F449197

General Info

Members Datasets Scaffolds Average Seq Length
463 318 926 122

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0263281|Ga0501042_0263281_365_871
Length 143
Sequence MPCLTAFAWREASTHKEPFLMRHYEIVFIVHPDQSEQVPAMVDRYRQMVTSRNGRIHRLEDWGRRQLAYPIEKVHKAHYVLMNIECDNEALSELEHAFKFNDAVLRHLTVFMDQAVTTPSAMMKEEKSRSISTSDDAAKQTPA

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
86 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
260 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
292 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
293 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
294 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
295 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
296 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
297 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
308 2738541277 Variovorax sp. GV051 Isolate Unclassified
309 2738541307 Variovorax sp. GV008 Isolate Unclassified
310 2738543019 Variovorax sp. GV040 Isolate Unclassified
311 2842733646 Variovorax sp. R-72446 Isolate Unclassified
312 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
313 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
314 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
315 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
316 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
317 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
318 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 1.73
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0
Rhizoplane 2.38
Rhizosphere 88.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0263281 3300049578 Bacteria 1245
2 Ga0006765J45826_108768 3300003161 Bacteria 1560
3 Ga0006759J45824_1032759 3300003163 Bacteria 1554
4 Ga0006770J48903_1035331 3300003305 Bacteria 541
5 rootL2_10000075 3300003322 Bacteria 6881
6 Ga0007416J51690_1029224 3300003577 Bacteria 1555
7 Ga0058860_10016004 3300004801 Bacteria 1489
8 Ga0070658_10357554 3300005327 Bacteria 1250
9 Ga0070676_10082082 3300005328 Bacteria 1958
10 Ga0070683_100023480 3300005329 Bacteria 5517
11 Ga0070690_100800878 3300005330 Bacteria 731
12 Ga0070670_100003776 3300005331 Bacteria 12608
13 Ga0070670_100711003 3300005331 Bacteria 904
14 Ga0068869_100039463 3300005334 Bacteria 3371
15 Ga0070666_10278910 3300005335 Bacteria 1188
16 Ga0068868_100116500 3300005338 Bacteria 2176
17 Ga0068868_100194519 3300005338 Bacteria 1688
18 Ga0068868_100431345 3300005338 Bacteria 1143
19 Ga0070660_100055654 3300005339 Bacteria 3058
20 Ga0070660_100302086 3300005339 Bacteria 1312
21 Ga0070689_100138937 3300005340 Bacteria 1953
22 Ga0070689_100997478 3300005340 Bacteria 745
23 Ga0070687_100387231 3300005343 Bacteria 913
24 Ga0070687_100742021 3300005343 Bacteria 690
25 Ga0070661_100000863 3300005344 Bacteria 21771
26 Ga0070661_101105489 3300005344 Bacteria 660
27 Ga0070692_10466157 3300005345 Bacteria 812
28 Ga0070668_100027977 3300005347 Bacteria 4278
29 Ga0070668_100238129 3300005347 Bacteria 1507
30 Ga0070669_100932284 3300005353 Bacteria 743
31 Ga0070675_100019685 3300005354 Bacteria 5381
32 Ga0070675_101007511 3300005354 Bacteria 765
33 Ga0070671_100673382 3300005355 Bacteria 896
34 Ga0070674_100430614 3300005356 Bacteria 1085
35 Ga0070674_100478085 3300005356 Bacteria 1033
36 Ga0070674_101697839 3300005356 Bacteria 571
37 Ga0070673_100003787 3300005364 Bacteria 9489
38 Ga0070673_100796953 3300005364 Bacteria 872
39 Ga0070673_101067120 3300005364 Bacteria 754
40 Ga0070659_100013471 3300005366 Bacteria 6088
41 Ga0070659_101093186 3300005366 Bacteria 703
42 Ga0070667_100123903 3300005367 Bacteria 2251
43 Ga0070667_100822784 3300005367 Bacteria 863
44 Ga0070714_100002440 3300005435 Bacteria 13710
45 Ga0070710_10092530 3300005437 Bacteria 1786
46 Ga0070694_100310218 3300005444 Bacteria 1211
47 Ga0070694_101047448 3300005444 Bacteria 679
48 Ga0070708_100114452 3300005445 Bacteria 2482
49 Ga0070708_100301022 3300005445 Bacteria 1510
50 Ga0070663_100378984 3300005455 Bacteria 1152
51 Ga0070663_100405079 3300005455 Bacteria 1116
52 Ga0070678_100169025 3300005456 Bacteria 1779
53 Ga0070678_100523223 3300005456 Bacteria 1050
54 Ga0070662_100513492 3300005457 Bacteria 1000
55 Ga0070681_10479617 3300005458 Bacteria 1156
56 Ga0070681_10522038 3300005458 Bacteria 1101
57 Ga0068867_100473524 3300005459 Bacteria 1071
58 Ga0068867_100898947 3300005459 Bacteria 797
59 Ga0070685_10119774 3300005466 Bacteria 1633
60 Ga0070707_100253236 3300005468 Bacteria 1714
