10006351 3300025920 Bacteria 6423
228 Ga0207646_10000143 3300025922 Bacteria 97493
229 Ga0207646_10000394 3300025922 Bacteria 58624
230 Ga0207646_10000668 3300025922 Bacteria 44376
231 Ga0207646_10001744 3300025922 Bacteria 26445
232 Ga0207646_10005654 3300025922 Bacteria 13120
233 Ga0207646_10017539 3300025922 Bacteria 6697
234 Ga0207646_10033781 3300025922 Bacteria 4624
235 Ga0207646_10103108 3300025922 Bacteria 2558
236 Ga0207646_10230501 3300025922 Bacteria 1673
237 Ga0207646_10230535 3300025922 Bacteria 1673
238 Ga0207646_10578177 3300025922 Bacteria 1009
239 Ga0207681_10027152 3300025923 Bacteria 3699
240 Ga0207650_10157615 3300025925 Unclassified 1796
241 Ga0207659_10009763 3300025926 Bacteria 6003
242 Ga0207687_10047613 3300025927 Bacteria 2973
243 Ga0207700_10066664 3300025928 Bacteria 2752
244 Ga0207664_10001273 3300025929 Bacteria 16631
245 Ga0207644_10033413 3300025931 Bacteria 3594
246 Ga0207644_10171807 3300025931 Bacteria 1693
247 Ga0207690_10045187 3300025932 Bacteria 2908
248 Ga0207706_10002541 3300025933 Bacteria 17781
249 Ga0207686_10113734 3300025934 Unclassified 1830
250 Ga0207709_10000097 3300025935 Bacteria 136507
251 Ga0207709_10113365 3300025935 Unclassified 1817
252 Ga0207670_10013450 3300025936 Bacteria 4827
253 Ga0207670_10051099 3300025936 Bacteria 2774
254 Ga0207669_10001785 3300025937 Bacteria 9123
255 Ga0207704_10001466 3300025938 Bacteria 10546
256 Ga0207704_10102930 3300025938 Bacteria 1909
257 Ga0207665_10027217 3300025939 Bacteria 3778
258 Ga0207665_10190708 3300025939 Bacteria 1489
259 Ga0207665_10307824 3300025939 Bacteria 1186
260 Ga0207665_10313529 3300025939 Bacteria 1175
261 Ga0207691_10000955 3300025940 Bacteria 28629
262 Ga0207691_10041727 3300025940 Bacteria 4234
263 Ga0207689_10014066 3300025942 Bacteria 6811
264 Ga0207689_10269063 3300025942 Bacteria 1411
265 Ga0207661_10090706 3300025944 Bacteria 2545
266 Ga0207679_10000541 3300025945 Bacteria 25439
267 Ga0207679_10030510 3300025945 Bacteria 3765
268 Ga0207651_10130399 3300025960 Bacteria 1923
269 Ga0207668_10050776 3300025972 Bacteria 2860
270 Ga0207658_10098720 3300025986 Unclassified 2282
271 Ga0207678_10094564 3300026067 Bacteria 2554
272 Ga0207708_10000561 3300026075 Bacteria 28687
273 Ga0207648_10000083 3300026089 Bacteria 89416
274 Ga0207648_10001233 3300026089 Bacteria 28717
275 Ga0207676_10239087 3300026095 Bacteria 1628
276 Ga0207674_10051238 3300026116 Bacteria 4213
277 Ga0207674_10286345 3300026116 Bacteria 1596
278 Ga0207683_10000895 3300026121 Bacteria 27406
279 Ga0207683_10276926 3300026121 Bacteria 1533
280 Ga0209973_1002123 3300027252 Unclassified 1817
281 Ga0209969_1000104 3300027360 Bacteria 10560
282 Ga0209967_1000038 3300027364 Bacteria 16833
283 Ga0209981_1000268 3300027378 Bacteria 6709
284 Ga0209996_1000062 3300027395 Bacteria 14921
285 Ga0209984_1000027 3300027424 Bacteria 15251
286 Ga0210000_1000018 3300027462 Bacteria 28094
287 Ga0209995_1000015 3300027471 Bacteria 26669
