F449119

General Info

Members Datasets Scaffolds Average Seq Length
463 284 461 321

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10176271|Ga0207646_101762712
Length 356
Sequence LLLVEWKFCWLSNLIFLFFKISRHNTLIYISIDCLIVIRDLVKRFDNLTAVDRLNLDIHENEVFGLLGSNGAGKTTTIHMLATLLKPTSGTATVNGFDIVTQSAKVRGSVGIVFQAPSSDDMLTGYENLKLHSWLYSVPRQVREKRISEVLDLVGLTERKNDQVKKYSGGMRRRLEIARGLIHKPKVIFLDEPTLGLDPSSRESMWKYIERLVKEEKITIILTTHYMEEADMLCDRIGIIDRGKIIVLDTPSNLKGMIGGDIIKLKLVQKKRPNIDILKNFSFVHKIENISDDGLLVLSVDNANRNLPIILKYIDTESVEYTSPTLNDVFLRSTGRDIKEEAEGGFMEKYARYDQK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
5 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
9 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
10 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
11 3300003391 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM Metagenome Rhizosphere
12 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
13 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
14 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
15 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
16 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
17 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
180 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
203 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
227 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
228 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
229 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
230 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
231 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
234 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
237 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
238 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
239 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
240 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
241 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
242 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
245 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
246 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
247 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
253 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
254 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
255 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
256 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
257 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
258 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
259 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
260 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
261 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
262 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
267 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
268 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1653340 2162886007 Archaea 1644
2 MRS1b_contig_1248338 2162886011 Bacteria 2432
3 MBSR1b_contig_10382275 2162886012 Bacteria 2908
4 JGI26145J50221_1000079 3300003371 Archaea 7499
5 JGI25407J50210_10002622 3300003373 Archaea 4262
6 JGI26142J50222_100271 3300003379 Bacteria 1965
7 JGI26139J50223_100139 3300003382 Bacteria 3654
8 JGI26140J50224_100030 3300003383 Archaea 9273
9 JGI26135J50243_100051 3300003391 Bacteria 3361
10 JGI26134J50242_100024 3300003392 Archaea 8912
11 JGI26137J50245_100089 3300003396 Bacteria 4226
12 JGI26131J50246_100369 3300003400 Bacteria 1733
13 JGI26143J51219_1000196 3300003502 Bacteria 2611
14 JGI26141J51220_1000027 3300003503 Archaea 6180
15 JGI26138J51218_100005 3300003504 Archaea 9618
16 Ga0065704_10000863 3300005289 Archaea 32255
17 Ga0065704_10010343 3300005289 Archaea 3275
18 Ga0065704_10083353 3300005289 Archaea 3477
19 Ga0065712_10000934 3300005290 Bacteria 11072