61 Ga0070699_100161653 3300005518 Bacteria 1982
62 Ga0070679_100019757 3300005530 Bacteria 6558
63 Ga0070679_100175321 3300005530 Bacteria 2116
64 Ga0070684_100012758 3300005535 Bacteria 6747
65 Ga0068853_100688262 3300005539 Bacteria 975
66 Ga0070696_100117869 3300005546 Bacteria 1919
67 Ga0070693_100010286 3300005547 Bacteria 4684
68 Ga0070665_100155251 3300005548 Bacteria 2291
69 Ga0070665_100163292 3300005548 Bacteria 2229
70 Ga0070665_100674602 3300005548 Bacteria 1047
71 Ga0070704_100763569 3300005549 Bacteria 862
72 Ga0070704_100987939 3300005549 Bacteria 761
73 Ga0068855_100014353 3300005563 Bacteria 9538
74 Ga0068855_100125556 3300005563 Bacteria 2934
75 Ga0068855_100331548 3300005563 Bacteria 1680
76 Ga0068857_100640909 3300005577 Bacteria 1006
77 Ga0068854_100011767 3300005578 Bacteria 5711
78 Ga0068856_100253591 3300005614 Bacteria 1774
79 Ga0068852_100184533 3300005616 Bacteria 1964
80 Ga0068859_100041674 3300005617 Bacteria 4611
81 Ga0068859_100094708 3300005617 Bacteria 3038
82 Ga0068864_100000849 3300005618 Bacteria 25790
83 Ga0068864_100071855 3300005618 Bacteria 3014
84 Ga0068864_100314556 3300005618 Bacteria 1469
85 Ga0068866_10031161 3300005718 Bacteria 2566
86 Ga0068861_100061661 3300005719 Bacteria 2879
87 Ga0068851_10014818 3300005834 Bacteria 3707
88 Ga0068870_10561894 3300005840 Bacteria 770
89 Ga0068863_100004993 3300005841 Bacteria 13078
90 Ga0068863_100029651 3300005841 Bacteria 5223
91 Ga0068863_100065189 3300005841 Bacteria 3446
92 Ga0068863_100102619 3300005841 Bacteria 2720
93 Ga0068858_100063103 3300005842 Bacteria 3428
94 Ga0068862_100007500 3300005844 Bacteria 9039
95 Ga0075363_100216714 3300006048 Bacteria 1096
96 Ga0075364_10087787 3300006051 Bacteria 2061
97 Ga0075364_10533747 3300006051 Bacteria 802
98 Ga0070715_10278412 3300006163 Bacteria 886
99 Ga0075362_10772378 3300006177 Bacteria 504
100 Ga0075366_10842130 3300006195 Bacteria 571
101 Ga0097621_100031379 3300006237 Bacteria 4217
102 Ga0097621_100230849 3300006237 Bacteria 1615
103 Ga0097621_100864501 3300006237 Bacteria 841
104 Ga0075370_10756557 3300006353 Bacteria 592
105 Ga0068871_101113279 3300006358 Bacteria 739
106 Ga0068865_100051386 3300006881 Bacteria 2853
107 Ga0097620_100041675 3300006931 Bacteria 4611
108 Ga0097620_100094709 3300006931 Bacteria 3038
109 Ga0105240_10002731 3300009093 Bacteria 27994
110 Ga0105240_10420669 3300009093 Bacteria 1501
111 Ga0111539_10709454 3300009094 Bacteria 1171
112 Ga0105245_10129838 3300009098 Bacteria 2362
113 Ga0105245_10183286 3300009098 Bacteria 2002
114 Ga0105247_10133305 3300009101 Bacteria 1621
115 Ga0105247_10779766 3300009101 Bacteria 727
116 Ga0114129_11206056 3300009147 Bacteria 942
117 Ga0114129_12377380 3300009147 Bacteria 635
118 Ga0105243_10547887 3300009148 Bacteria 1105
119 Ga0105241_10038351 3300009174 Bacteria 3612
120 Ga0105242_10681615 3300009176 Bacteria 1003
121 Ga0105248_10062459 3300009177 Bacteria 4183
122 Ga0105237_10139819 3300009545 Bacteria 2415
123 Ga0105238_10000890 3300009551 Bacteria 30714
124 Ga0105249_10304265 3300009553 Bacteria 1600
125 Ga0105246_11178464 3300011119 Bacteria 704
126 Ga0157336_1008715 3300012477 Bacteria 742
127 Ga0157347_1028095 3300012502 Bacteria 693
128 Ga0157373_10055539 3300013100 Bacteria 2813
129 Ga0157370_10034627 3300013104 Bacteria 4915
130 Ga0157369_10029568 3300013105 Bacteria 6054
131 Ga0157378_10056290 3300013297 Bacteria 3504
132 Ga0163162_10364130 3300013306 Bacteria 1579
133 Ga0157372_10027498 3300013307 Bacteria 6196
134 Ga0157372_10443751 3300013307 Bacteria 1512
135 Ga0157375_10143852 3300013308 Bacteria 2514
136 Ga0157375_10458427 3300013308 Bacteria 1440
137 Ga0157375_10796214 3300013308 Bacteria 1094
138 Ga0163163_10005079 3300014325 Bacteria 11340
139 Ga0163163_10037228 3300014325 Bacteria 4732
140 Ga0163163_10044327 3300014325 Bacteria 4364
141 Ga0157380_10499782 3300014326 Bacteria 1181
142 Ga0157380_10501649 3300014326 Bacteria 1179
143 Ga0157377_10075797 3300014745 Bacteria 1954
144 Ga0157379_10056029 3300014968 Bacteria 3523
145 Ga0157379_10185311 3300014968 Bacteria 1881
146 Ga0157376_10110096 3300014969 Bacteria 2423
147 Ga0157376_10502882 3300014969 Bacteria 1191
148 Ga0157376_11728948 3300014969 Bacteria 661
149 Ga0163161_10765423 3300017792 Bacteria 809
150 Ga0163161_11297769 3300017792 Bacteria 633
151 Ga0213872_10009346 3300021361 Bacteria 4704
152 Ga0213872_10012400 3300021361 Bacteria 4010
153 Ga0213872_10012656 3300021361 Bacteria 3965