288 Ga0209968_1000052 3300027526 Bacteria 21189
289 Ga0209982_1000018 3300027552 Bacteria 15162
290 Ga0209970_1000260 3300027614 Bacteria 8679
291 Ga0210002_1000043 3300027617 Bacteria 19508
292 Ga0209588_1000036 3300027671 Bacteria 65612
293 Ga0209971_1000266 3300027682 Bacteria 14793
294 Ga0209971_1009970 3300027682 Bacteria 2247
295 Ga0209966_1000180 3300027695 Bacteria 25869
296 Ga0209998_10000137 3300027717 Bacteria 28713
297 Ga0209974_10003579 3300027876 Bacteria 5585
298 Ga0207428_10000452 3300027907 Bacteria 49793
299 Ga0268265_10007292 3300028380 Bacteria 7469
300 Ga0268264_10319587 3300028381 Bacteria 1467
301 Ga0316182_1102604 3300030745 Bacteria 1151
302 Ga0265325_10039150 3300031241 Bacteria 2498
303 Ga0307408_100139674 3300031548 Bacteria 1900
304 Ga0307405_10396215 3300031731 Bacteria 1079
305 Ga0307405_10668491 3300031731 Bacteria 856
306 Ga0307413_10052889 3300031824 Bacteria 2456
307 Ga0307413_10268332 3300031824 Bacteria 1276
308 Ga0307410_10175784 3300031852 Bacteria 1617
309 Ga0307406_10164704 3300031901 Bacteria 1598
310 Ga0307407_10090510 3300031903 Bacteria 1874
311 Ga0307407_10365109 3300031903 Bacteria 1026
312 Ga0307409_100092397 3300031995 Bacteria 2483
313 Ga0307409_100336532 3300031995 Bacteria 1418
314 Ga0307416_100076811 3300032002 Bacteria 2801
315 Ga0307416_100216144 3300032002 Bacteria 1834
316 Ga0307414_10054992 3300032004 Bacteria 2785
317 Ga0307414_10095671 3300032004 Bacteria 2220
318 Ga0307411_10096077 3300032005 Bacteria 2082
319 Ga0307415_100316471 3300032126 Bacteria 1299
320 Ga0307415_100514262 3300032126 Bacteria 1049
321 Ga0373931_0078226 3300035691 Unclassified 1819
322 Ga0373935_0190004 3300035692 Bacteria 1414
323 Ga0373933_0029081 3300035724 Bacteria 3192
324 Ga0316582_0007903 3300036647 Bacteria 5685
325 Ga0373925_0039769 3300037068 Bacteria 3480
326 Ga0316581_0012351 3300037588 Bacteria 2403
327 Ga0436364_0367212 3300037853 Bacteria 15974
328 Ga0436364_1270093 3300037853 Bacteria 2392
329 Ga0400483_168849 3300039062 Bacteria 24271
330 Ga0436365_0222942 3300039437 Bacteria 6189
331 Ga0436365_1544784 3300039437 Bacteria 5536
332 Ga0436365_1662543 3300039437 Bacteria 16980
333 Ga0436363_0133663 3300039450 Bacteria 6873
334 Ga0436363_0145734 3300039450 Bacteria 3290
335 Ga0439453_0000086 3300041408 Bacteria 7091
336 Ga0439437_007560 3300042000 Bacteria 1215
337 Ga0450889_004721 3300042144 Bacteria 1349
338 Ga0450889_006936 3300042144 Bacteria 1140
339 Ga0451577_0000006 3300042876 Bacteria 709265
340 Ga0451577_0341592 3300042876 Unclassified 1358
341 Ga0453683_0000088 3300044673 Bacteria 138620
342 Ga0453683_0149263 3300044673 Bacteria 1477
343 Ga0466966_0216255 3300044684 Bacteria 1157
344 Ga0466961_0009202 3300044693 Bacteria 6289
345 Ga0466963_0001026 3300044694 Bacteria 14486
346 Ga0466963_0363027 3300044694 Bacteria 1020
347 Ga0453684_0000037 3300044712 Bacteria 709327
348 Ga0453684_0008501 3300044712 Bacteria 18357