20 Ga0065715_10000541 3300005293 Bacteria 10324
21 Ga0065715_10131113 3300005293 Bacteria 2013
22 Ga0065707_10000205 3300005295 Archaea 3762
23 Ga0065707_10000598 3300005295 Archaea 17112
24 Ga0070676_10007966 3300005328 Bacteria 5697
25 Ga0070676_10119778 3300005328 Unclassified 1650
26 Ga0070677_10077501 3300005333 Bacteria 1414
27 Ga0070680_100008762 3300005336 Archaea 7758
28 Ga0070680_100055025 3300005336 Archaea 3251
29 Ga0070682_100015969 3300005337 Unclassified 4361
30 Ga0068868_100031148 3300005338 Unclassified 4095
31 Ga0068868_100069659 3300005338 Unclassified 2803
32 Ga0070660_100332372 3300005339 Bacteria 1250
33 Ga0070689_100057087 3300005340 Bacteria 3029
34 Ga0070691_10018694 3300005341 Bacteria 3195
35 Ga0070661_100148222 3300005344 Bacteria 1773
36 Ga0070668_100148069 3300005347 Bacteria 1896
37 Ga0070668_100192286 3300005347 Bacteria 1672
38 Ga0070674_100243371 3300005356 Unclassified 1409
39 Ga0070673_100227014 3300005364 Unclassified 1619
40 Ga0070659_100146878 3300005366 Unclassified 1922
41 Ga0070709_10007182 3300005434 Archaea 6101
42 Ga0070709_10080733 3300005434 Unclassified 2121
43 Ga0070714_100001327 3300005435 Archaea 17855
44 Ga0070714_100080817 3300005435 Archaea 2829
45 Ga0070713_100025658 3300005436 Archaea 4612
46 Ga0070713_100276992 3300005436 Bacteria 1538
47 Ga0070710_10012702 3300005437 Unclassified 4191
48 Ga0070710_10022516 3300005437 Archaea 3296
49 Ga0070710_10058434 3300005437 Archaea 2187
50 Ga0070701_10018736 3300005438 Bacteria 3258
51 Ga0070711_100018972 3300005439 Archaea 4401
52 Ga0070711_100037046 3300005439 Unclassified 3271
53 Ga0070711_100057460 3300005439 Archaea 2694
54 Ga0070711_100132770 3300005439 Archaea 1857
55 Ga0070705_100020752 3300005440 Archaea 3483
56 Ga0070705_100036243 3300005440 Archaea 2772
57 Ga0070694_100000057 3300005444 Archaea 52225
58 Ga0070694_100023536 3300005444 Archaea 3963
59 Ga0070708_100226364 3300005445 Archaea 1754
60 Ga0070663_100102605 3300005455 Unclassified 2137
61 Ga0070663_100167880 3300005455 Bacteria 1694
62 Ga0070678_100139618 3300005456 Unclassified 1937
63 Ga0070681_10016030 3300005458 Bacteria 7471
64 Ga0068867_100017198 3300005459 Archaea 5137
65 Ga0070706_100021914 3300005467 Archaea 5883
66 Ga0070707_100311124 3300005468 Unclassified 1531
67 Ga0070698_100010479 3300005471 Archaea 9887
68 Ga0070699_100026289 3300005518 Archaea 5021
69 Ga0070699_100415375 3300005518 Archaea 1217
70 Ga0070679_100028922 3300005530 Archaea 5466
71 Ga0070679_100103336 3300005530 Archaea 2836
72 Ga0070684_100103559 3300005535 Unclassified 2546
73 Ga0070697_100056968 3300005536 Archaea 3180
74 Ga0070697_100116168 3300005536 Unclassified 2235
75 Ga0070672_100032318 3300005543 Bacteria 3948
76 Ga0070695_100013833 3300005545 Archaea 4855
77 Ga0070695_100098868 3300005545 Archaea 1961
78 Ga0070696_100050233 3300005546 Bacteria 2898
79 Ga0070696_100124849 3300005546 Archaea 1866
80 Ga0070693_100042283 3300005547 Unclassified 2567
81 Ga0070693_100071962 3300005547 Archaea 2038
82 Ga0070665_100000046 3300005548 Bacteria 271885
83 Ga0070704_100017843 3300005549 Bacteria 4526
84 Ga0070664_100010108 3300005564 Archaea 7649
85 Ga0068857_100183493 3300005577 Archaea 1904
86 Ga0068856_100049449 3300005614 Unclassified 4144
87 Ga0068856_100396812 3300005614 Unclassified 1399
88 Ga0070702_100008110 3300005615 Archaea 5074
89 Ga0070702_100043653 3300005615 Unclassified 2527
90 Ga0068859_100195939 3300005617 Unclassified 2105
91 Ga0068859_100579899 3300005617 Bacteria 1215
92 Ga0068864_100120580 3300005618 Unclassified 2345
93 Ga0068870_10000733 3300005840 Archaea 12622
94 Ga0068870_10019659 3300005840 Archaea 3278
95 Ga0068860_100145351 3300005843 Bacteria 2281
96 Ga0068862_100035311 3300005844 Bacteria 4233