154 Ga0209675_1006846 3300025291 Bacteria 4494
155 Ga0209676_1000260 3300025292 Bacteria 111683
156 Ga0209025_1059808 3300025294 Bacteria 1435
157 Ga0209051_1000319 3300025303 Bacteria 72894
158 Ga0209257_1010636 3300025304 Bacteria 4610
159 Ga0207697_10153029 3300025315 Bacteria 1004
160 Ga0207656_10028530 3300025321 Bacteria 2291
161 Ga0207680_10089311 3300025903 Bacteria 1956
162 Ga0207685_10222000 3300025905 Bacteria 899
163 Ga0207645_10019571 3300025907 Bacteria 4437
164 Ga0207645_10040820 3300025907 Bacteria 2972
165 Ga0207643_10325664 3300025908 Bacteria 960
166 Ga0207643_10481584 3300025908 Bacteria 792
167 Ga0207705_10125612 3300025909 Bacteria 1906
168 Ga0207705_10417063 3300025909 Bacteria 1039
169 Ga0207654_10129354 3300025911 Bacteria 1596
170 Ga0207695_10019505 3300025913 Bacteria 7807
171 Ga0207695_10172732 3300025913 Bacteria 2086
172 Ga0207671_10596699 3300025914 Bacteria 880
173 Ga0207693_11244944 3300025915 Bacteria 559
174 Ga0207660_10249556 3300025917 Bacteria 1400
175 Ga0207657_10000709 3300025919 Bacteria 35416
176 Ga0207657_10005307 3300025919 Bacteria 13507
177 Ga0207657_10309883 3300025919 Bacteria 1250
178 Ga0207649_10335053 3300025920 Bacteria 1116
179 Ga0207649_10402763 3300025920 Bacteria 1024
180 Ga0207649_10518808 3300025920 Bacteria 908
181 Ga0207652_10812243 3300025921 Bacteria 830
182 Ga0207646_10182659 3300025922 Bacteria 1894
183 Ga0207694_10016778 3300025924 Bacteria 5534
184 Ga0207650_10988364 3300025925 Bacteria 716
185 Ga0207659_10017642 3300025926 Bacteria 4664
186 Ga0207659_10100437 3300025926 Bacteria 2180
187 Ga0207659_10349414 3300025926 Bacteria 1227
188 Ga0207687_10201843 3300025927 Bacteria 1555
189 Ga0207700_10503106 3300025928 Bacteria 1072
190 Ga0207664_10047438 3300025929 Bacteria 3374
191 Ga0207644_10002884 3300025931 Bacteria 11075
192 Ga0207644_10009549 3300025931 Bacteria 6372
193 Ga0207644_10125212 3300025931 Bacteria 1961
194 Ga0207644_10954537 3300025931 Bacteria 719
195 Ga0207690_10003165 3300025932 Bacteria 9891
196 Ga0207690_10171169 3300025932 Bacteria 1627
197 Ga0207690_10525750 3300025932 Bacteria 959
198 Ga0207706_10000002 3300025933 Bacteria 360309
199 Ga0207709_10000240 3300025935 Bacteria 68308
200 Ga0207670_11358247 3300025936 Bacteria 603
201 Ga0207669_10227372 3300025937 Bacteria 1374
202 Ga0207704_11008815 3300025938 Bacteria 704
203 Ga0207691_10088495 3300025940 Bacteria 2777
204 Ga0207711_10688889 3300025941 Bacteria 953
205 Ga0207689_10000320 3300025942 Bacteria 44520
206 Ga0207661_10158163 3300025944 Bacteria 1964
207 Ga0207679_10001683 3300025945 Bacteria 13764
208 Ga0207679_10081062 3300025945 Bacteria 2480
209 Ga0207667_10003619 3300025949 Bacteria 19070
210 Ga0207667_10065056 3300025949 Bacteria 3805
211 Ga0207667_10184364 3300025949 Bacteria 2143
212 Ga0207667_10559763 3300025949 Bacteria 1156
213 Ga0207651_10036344 3300025960 Bacteria 3214
214 Ga0207712_10366183 3300025961 Bacteria 1202
215 Ga0207668_10009762 3300025972 Bacteria 5765
216 Ga0207640_10010809 3300025981 Bacteria 5152
217 Ga0207640_10265279 3300025981 Bacteria 1340
218 Ga0207658_10420176 3300025986 Bacteria 1179
219 Ga0207658_11744163 3300025986 Bacteria 568
220 Ga0207677_10223210 3300026023 Bacteria 1513
221 Ga0207677_10928867 3300026023 Bacteria 786
222 Ga0207703_10276530 3300026035 Bacteria 1523
223 Ga0207639_10151659 3300026041 Bacteria 1942
224 Ga0207678_10029888 3300026067 Bacteria 4757
225 Ga0207708_10351713 3300026075 Bacteria 1209
226 Ga0207708_11082322 3300026075 Bacteria 698
227 Ga0207708_11333820 3300026075 Bacteria 629
228 Ga0207702_10018475 3300026078 Bacteria 5768
229 Ga0207702_10031526 3300026078 Bacteria 4418
230 Ga0207641_10079145 3300026088 Bacteria 2849
231 Ga0207641_10304903 3300026088 Bacteria 1505
232 Ga0207648_10056023 3300026089 Bacteria 3441
233 Ga0207648_10807170 3300026089 Bacteria 874
234 Ga0207648_11062161 3300026089 Bacteria 759
235 Ga0207676_10110037 3300026095 Bacteria 2304
236 Ga0207676_10186567 3300026095 Bacteria 1821
237 Ga0207674_10000049 3300026116 Bacteria 118784
238 Ga0207674_10259769 3300026116 Bacteria 1684
239 Ga0207674_11593769 3300026116 Bacteria 622
240 Ga0207675_100109526 3300026118 Bacteria 2606
241 Ga0207675_100288612 3300026118 Bacteria 1596
242 Ga0207675_101773827 3300026118 Bacteria 637
243 Ga0207683_10175260 3300026121 Bacteria 1943
244 Ga0207683_10344821 3300026121 Bacteria 1366
245 Ga0207698_10159677 3300026142 Bacteria 1970
246 Ga0207698_10427004 3300026142 Bacteria 1273
247 Ga0209969_1004714 3300027360 Bacteria 1905