349 Ga0453684_0025015 3300044712 Bacteria 8688
350 Ga0453684_0043756 3300044712 Bacteria 6010
351 Ga0453684_0057007 3300044712 Bacteria 5063
352 Ga0453684_0086711 3300044712 Bacteria 3883
353 Ga0466970_0034497 3300044765 Bacteria 2679
354 Ga0466957_0069240 3300044842 Bacteria 2180
355 Ga0466959_0000810 3300045049 Bacteria 18412
356 Ga0466959_0146969 3300045049 Bacteria 1663
357 Ga0451576_0000298 3300045051 Bacteria 120202
358 Ga0451576_0005300 3300045051 Bacteria 16207
359 Ga0451576_0047121 3300045051 Bacteria 4533
360 Ga0451576_0310218 3300045051 Bacteria 1650
361 Ga0466958_0001100 3300045836 Bacteria 12465
362 Ga0466958_0210397 3300045836 Bacteria 1239
363 Ga0466967_0062465 3300045976 Bacteria 3306
364 Ga0495591_060169 3300046458 Bacteria 1011
365 Ga0495629_0043853 3300046459 Bacteria 3140
366 Ga0495662_0114250 3300046476 Bacteria 1324
367 Ga0495584_0108087 3300046491 Bacteria 1407
368 Ga0495594_0044035 3300046499 Bacteria 2447
369 Ga0495630_0023183 3300046517 Bacteria 4588
370 Ga0495657_0003784 3300046675 Bacteria 12244
371 Ga0495624_0068025 3300046690 Bacteria 2221
372 Ga0495600_0112103 3300046809 Bacteria 1776
373 Ga0495581_0106549 3300047315 Bacteria 1629
374 Ga0495674_0408008 3300047319 Bacteria 1096
375 Ga0495676_0043484 3300047321 Bacteria 3675
376 Ga0495680_0029262 3300047322 Bacteria 4511
377 Ga0496110_0336238 3300048913 Unclassified 1376
378 Ga0501032_0016350 3300049569 Bacteria 5220
379 Ga0501032_0086233 3300049569 Bacteria 2087
380 Ga0501033_0075609 3300049570 Bacteria 2472
381 Ga0501036_0130131 3300049572 Bacteria 2125
382 Ga0501037_0045287 3300049573 Bacteria 3230
383 Ga0501038_0002519 3300049574 Bacteria 17073
384 Ga0501038_0116576 3300049574 Bacteria 2207
385 Ga0501039_0048103 3300049575 Bacteria 3297
386 Ga0501039_0147062 3300049575 Bacteria 1851
387 Ga0501039_0155387 3300049575 Bacteria 1797
388 Ga0501040_0060308 3300049576 Bacteria 2607
389 Ga0501040_0131209 3300049576 Bacteria 1762
390 Ga0501041_0007026 3300049577 Bacteria 6607
391 Ga0501042_0005863 3300049578 Bacteria 7940
392 Ga0501042_0269598 3300049578 Bacteria 1229
393 Ga0501043_0202306 3300049579 Bacteria 1541
394 Ga0501046_0013923 3300049580 Bacteria 6793
395 Ga0501046_0017452 3300049580 Bacteria 5990
396 Ga0501047_0112209 3300049581 Bacteria 2608
397 Ga0501048_0201899 3300049582 Bacteria 1409
398 Ga0501069_0053996 3300049585 Bacteria 2238
399 Ga0501070_0241693 3300049586 Bacteria 1478
400 Ga0501071_0020859 3300049587 Bacteria 4558
401 Ga0501072_0021548 3300049588 Bacteria 4998
402 Ga0501072_0044375 3300049588 Bacteria 3496
403 Ga0501075_0022983 3300049591 Bacteria 4561
404 Ga0501075_0173693 3300049591 Bacteria 1644
405 Ga0501076_0021046 3300049592 Bacteria 4998
406 Ga0501076_0162505 3300049592 Bacteria 1820
407 Ga0501209_150795 3300049656 Bacteria 700
408 Ga0501221_008057 3300049704 Bacteria 1824
409 Ga0501079_0081357 3300049741 Bacteria 2504
410 Ga0501079_0437783 3300049741 Bacteria 1026
411 Ga0501079_0445035 3300049741 Bacteria 1017