248 Ga0210000_1004363 3300027462 Bacteria 2044
249 Ga0209995_1004296 3300027471 Bacteria 2278
250 Ga0209968_1054552 3300027526 Bacteria 698
251 Ga0209982_1003882 3300027552 Bacteria 2136
252 Ga0209970_1052513 3300027614 Bacteria 739
253 Ga0209983_1005254 3300027665 Bacteria 2688
254 Ga0209971_1010276 3300027682 Bacteria 2216
255 Ga0209974_10005500 3300027876 Bacteria 4452
256 Ga0209974_10042824 3300027876 Bacteria 1508
257 Ga0268266_10357222 3300028379 Bacteria 1374
258 Ga0268265_10016272 3300028380 Bacteria 5106
259 Ga0268265_10049344 3300028380 Bacteria 3165
260 Ga0268265_11192473 3300028380 Bacteria 759
261 Ga0268265_11469164 3300028380 Bacteria 685
262 Ga0268264_11633014 3300028381 Bacteria 655
263 Ga0307517_10466964 3300028786 Bacteria 650
264 Ga0265324_10004146 3300029957 Bacteria 6626
265 Ga0307512_10064330 3300030522 Bacteria 2795
266 Ga0265328_10077193 3300031239 Bacteria 1226
267 Ga0265325_10147057 3300031241 Bacteria 1117
268 Ga0265331_10014114 3300031250 Bacteria 4267
269 Ga0265331_10016544 3300031250 Bacteria 3869
270 Ga0265331_10245256 3300031250 Bacteria 804
271 Ga0265327_10000116 3300031251 Bacteria 173745
272 Ga0265327_10003965 3300031251 Bacteria 13521
273 Ga0307408_100005881 3300031548 Bacteria 8170
274 Ga0307408_100591420 3300031548 Bacteria 985
275 Ga0307508_10791154 3300031616 Bacteria 565
276 Ga0265314_10008135 3300031711 Bacteria 9024
277 Ga0307405_10001520 3300031731 Bacteria 9827
278 Ga0307405_10721731 3300031731 Bacteria 827
279 Ga0307405_11105565 3300031731 Bacteria 681
280 Ga0307413_10012089 3300031824 Bacteria 4279
281 Ga0307413_10033221 3300031824 Bacteria 2935
282 Ga0307413_11416813 3300031824 Bacteria 612
283 Ga0307410_10008332 3300031852 Bacteria 5745
284 Ga0307410_10043358 3300031852 Bacteria 2981
285 Ga0307406_10002537 3300031901 Bacteria 9956
286 Ga0307412_10009901 3300031911 Bacteria 5481
287 Ga0307409_100020670 3300031995 Bacteria 4492
288 Ga0307416_100012556 3300032002 Bacteria 5713
289 Ga0307416_100366588 3300032002 Bacteria 1465
290 Ga0307416_102453351 3300032002 Bacteria 620
291 Ga0307414_10279257 3300032004 Bacteria 1402
292 Ga0307414_10305223 3300032004 Bacteria 1348
293 Ga0307411_10010279 3300032005 Bacteria 4978
294 Ga0307411_10061940 3300032005 Bacteria 2493
295 Ga0307415_100010348 3300032126 Bacteria 5279
296 Ga0373930_0017201 3300034816 Bacteria 1376
297 Ga0373949_0229880 3300035090 Bacteria 567
298 Ga0373932_0164736 3300035112 Bacteria 769
299 Ga0373936_0378180 3300035113 Bacteria 648
300 Ga0373939_0374582 3300035114 Bacteria 585
301 Ga0373939_0396195 3300035114 Bacteria 571
302 Ga0373945_0191561 3300035116 Bacteria 846
303 Ga0373946_0175939 3300035171 Bacteria 1013
304 Ga0373962_0059765 3300035242 Bacteria 1117
305 Ga0316574_0587091 3300035398 Bacteria 689
306 Ga0373924_0352945 3300035410 Bacteria 655
307 Ga0373931_0057856 3300035691 Bacteria 2080
308 Ga0373927_0015912 3300035695 Bacteria 4964
309 Ga0373933_0173086 3300035724 Bacteria 1374
310 Ga0373937_0492021 3300036401 Bacteria 1165
311 Ga0373937_0912276 3300036401 Bacteria 827
312 Ga0316582_0637518 3300036647 Bacteria 733
313 Ga0373925_0414136 3300037068 Bacteria 1100
314 Ga0395899_0267257 3300037312 Bacteria 1167
315 Ga0395900_0007306 3300037418 Bacteria 11426
316 Ga0395898_0004864 3300037466 Bacteria 14586
317 Ga0395905_0197445 3300037471 Bacteria 1886
318 Ga0395905_0299136 3300037471 Bacteria 1496
319 Ga0395905_0458121 3300037471 Bacteria 1173
320 Ga0436364_0553400 3300037853 Bacteria 1231
321 Ga0395901_0192139 3300038443 Bacteria 2141
322 Ga0436361_0924126 3300039447 Bacteria 8644
323 Ga0436361_1021227 3300039447 Bacteria 4437
324 Ga0436361_1046017 3300039447 Bacteria 8969
325 Ga0451797_0112246 3300041453 Bacteria 1043
326 Ga0451837_0902724 3300041494 Bacteria 566
327 Ga0439443_038829 3300042003 Bacteria 808
328 Ga0439448_0295198 3300042005 Bacteria 575
329 Ga0439435_0304938 3300042436 Bacteria 546
330 Ga0439444_0106950 3300042437 Bacteria 640
331 Ga0439460_0182505 3300042461 Bacteria 710
332 Ga0451577_0000002 3300042876 Bacteria 1731375
333 Ga0451577_0101062 3300042876 Bacteria 2576
334 Ga0451577_0635963 3300042876 Bacteria 968
335 Ga0466969_0003770 3300044656 Bacteria 8058
336 Ga0453683_0000011 3300044673 Bacteria 412765
337 Ga0453683_0029520 3300044673 Bacteria 3467
338 Ga0466965_0038802 3300044683 Bacteria 2340
339 Ga0466966_0007784 3300044684 Bacteria 7096
340 Ga0466961_0000903 3300044693 Bacteria 18426
341 Ga0453684_0000002 3300044712 Bacteria 1731375