412 Ga0501080_0090233 3300049742 Bacteria 2847
413 Ga0501080_0166791 3300049742 Bacteria 2032
414 Ga0501081_0019551 3300049743 Bacteria 4510
415 Ga0501081_0211390 3300049743 Bacteria 1409
416 Ga0501035_0012778 3300049822 Bacteria 7756
417 Ga0501035_0408060 3300049822 Bacteria 1129
418 Ga0501045_0095074 3300049824 Bacteria 2204
419 Ga0501212_001657 3300049851 Bacteria 2549
420 nmdc:mga03n38_66559_c1 3300050490 Bacteria 1655
421 nmdc:mga0yw44_375828_c1 3300050492 Bacteria 959
422 nmdc:mga04h51_57298_c1 3300050495 Bacteria 1325
423 nmdc:mga05p37_150384_c1 3300050507 Bacteria 2848
424 nmdc:mga05p37_16103_c1 3300050507 Bacteria 9000
425 nmdc:mga05p37_335929_c1 3300050507 Bacteria 1783
426 nmdc:mga05p37_431200_c1 3300050507 Bacteria 1531
427 nmdc:mga05p37_49727_c1 3300050507 Bacteria 5157
428 nmdc:mga09592_285521_c1 3300050508 Unclassified 1431
429 nmdc:mga0qj67_14052_c1 3300050509 Bacteria 6046
430 nmdc:mga0qj67_2019_c1 3300050509 Bacteria 10913
431 nmdc:mga0qj67_25295_c1 3300050509 Bacteria 4586
432 nmdc:mga0qj67_46834_c1 3300050509 Bacteria 3414
433 nmdc:mga06r32_27115_c1 3300050510 Bacteria 5348
434 nmdc:mga06r32_3627_c1 3300050510 Bacteria 13776
435 nmdc:mga06r32_37753_c1 3300050510 Bacteria 4570
436 nmdc:mga08y16_238397_c1 3300050511 Bacteria 1881
437 nmdc:mga0n895_375668_c1 3300050512 Bacteria 1439
438 nmdc:mga0n895_478423_c1 3300050512 Bacteria 1256
439 nmdc:mga0n895_77732_c1 3300050512 Bacteria 3302
440 nmdc:mga0rr50_546936_c1 3300050513 Bacteria 986
441 nmdc:mga0rr50_88436_c1 3300050513 Bacteria 2407
442 nmdc:mga08x19_164304_c1 3300050514 Bacteria 1509
443 nmdc:mga08x19_319527_c1 3300050514 Bacteria 1080
444 nmdc:mga08x19_375111_c1 3300050514 Bacteria 996
445 nmdc:mga08x19_55626_c1 3300050514 Bacteria 2551
446 nmdc:mga08x19_63277_c1 3300050514 Bacteria 2400
447 nmdc:mga0a205_186553_c1 3300050515 Bacteria 1967
448 nmdc:mga0a205_23315_c1 3300050515 Bacteria 4418
449 nmdc:mga0a205_404340_c1 3300050515 Bacteria 1229
450 nmdc:mga0a205_8227_c1 3300050515 Bacteria 9480
451 nmdc:mga0a205_97995_c1 3300050515 Bacteria 2831
452 Ga0495601_0058326 3300053077 Bacteria 2446
453 Ga0500635_0005767 3300053080 Bacteria 3272
454 Ga0495619_0031129 3300053085 Bacteria 3456
455 Ga0495619_0031481 3300053085 Bacteria 3437
456 Ga0501084_0269216 3300054114 Bacteria 1438
457 Ga0590075_004314 3300059424 Bacteria 3366
458 Ga0590075_005913 3300059424 Bacteria 2893
459 Ga0590075_033582 3300059424 Bacteria 1303
460 Ga0501082_0052100 3300060353 Bacteria 3527
461 Ga0501082_0253440 3300060353 Bacteria 1531
462 Ga0530510_0198298 3300061734 Bacteria 1490
463 Ga0530510_0244239 3300061734 Bacteria 1337
464 Ga0530510_0278578 3300061734 Bacteria 1249
465 Ga0070697_100127760
466 SwRhRL2b_contig_3021854
467 JGI24746J21847_1000439
468 Ga0058862_12677821
469 Ga0058862_12781598
470 Ga0065704_10094280
471 Ga0065707_10117488
472 Ga0065707_10124509
473 Ga0065707_10157277
474 Ga0070676_10002352
475 Ga0070676_10089255