342 Ga0453684_0000040 3300044712 Bacteria 690210
343 Ga0453684_0044376 3300044712 Bacteria 5950
344 Ga0466957_0070427 3300044842 Bacteria 2161
345 Ga0466959_0012730 3300045049 Bacteria 6085
346 Ga0451576_0000004 3300045051 Bacteria 1312238
347 Ga0451576_0009821 3300045051 Bacteria 11060
348 Ga0451576_0035577 3300045051 Bacteria 5282
349 Ga0451576_0551987 3300045051 Bacteria 1210
350 Ga0451576_1202009 3300045051 Bacteria 792
351 Ga0495592_0341912 3300046454 Bacteria 962
352 Ga0495629_0627428 3300046459 Bacteria 717
353 Ga0495580_0035643 3300046472 Bacteria 3577
354 Ga0495583_0149634 3300046506 Bacteria 968
355 Ga0495620_0015501 3300046515 Bacteria 3846
356 Ga0495637_0021655 3300046520 Bacteria 2944
357 Ga0495609_0350979 3300046538 Bacteria 595
358 Ga0495621_0025039 3300046539 Bacteria 2001
359 Ga0495633_0072098 3300046558 Bacteria 1611
360 Ga0495668_0076174 3300046616 Bacteria 1842
361 Ga0495625_0057672 3300046660 Bacteria 2760
362 Ga0495588_0027599 3300046674 Bacteria 2837
363 Ga0495588_0071080 3300046674 Bacteria 1809
364 Ga0495657_0503300 3300046675 Bacteria 706
365 Ga0495613_0567316 3300046689 Bacteria 758
366 Ga0495670_0035452 3300046691 Bacteria 2487
367 Ga0495600_0848940 3300046809 Bacteria 541
368 Ga0495660_0146786 3300046810 Bacteria 1168
369 Ga0495676_0040342 3300047321 Bacteria 3853
370 Ga0495676_0915525 3300047321 Bacteria 561
371 Ga0495593_0002587 3300047673 Bacteria 10878
372 Ga0495614_0003634 3300048089 Bacteria 6914
373 Ga0496100_0219698 3300048903 Bacteria 1394
374 Ga0496101_0031403 3300048904 Bacteria 3734
375 Ga0496101_0160541 3300048904 Bacteria 1723
376 Ga0496102_0006121 3300048905 Bacteria 10254
377 Ga0496102_0446939 3300048905 Bacteria 1213
378 Ga0496106_0000409 3300048909 Bacteria 30485
379 Ga0496107_0001779 3300048910 Bacteria 13578
380 Ga0496111_0747791 3300048914 Bacteria 709
381 Ga0496113_0068350 3300048916 Bacteria 2696
382 Ga0496113_1317501 3300048916 Bacteria 561
383 Ga0501306_032651 3300049127 Bacteria 780
384 Ga0501290_027440 3300049513 Bacteria 803
385 Ga0501319_028089 3300049535 Bacteria 532
386 Ga0501322_008369 3300049538 Bacteria 767
387 Ga0501031_0091008 3300049568 Bacteria 1990
388 Ga0501031_0206818 3300049568 Bacteria 1280
389 Ga0501033_0058510 3300049570 Bacteria 2847
390 Ga0501034_0065598 3300049571 Bacteria 3643
391 Ga0501036_0107609 3300049572 Bacteria 2357
392 Ga0501036_0418219 3300049572 Bacteria 1118
393 Ga0501037_0039661 3300049573 Bacteria 3467
394 Ga0501037_0337531 3300049573 Bacteria 1041
395 Ga0501039_0009173 3300049575 Bacteria 7537
396 Ga0501039_0437713 3300049575 Bacteria 1027
397 Ga0501040_0116026 3300049576 Bacteria 1875
398 Ga0501040_0579855 3300049576 Bacteria 810
399 Ga0501041_0009354 3300049577 Bacteria 5773
400 Ga0501041_0428558 3300049577 Bacteria 839
401 Ga0501042_0413406 3300049578 Bacteria 977
402 Ga0501043_0072569 3300049579 Bacteria 2704
403 Ga0501046_0014670 3300049580 Bacteria 6599
404 Ga0501046_0044993 3300049580 Bacteria 3509
405 Ga0501047_0011595 3300049581 Bacteria 8341
406 Ga0501048_0113110 3300049582 Bacteria 1917
407 Ga0501071_0006583 3300049587 Bacteria 7546
408 Ga0501071_0694972 3300049587 Bacteria 783
409 Ga0501073_0065489 3300049589 Bacteria 2534
410 Ga0501073_0459353 3300049589 Bacteria 880
411 Ga0501076_0004601 3300049592 Bacteria 9821
412 Ga0501076_0289069 3300049592 Bacteria 1343
413 Ga0501076_0384857 3300049592 Bacteria 1153
414 Ga0501077_0034931 3300049593 Bacteria 3200
415 Ga0501079_0000832 3300049741 Bacteria 20981
416 Ga0501080_0037266 3300049742 Bacteria 4540
417 Ga0501080_0184353 3300049742 Bacteria 1920
418 Ga0501080_0252591 3300049742 Bacteria 1608
419 Ga0501080_1602391 3300049742 Bacteria 551
420 Ga0501081_0007856 3300049743 Bacteria 6919
421 Ga0501081_0327091 3300049743 Bacteria 1127
422 Ga0501083_0035991 3300049744 Bacteria 3379
423 Ga0501083_0087736 3300049744 Bacteria 2057
424 Ga0501035_0332043 3300049822 Bacteria 1276
425 Ga0501035_0684891 3300049822 Bacteria 828
426 Ga0501044_0045550 3300049823 Bacteria 4544
427 Ga0501044_1183025 3300049823 Bacteria 633
428 Ga0501045_0007263 3300049824 Bacteria 7692
429 nmdc:mga03683_264607_c1 3300050489 Bacteria 801
430 nmdc:mga00v17_641313_c1 3300050491 Bacteria 683
431 nmdc:mga0k408_459553_c1 3300050493 Bacteria 756
432 nmdc:mga0n895_1402063_c1 3300050512 Bacteria 667
433 Ga0495612_0228238 3300053078 Bacteria 825
434 Ga0500651_0000449 3300053093 Bacteria 21984
435 Ga0500650_0095018 3300053098 Bacteria 1396
436 Ga0500571_018711 3300053110 Bacteria 3870