476 Ga0070683_100029138
477 Ga0070690_100001487
478 Ga0070690_100025120
479 Ga0070670_100007145
480 Ga0070677_10000876
481 Ga0068869_100002424
482 Ga0070666_10056014
483 Ga0070680_100001398
484 Ga0070682_100039950
485 Ga0068868_100436321
486 Ga0070660_100018135
487 Ga0070689_100047490
488 Ga0070691_10034998
489 Ga0070687_100018120
490 Ga0070687_100220404
491 Ga0070661_100004891
492 Ga0070661_100025478
493 Ga0070692_10105828
494 Ga0070668_100039054
495 Ga0070669_100070016
496 Ga0070671_100021110
497 Ga0070674_100011117
498 Ga0070673_100028371
499 Ga0070673_100746429
500 Ga0070659_100118915
501 Ga0070703_10005450
502 Ga0070714_100027086
503 Ga0070714_100091616
504 Ga0070714_100272636
505 Ga0070714_100321409
506 Ga0070713_100021996
507 Ga0070710_10306865
508 Ga0070711_100457267
509 Ga0070705_100015576
510 Ga0070705_100025577
511 Ga0070705_100030655
512 Ga0070705_100091803
513 Ga0070705_100125705
514 Ga0070705_100261142
515 Ga0070700_100007161
516 Ga0070694_100033008
517 Ga0070694_100050477
518 Ga0070708_100000027
519 Ga0070708_100001490
520 Ga0070708_100049189
521 Ga0070708_100059463
522 Ga0070708_100170936
523 Ga0070708_100234209
524 Ga0070663_100110033
525 Ga0070678_100000687
526 Ga0070681_10007331
527 Ga0068867_100000218
528 Ga0068867_100002011
529 Ga0070706_100000117
530 Ga0070706_100000547
531 Ga0070706_100001931
532 Ga0070706_100009741
533 Ga0070706_100011793
534 Ga0070706_100016257
535 Ga0070707_100000060
536 Ga0070707_100001828
537 Ga0070707_100010596
538 Ga0070707_100043111
539 Ga0070707_100064893
540 Ga0070707_100102186
541 Ga0070707_100250604
542 Ga0070707_100256847
543 Ga0070707_100294316
544 Ga0070707_100578572
545 Ga0070698_100018273
546 Ga0070698_100023059
547 Ga0070698_100102838
548 Ga0070698_100201083
549 Ga0070698_100456312
550 Ga0070698_100473801
551 Ga0070698_100558399
552 Ga0070698_100659716
553 Ga0070699_100000685
554 Ga0070699_100000784
555 Ga0070699_100002925
556 Ga0070699_100046351
557 Ga0070699_100053088
558 Ga0070699_100065427
559 Ga0070699_100221941
560 Ga0070699_100378282
561 Ga0070684_100092388
562 Ga0070697_100000351
563 Ga0070697_100001474
564 Ga0070697_100014335
565 Ga0070697_100016182
566 Ga0070697_100052182
567 Ga0070697_100077619
568 Ga0070697_100095218
569 Ga0070697_100219435
570 Ga0070697_100231399
571 Ga0070697_100445092
572 Ga0070672_100010522
573 Ga0070672_100016350
574 Ga0070686_100027236
575 Ga0070695_100005251
576 Ga0070695_100029506
577 Ga0070695_100471286
578 Ga0070696_100051210
579 Ga0070696_100403131
580 Ga0070693_100203796
581 Ga0070693_100363412
582 Ga0070704_100004934
583 Ga0070704_100006043
584 Ga0070704_100130670
585 Ga0070664_100004346
586 Ga0068857_100091178
587 Ga0068864_100106443
588 Ga0068864_100191261
589 Ga0068866_10018240
590 Ga0068866_10025428
591 Ga0068858_100131773
592 Ga0068860_100029433
593 Ga0068862_100007798
594 Ga0081455_10003827
595 Ga0081538_10020098
596 Ga0081538_10022736
597 Ga0081538_10082674
598 Ga0081539_10000187
599 Ga0081539_10023492
600 Ga0070717_10000007
601 Ga0070717_10008688
602 Ga0070717_10034873
603 Ga0075364_10047604
604 Ga0070716_100076540
605 Ga0075367_10010858
606 Ga0097621_100030761
607 Ga0097621_100037374
608 Ga0068871_100285934
609 Ga0075428_100123908
610 Ga0075428_100289686
611 Ga0075430_100003584
612 Ga0075430_100011986
613 Ga0075431_100009425
614 Ga0075431_100009466
615 Ga0075433_10012940
616 Ga0075433_10137694
617 Ga0075434_100163257
618 Ga0075434_100207960
619 Ga0075434_100364703
620 Ga0075429_100030783
621 Ga0068865_100001372
622 Ga0075436_100038296
623 Ga0075436_100041209
624 Ga0075436_100160869
625 Ga0075435_100061967
626 Ga0075435_100140037
627 Ga0075435_100181585
628 Ga0099794_10000117
629 Ga0099794_10004600
630 Ga0099794_10225257
631 Ga0111539_10493398
632 Ga0105245_10002155
633 Ga0114129_10015428
634 Ga0114129_10025977
635 Ga0114129_10033158
636 Ga0114129_10119665
637 Ga0114129_10270489
638 Ga0114129_10418863
639 Ga0114129_10630303
640 Ga0105243_10000049
641 Ga0105243_10002596
642 Ga0105242_10001315
643 Ga0105249_10001784
644 Ga0105239_10132652
645 Ga0105246_10000933
646 Ga0157369_10031128
647 Ga0157369_10667919
648 Ga0157374_10004664
649 Ga0157378_10017169
650 Ga0163162_10226389
651 Ga0157380_10015563
652 Ga0157380_10032645
653 Ga0157377_10040483
654 Ga0157377_10043021
655 Ga0157376_10000962
656 Ga0157376_10011279
657 Ga0213876_10009713
658 Ga0213876_10016993
659 Ga0213875_10006988
660 Ga0224712_10179793
661 Ga0207653_10001462
662 Ga0207682_10030281
663 Ga0207692_10263003
664 Ga0207642_10245301
665 Ga0207688_10001296
666 Ga0207680_10004142
667 Ga0207680_10025370
668 Ga0207647_10095905
669 Ga0207645_10001331
670 Ga0207645_10193102
671 Ga0207684_10000002
672 Ga0207684_10000026
673 Ga0207684_10000148
674 Ga0207684_10000222
675 Ga0207684_10002609
676 Ga0207684_10022921
677 Ga0207684_10067051
678 Ga0207684_10139657
679 Ga0207684_10225000
680 Ga0207684_10285644
681 Ga0207684_10296857
682 Ga0207707_10005817
683 Ga0207707_10037560
684 Ga0207693_10131173
685 Ga0207663_10365566
686 Ga0207660_10034701
687 Ga0207660_10047074
688 Ga0207662_10023453
689 Ga0207657_10003006
690 Ga0207649_10003938
691 Ga0207649_10006351
692 Ga0207646_10000143
693 Ga0207646_10000394
694 Ga0207646_10000668
695 Ga0207646_10001744
696 Ga0207646_10005654
697 Ga0207646_10017539
698 Ga0207646_10033781
699 Ga0207646_10103108
700 Ga0207646_10230501
701 Ga0207646_10230535
702 Ga0207646_10578177
703 Ga0207681_10027152
704 Ga0207650_10157615
705 Ga0207659_10009763
706 Ga0207687_10047613
707 Ga0207700_10066664
708 Ga0207664_10001273
709 Ga0207644_10033413
710 Ga0207644_10171807
711 Ga0207690_10045187
712 Ga0207706_10002541
713 Ga0207686_10113734
714 Ga0207709_10000097
715 Ga0207709_10113365
716 Ga0207670_10013450
717 Ga0207670_10051099
718 Ga0207669_10001785
719 Ga0207704_10001466
720 Ga0207704_10102930
721 Ga0207665_10027217
722 Ga0207665_10190708
723 Ga0207665_10307824
724 Ga0207665_10313529
725 Ga0207691_10000955