437 Ga0500593_008590 3300053117 Bacteria 4204
438 Ga0500597_315318 3300053120 Bacteria 619
439 Ga0500607_007214 3300053121 Bacteria 6901
440 Ga0500608_187591 3300053122 Bacteria 868
441 Ga0500574_000538 3300053141 Bacteria 4878
442 Ga0500622_0000001 3300053156 Bacteria 657715
443 Ga0500627_0029726 3300053158 Bacteria 2281
444 Ga0500634_0080337 3300053161 Bacteria 1682
445 Ga0500638_059164 3300053162 Bacteria 1843
446 Ga0500636_0059544 3300053177 Bacteria 2231
447 Ga0590075_115532 3300059424 Bacteria 701
448 Ga0590077_042134 3300059426 Bacteria 1016
449 Ga0501082_0035040 3300060353 Bacteria 4326
450 Ga0501082_0381865 3300060353 Bacteria 1229
451 Ga0530510_0004439 3300061734 Bacteria 9712
452 2644162638 2643221628 Bacteria 5745828
453 2738719899 2738541277 Bacteria 7458140
454 2738879689 2738541307 Bacteria 8606193
455 2739279098 2738543019 Bacteria 7459457
456 2842734686 2842733646 Bacteria 5716726
457 2843691761 2843690924 Bacteria 5169057
458 2846036995 2846033681 Bacteria 4377894
459 2846041217 2846037992 Bacteria 4526407
460 2904480165 2904479285 Bacteria 5073931
461 2904543954 2904541872 Bacteria 8915136
462 2929162487 2929160207 Bacteria 9075316
463 2939636645 2939631187 Bacteria 6118131
464 Ga0501042_0263281
465 Ga0006765J45826_108768
466 Ga0006759J45824_1032759
467 Ga0006770J48903_1035331
468 rootL2_10000075
469 Ga0007416J51690_1029224
470 Ga0058860_10016004
471 Ga0070658_10357554
472 Ga0070676_10082082
473 Ga0070683_100023480
474 Ga0070690_100800878
475 Ga0070670_100003776
476 Ga0070670_100711003
477 Ga0068869_100039463
478 Ga0070666_10278910
479 Ga0068868_100116500
480 Ga0068868_100194519
481 Ga0068868_100431345
482 Ga0070660_100055654
483 Ga0070660_100302086
484 Ga0070689_100138937
485 Ga0070689_100997478
486 Ga0070687_100387231
487 Ga0070687_100742021
488 Ga0070661_100000863
489 Ga0070661_101105489
490 Ga0070692_10466157
491 Ga0070668_100027977
492 Ga0070668_100238129
493 Ga0070669_100932284
494 Ga0070675_100019685
495 Ga0070675_101007511
496 Ga0070671_100673382
497 Ga0070674_100430614
498 Ga0070674_100478085
499 Ga0070674_101697839
500 Ga0070673_100003787
501 Ga0070673_100796953
502 Ga0070673_101067120
503 Ga0070659_100013471
504 Ga0070659_101093186
505 Ga0070667_100123903
506 Ga0070667_100822784
507 Ga0070714_100002440
508 Ga0070710_10092530
509 Ga0070694_100310218
510 Ga0070694_101047448
511 Ga0070708_100114452
512 Ga0070708_100301022
513 Ga0070663_100378984
514 Ga0070663_100405079
515 Ga0070678_100169025
516 Ga0070678_100523223
517 Ga0070662_100513492
518 Ga0070681_10479617
519 Ga0070681_10522038
520 Ga0068867_100473524
521 Ga0068867_100898947
522 Ga0070685_10119774
523 Ga0070707_100253236
524 Ga0070699_100161653
525 Ga0070679_100019757
526 Ga0070679_100175321
527 Ga0070684_100012758
528 Ga0068853_100688262
529 Ga0070696_100117869
530 Ga0070693_100010286
531 Ga0070665_100155251
532 Ga0070665_100163292
533 Ga0070665_100674602
534 Ga0070704_100763569
535 Ga0070704_100987939
536 Ga0068855_100014353
537 Ga0068855_100125556
538 Ga0068855_100331548
539 Ga0068857_100640909
540 Ga0068854_100011767
541 Ga0068856_100253591
542 Ga0068852_100184533
543 Ga0068859_100041674
544 Ga0068859_100094708
545 Ga0068864_100000849
546 Ga0068864_100071855
547 Ga0068864_100314556
548 Ga0068866_10031161
549 Ga0068861_100061661
550 Ga0068851_10014818
551 Ga0068870_10561894
552 Ga0068863_100004993
553 Ga0068863_100029651
554 Ga0068863_100065189
555 Ga0068863_100102619
556 Ga0068858_100063103
557 Ga0068862_100007500
558 Ga0075363_100216714
559 Ga0075364_10087787
560 Ga0075364_10533747
561 Ga0070715_10278412
562 Ga0075362_10772378
563 Ga0075366_10842130
564 Ga0097621_100031379
565 Ga0097621_100230849
566 Ga0097621_100864501
567 Ga0075370_10756557
568 Ga0068871_101113279
569 Ga0068865_100051386
570 Ga0097620_100041675
571 Ga0097620_100094709
572 Ga0105240_10002731
573 Ga0105240_10420669
574 Ga0111539_10709454
575 Ga0105245_10129838
576 Ga0105245_10183286
577 Ga0105247_10133305
578 Ga0105247_10779766
579 Ga0114129_11206056
580 Ga0114129_12377380
581 Ga0105243_10547887
582 Ga0105241_10038351
583 Ga0105242_10681615
584 Ga0105248_10062459
585 Ga0105237_10139819
586 Ga0105238_10000890
587 Ga0105249_10304265
588 Ga0105246_11178464
589 Ga0157336_1008715
590 Ga0157347_1028095
591 Ga0157373_10055539
592 Ga0157370_10034627
593 Ga0157369_10029568
594 Ga0157378_10056290
595 Ga0163162_10364130
596 Ga0157372_10027498
597 Ga0157372_10443751
598 Ga0157375_10143852
599 Ga0157375_10458427
600 Ga0157375_10796214
601 Ga0163163_10005079