726 Ga0207691_10041727
727 Ga0207689_10014066
728 Ga0207689_10269063
729 Ga0207661_10090706
730 Ga0207679_10000541
731 Ga0207679_10030510
732 Ga0207651_10130399
733 Ga0207668_10050776
734 Ga0207658_10098720
735 Ga0207678_10094564
736 Ga0207708_10000561
737 Ga0207648_10000083
738 Ga0207648_10001233
739 Ga0207676_10239087
740 Ga0207674_10051238
741 Ga0207674_10286345
742 Ga0207683_10000895
743 Ga0207683_10276926
744 Ga0209973_1002123
745 Ga0209969_1000104
746 Ga0209967_1000038
747 Ga0209981_1000268
748 Ga0209996_1000062
749 Ga0209984_1000027
750 Ga0210000_1000018
751 Ga0209995_1000015
752 Ga0209968_1000052
753 Ga0209982_1000018
754 Ga0209970_1000260
755 Ga0210002_1000043
756 Ga0209588_1000036
757 Ga0209971_1000266
758 Ga0209971_1009970
759 Ga0209966_1000180
760 Ga0209998_10000137
761 Ga0209974_10003579
762 Ga0207428_10000452
763 Ga0268265_10007292
764 Ga0268264_10319587
765 Ga0316182_1102604
766 Ga0265325_10039150
767 Ga0307408_100139674
768 Ga0307405_10396215
769 Ga0307405_10668491
770 Ga0307413_10052889
771 Ga0307413_10268332
772 Ga0307410_10175784
773 Ga0307406_10164704
774 Ga0307407_10090510
775 Ga0307407_10365109
776 Ga0307409_100092397
777 Ga0307409_100336532
778 Ga0307416_100076811
779 Ga0307416_100216144
780 Ga0307414_10054992
781 Ga0307414_10095671
782 Ga0307411_10096077
783 Ga0307415_100316471
784 Ga0307415_100514262
785 Ga0373931_0078226
786 Ga0373935_0190004
787 Ga0373933_0029081
788 Ga0316582_0007903
789 Ga0373925_0039769
790 Ga0316581_0012351
791 Ga0436364_0367212
792 Ga0436364_1270093
793 Ga0400483_168849
794 Ga0436365_0222942
795 Ga0436365_1544784
796 Ga0436365_1662543
797 Ga0436363_0133663
798 Ga0436363_0145734
799 Ga0439453_0000086
800 Ga0439437_007560
801 Ga0450889_004721
802 Ga0450889_006936
803 Ga0451577_0000006
804 Ga0451577_0341592
805 Ga0453683_0000088
806 Ga0453683_0149263
807 Ga0466966_0216255
808 Ga0466961_0009202
809 Ga0466963_0001026
810 Ga0466963_0363027
811 Ga0453684_0000037
812 Ga0453684_0008501
813 Ga0453684_0025015
814 Ga0453684_0043756
815 Ga0453684_0057007
816 Ga0453684_0086711
817 Ga0466970_0034497
818 Ga0466957_0069240
819 Ga0466959_0000810
820 Ga0466959_0146969
821 Ga0451576_0000298
822 Ga0451576_0005300
823 Ga0451576_0047121
824 Ga0451576_0310218
825 Ga0466958_0001100
826 Ga0466958_0210397
827 Ga0466967_0062465
828 Ga0495591_060169
829 Ga0495629_0043853
830 Ga0495662_0114250
831 Ga0495584_0108087
832 Ga0495594_0044035
833 Ga0495630_0023183
834 Ga0495657_0003784
835 Ga0495624_0068025
836 Ga0495600_0112103
837 Ga0495581_0106549
838 Ga0495674_0408008
839 Ga0495676_0043484
840 Ga0495680_0029262
841 Ga0496110_0336238
842 Ga0501032_0016350
843 Ga0501032_0086233
844 Ga0501033_0075609
845 Ga0501036_0130131
846 Ga0501037_0045287
847 Ga0501038_0002519
848 Ga0501038_0116576
849 Ga0501039_0048103
850 Ga0501039_0147062
851 Ga0501039_0155387
852 Ga0501040_0060308
853 Ga0501040_0131209
854 Ga0501041_0007026
855 Ga0501042_0005863
856 Ga0501042_0269598
857 Ga0501043_0202306
858 Ga0501046_0013923
859 Ga0501046_0017452
860 Ga0501047_0112209
861 Ga0501048_0201899
862 Ga0501069_0053996
863 Ga0501070_0241693
864 Ga0501071_0020859
865 Ga0501072_0021548
866 Ga0501072_0044375
867 Ga0501075_0022983
868 Ga0501075_0173693
869 Ga0501076_0021046
870 Ga0501076_0162505
871 Ga0501209_150795
872 Ga0501221_008057
873 Ga0501079_0081357
874 Ga0501079_0437783
875 Ga0501079_0445035
876 Ga0501080_0090233
877 Ga0501080_0166791
878 Ga0501081_0019551
879 Ga0501081_0211390
880 Ga0501035_0012778
881 Ga0501035_0408060
882 Ga0501045_0095074
883 Ga0501212_001657
884 nmdc:mga03n38_66559_c1
885 nmdc:mga0yw44_375828_c1
886 nmdc:mga04h51_57298_c1
887 nmdc:mga05p37_150384_c1
888 nmdc:mga05p37_16103_c1
889 nmdc:mga05p37_335929_c1
890 nmdc:mga05p37_431200_c1
891 nmdc:mga05p37_49727_c1
892 nmdc:mga09592_285521_c1
893 nmdc:mga0qj67_14052_c1
894 nmdc:mga0qj67_2019_c1
895 nmdc:mga0qj67_25295_c1
896 nmdc:mga0qj67_46834_c1
897 nmdc:mga06r32_27115_c1
898 nmdc:mga06r32_3627_c1
899 nmdc:mga06r32_37753_c1
900 nmdc:mga08y16_238397_c1
901 nmdc:mga0n895_375668_c1
902 nmdc:mga0n895_478423_c1
903 nmdc:mga0n895_77732_c1
904 nmdc:mga0rr50_546936_c1
905 nmdc:mga0rr50_88436_c1
906 nmdc:mga08x19_164304_c1
907 nmdc:mga08x19_319527_c1
908 nmdc:mga08x19_375111_c1
909 nmdc:mga08x19_55626_c1
910 nmdc:mga08x19_63277_c1
911 nmdc:mga0a205_186553_c1
912 nmdc:mga0a205_23315_c1
913 nmdc:mga0a205_404340_c1
914 nmdc:mga0a205_8227_c1
915 nmdc:mga0a205_97995_c1
916 Ga0495601_0058326
917 Ga0500635_0005767
918 Ga0495619_0031129
919 Ga0495619_0031481
920 Ga0501084_0269216
921 Ga0590075_004314
922 Ga0590075_005913
923 Ga0590075_033582
924 Ga0501082_0052100
925 Ga0501082_0253440
926 Ga0530510_0198298
927 Ga0530510_0244239
928 Ga0530510_0278578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

239

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9867 1 248
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9854 1 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.985 1 249
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9849 1 248
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9833 4 249
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9914 16 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9867 1 248 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.985 1 249 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9849 1 248 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9848 4 248 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7C3XA93-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9981 1 196 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9975 83 188 GO:0005829
GO:0006508
GO:0070006
AF-I3VU54-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9971 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3D0E855-F1-model_v4 deleted 0.997 1 249
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9968 1 249 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map