602 Ga0163163_10037228
603 Ga0163163_10044327
604 Ga0157380_10499782
605 Ga0157380_10501649
606 Ga0157377_10075797
607 Ga0157379_10056029
608 Ga0157379_10185311
609 Ga0157376_10110096
610 Ga0157376_10502882
611 Ga0157376_11728948
612 Ga0163161_10765423
613 Ga0163161_11297769
614 Ga0213872_10009346
615 Ga0213872_10012400
616 Ga0213872_10012656
617 Ga0209675_1006846
618 Ga0209676_1000260
619 Ga0209025_1059808
620 Ga0209051_1000319
621 Ga0209257_1010636
622 Ga0207697_10153029
623 Ga0207656_10028530
624 Ga0207680_10089311
625 Ga0207685_10222000
626 Ga0207645_10019571
627 Ga0207645_10040820
628 Ga0207643_10325664
629 Ga0207643_10481584
630 Ga0207705_10125612
631 Ga0207705_10417063
632 Ga0207654_10129354
633 Ga0207695_10019505
634 Ga0207695_10172732
635 Ga0207671_10596699
636 Ga0207693_11244944
637 Ga0207660_10249556
638 Ga0207657_10000709
639 Ga0207657_10005307
640 Ga0207657_10309883
641 Ga0207649_10335053
642 Ga0207649_10402763
643 Ga0207649_10518808
644 Ga0207652_10812243
645 Ga0207646_10182659
646 Ga0207694_10016778
647 Ga0207650_10988364
648 Ga0207659_10017642
649 Ga0207659_10100437
650 Ga0207659_10349414
651 Ga0207687_10201843
652 Ga0207700_10503106
653 Ga0207664_10047438
654 Ga0207644_10002884
655 Ga0207644_10009549
656 Ga0207644_10125212
657 Ga0207644_10954537
658 Ga0207690_10003165
659 Ga0207690_10171169
660 Ga0207690_10525750
661 Ga0207706_10000002
662 Ga0207709_10000240
663 Ga0207670_11358247
664 Ga0207669_10227372
665 Ga0207704_11008815
666 Ga0207691_10088495
667 Ga0207711_10688889
668 Ga0207689_10000320
669 Ga0207661_10158163
670 Ga0207679_10001683
671 Ga0207679_10081062
672 Ga0207667_10003619
673 Ga0207667_10065056
674 Ga0207667_10184364
675 Ga0207667_10559763
676 Ga0207651_10036344
677 Ga0207712_10366183
678 Ga0207668_10009762
679 Ga0207640_10010809
680 Ga0207640_10265279
681 Ga0207658_10420176
682 Ga0207658_11744163
683 Ga0207677_10223210
684 Ga0207677_10928867
685 Ga0207703_10276530
686 Ga0207639_10151659
687 Ga0207678_10029888
688 Ga0207708_10351713
689 Ga0207708_11082322
690 Ga0207708_11333820
691 Ga0207702_10018475
692 Ga0207702_10031526
693 Ga0207641_10079145
694 Ga0207641_10304903
695 Ga0207648_10056023
696 Ga0207648_10807170
697 Ga0207648_11062161
698 Ga0207676_10110037
699 Ga0207676_10186567
700 Ga0207674_10000049
701 Ga0207674_10259769
702 Ga0207674_11593769
703 Ga0207675_100109526
704 Ga0207675_100288612
705 Ga0207675_101773827
706 Ga0207683_10175260
707 Ga0207683_10344821
708 Ga0207698_10159677
709 Ga0207698_10427004
710 Ga0209969_1004714
711 Ga0210000_1004363
712 Ga0209995_1004296
713 Ga0209968_1054552
714 Ga0209982_1003882
715 Ga0209970_1052513
716 Ga0209983_1005254
717 Ga0209971_1010276
718 Ga0209974_10005500
719 Ga0209974_10042824
720 Ga0268266_10357222
721 Ga0268265_10016272
722 Ga0268265_10049344
723 Ga0268265_11192473
724 Ga0268265_11469164
725 Ga0268264_11633014
726 Ga0307517_10466964
727 Ga0265324_10004146
728 Ga0307512_10064330
729 Ga0265328_10077193
730 Ga0265325_10147057
731 Ga0265331_10014114
732 Ga0265331_10016544
733 Ga0265331_10245256
734 Ga0265327_10000116
735 Ga0265327_10003965
736 Ga0307408_100005881
737 Ga0307408_100591420
738 Ga0307508_10791154
739 Ga0265314_10008135
740 Ga0307405_10001520
741 Ga0307405_10721731
742 Ga0307405_11105565
743 Ga0307413_10012089
744 Ga0307413_10033221
745 Ga0307413_11416813
746 Ga0307410_10008332
747 Ga0307410_10043358
748 Ga0307406_10002537
749 Ga0307412_10009901
750 Ga0307409_100020670
751 Ga0307416_100012556
752 Ga0307416_100366588
753 Ga0307416_102453351
754 Ga0307414_10279257
755 Ga0307414_10305223
756 Ga0307411_10010279
757 Ga0307411_10061940
758 Ga0307415_100010348
759 Ga0373930_0017201
760 Ga0373949_0229880
761 Ga0373932_0164736
762 Ga0373936_0378180
763 Ga0373939_0374582
764 Ga0373939_0396195
765 Ga0373945_0191561
766 Ga0373946_0175939
767 Ga0373962_0059765
768 Ga0316574_0587091
769 Ga0373924_0352945
770 Ga0373931_0057856
771 Ga0373927_0015912
772 Ga0373933_0173086
773 Ga0373937_0492021
774 Ga0373937_0912276
775 Ga0316582_0637518
776 Ga0373925_0414136
777 Ga0395899_0267257
778 Ga0395900_0007306
779 Ga0395898_0004864
780 Ga0395905_0197445
781 Ga0395905_0299136
782 Ga0395905_0458121
783 Ga0436364_0553400
784 Ga0395901_0192139
785 Ga0436361_0924126
786 Ga0436361_1021227
787 Ga0436361_1046017
788 Ga0451797_0112246
789 Ga0451837_0902724
790 Ga0439443_038829
791 Ga0439448_0295198
792 Ga0439435_0304938
793 Ga0439444_0106950
794 Ga0439460_0182505
795 Ga0451577_0000002
796 Ga0451577_0101062
797 Ga0451577_0635963
798 Ga0466969_0003770
799 Ga0453683_0000011
800 Ga0453683_0029520
801 Ga0466965_0038802
802 Ga0466966_0007784
803 Ga0466961_0000903
804 Ga0453684_0000002
805 Ga0453684_0000040
806 Ga0453684_0044376
807 Ga0466957_0070427
808 Ga0466959_0012730
809 Ga0451576_0000004
810 Ga0451576_0009821
811 Ga0451576_0035577
812 Ga0451576_0551987
813 Ga0451576_1202009
814 Ga0495592_0341912
815 Ga0495629_0627428
816 Ga0495580_0035643
817 Ga0495583_0149634
818 Ga0495620_0015501
819 Ga0495637_0021655
820 Ga0495609_0350979
821 Ga0495621_0025039
822 Ga0495633_0072098
823 Ga0495668_0076174
824 Ga0495625_0057672
825 Ga0495588_0027599
826 Ga0495588_0071080
827 Ga0495657_0503300
828 Ga0495613_0567316
829 Ga0495670_0035452
830 Ga0495600_0848940
831 Ga0495660_0146786
832 Ga0495676_0040342
833 Ga0495676_0915525
834 Ga0495593_0002587
835 Ga0495614_0003634
836 Ga0496100_0219698
837 Ga0496101_0031403
838 Ga0496101_0160541
839 Ga0496102_0006121
840 Ga0496102_0446939
841 Ga0496106_0000409
842 Ga0496107_0001779
843 Ga0496111_0747791
844 Ga0496113_0068350
845 Ga0496113_1317501
846 Ga0501306_032651
847 Ga0501290_027440
848 Ga0501319_028089
849 Ga0501322_008369
850 Ga0501031_0091008
851 Ga0501031_0206818
852 Ga0501033_0058510
853 Ga0501034_0065598
854 Ga0501036_0107609
855 Ga0501036_0418219
856 Ga0501037_0039661
857 Ga0501037_0337531
858 Ga0501039_0009173
859 Ga0501039_0437713
860 Ga0501040_0116026
861 Ga0501040_0579855
862 Ga0501041_0009354
863 Ga0501041_0428558
864 Ga0501042_0413406
865 Ga0501043_0072569
866 Ga0501046_0014670
867 Ga0501046_0044993
868 Ga0501047_0011595
869 Ga0501048_0113110
870 Ga0501071_0006583
871 Ga0501071_0694972
872 Ga0501073_0065489
873 Ga0501073_0459353
874 Ga0501076_0004601
875 Ga0501076_0289069
876 Ga0501076_0384857
877 Ga0501077_0034931
878 Ga0501079_0000832
879 Ga0501080_0037266
880 Ga0501080_0184353
881 Ga0501080_0252591
882 Ga0501080_1602391
883 Ga0501081_0007856
884 Ga0501081_0327091
885 Ga0501083_0035991
886 Ga0501083_0087736
887 Ga0501035_0332043
888 Ga0501035_0684891
889 Ga0501044_0045550
890 Ga0501044_1183025
891 Ga0501045_0007263
892 nmdc:mga03683_264607_c1
893 nmdc:mga00v17_641313_c1
894 nmdc:mga0k408_459553_c1
895 nmdc:mga0n895_1402063_c1
896 Ga0495612_0228238
897 Ga0500651_0000449
898 Ga0500650_0095018
899 Ga0500571_018711
900 Ga0500593_008590
901 Ga0500597_315318
902 Ga0500607_007214
903 Ga0500608_187591
904 Ga0500574_000538
905 Ga0500622_0000001
906 Ga0500627_0029726
907 Ga0500634_0080337
908 Ga0500638_059164
909 Ga0500636_0059544
910 Ga0590075_115532
911 Ga0590077_042134
912 Ga0501082_0035040
913 Ga0501082_0381865
914 Ga0530510_0004439
915 2644162638
916 2738719899
917 2738879689
918 2739279098
919 2842734686
920 2843691761
921 2846036995
922 2846041217
923 2904480165
924 2904543954
925 2929162487
926 2939636645

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

23

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oii-assembly1.cif.gz_j cspa-70 cotranslational folding intermediate 2 0.9432 1 102
6yt9-assembly1.cif.gz_g acinetobacter baumannii ribosome-tigecycline complex - 30s subunit body 0.9419 1 102
6yt9-assembly1.cif.gz_g acinetobacter baumannii ribosome-tigecycline complex - 30s subunit body 0.9243 1 102
7oii-assembly1.cif.gz_j cspa-70 cotranslational folding intermediate 2 0.917 1 102
7unu-assembly1.cif.gz_f pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9164 1 104
ID Description Score Start End Superfamily
af_P02358_1_115_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9472 1 110 3.30.70.60
4waoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9381 1 92 3.30.70.60
4waoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9284 1 92 3.30.70.60
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9029 2 99 3.30.70.60
af_P02358_1_115_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8994 1 110 3.30.70.60
ID Description Score Start End GO Terms
AF-B8F5T7-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9551 1 110 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-B0BQB3-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9517 1 110 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A316I2G4-F1-model_v4 Small ribosomal subunit protein bS6 0.9515 2 110 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A562J329-F1-model_v4 Small ribosomal subunit protein bS6 0.9507 1 110 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-A0A1E2V6K0-F1-model_v4 Small ribosomal subunit protein bS6 0.9504 1 110 GO:0003735
GO:0006412
GO:0022627
GO:0070181

Map