97 Ga0081455_10005946 3300005937 Archaea 13236
98 Ga0081455_10017577 3300005937 Archaea 6847
99 Ga0081538_10002499 3300005981 Bacteria 17909
100 Ga0081538_10033880 3300005981 Archaea 3390
101 Ga0081538_10033932 3300005981 Archaea 3386
102 Ga0070717_10015993 3300006028 Archaea 5808
103 Ga0075432_10005326 3300006058 Archaea 4382
104 Ga0070715_10022677 3300006163 Bacteria 2451
105 Ga0070715_10166139 3300006163 Archaea 1095
106 Ga0070716_100198716 3300006173 Archaea 1331
107 Ga0070716_100215406 3300006173 Bacteria 1286
108 Ga0075427_10002847 3300006194 Archaea 2350
109 Ga0075428_100035972 3300006844 Archaea 5458
110 Ga0075428_100091221 3300006844 Bacteria 3323
111 Ga0075428_100225226 3300006844 Archaea 2024
112 Ga0075428_100304279 3300006844 Archaea 1714
113 Ga0075430_100000075 3300006846 Archaea 54285
114 Ga0075430_100013535 3300006846 Archaea 6955
115 Ga0075430_100088555 3300006846 Archaea 2590
116 Ga0075430_100121707 3300006846 Archaea 2175
117 Ga0075430_100123662 3300006846 Archaea 2156
118 Ga0075431_100012709 3300006847 Archaea 8500
119 Ga0075431_100034214 3300006847 Archaea 5235
120 Ga0075431_100045578 3300006847 Archaea 4521
121 Ga0075433_10028411 3300006852 Bacteria 4754
122 Ga0075433_10116327 3300006852 Bacteria 2372
123 Ga0075434_100001722 3300006871 Archaea 18762
124 Ga0075434_100012094 3300006871 Archaea 8173
125 Ga0075434_100043312 3300006871 Bacteria 4464
126 Ga0075434_100289696 3300006871 Unclassified 1657
127 Ga0075429_100008054 3300006880 Archaea 9163
128 Ga0075429_100008281 3300006880 Archaea 9036
129 Ga0075429_100026731 3300006880 Archaea 5011
130 Ga0075429_100056258 3300006880 Archaea 3423
131 Ga0075429_100062415 3300006880 Bacteria 3247
132 Ga0075429_100232639 3300006880 Bacteria 1614
133 Ga0075429_100315324 3300006880 Archaea 1369
134 Ga0068865_100025686 3300006881 Bacteria 3877
135 Ga0097620_100195937 3300006931 Archaea 2105
136 Ga0097620_100579856 3300006931 Bacteria 1215
137 Ga0075435_100081877 3300007076 Bacteria 2652
138 Ga0075435_100130258 3300007076 Archaea 2105
139 Ga0105240_10627552 3300009093 Bacteria 1180
140 Ga0111539_10024367 3300009094 Archaea 7426
141 Ga0111539_10056526 3300009094 Archaea 4663
142 Ga0111539_10079108 3300009094 Archaea 3867
143 Ga0105245_10186810 3300009098 Bacteria 1983
144 Ga0105245_10190976 3300009098 Bacteria 1962
145 Ga0114129_10006804 3300009147 Bacteria 16236
146 Ga0114129_10011859 3300009147 Archaea 12397
147 Ga0114129_10019689 3300009147 Archaea 9607
148 Ga0114129_10032006 3300009147 Archaea 7434
149 Ga0114129_10043051 3300009147 Archaea 6355
150 Ga0114129_10062681 3300009147 Archaea 5193
151 Ga0105241_10244163 3300009174 Bacteria 1519
152 Ga0105242_10189728 3300009176 Unclassified 1819
153 Ga0105242_10216037 3300009176 Bacteria 1711
154 Ga0105248_10053631 3300009177 Bacteria 4524
155 Ga0105249_10008637 3300009553 Archaea 8879
156 Ga0105239_10280490 3300010375 Bacteria 1876
157 Ga0105246_10009517 3300011119 Archaea 5986
158 Ga0105246_10070309 3300011119 Archaea 2461
159 Ga0105246_10303665 3300011119 Unclassified 1290
160 Ga0157373_10081181 3300013100 Bacteria 2286
161 Ga0157374_10030596 3300013296 Unclassified 4889
162 Ga0157378_10057927 3300013297 Archaea 3454
163 Ga0157378_10136042 3300013297 Unclassified 2278
164 Ga0157378_10153296 3300013297 Bacteria 2148
165 Ga0157375_10355133 3300013308 Bacteria 1632
166 Ga0163163_10147763 3300014325 Bacteria 2395
167 Ga0182008_10008794 3300014497 Archaea 5487
168 Ga0182008_10025632 3300014497 Archaea 2995
169 Ga0157376_10435798 3300014969 Unclassified 1275
170 Ga0182007_10019587 3300015262 Archaea 2431
171 Ga0207692_10048525 3300025898 Archaea 2138
172 Ga0207692_10066160 3300025898 Archaea 1888
173 Ga0207647_10013957 3300025904 Bacteria 5558
174 Ga0207685_10025021 3300025905 Bacteria 2055
175 Ga0207699_10053576 3300025906 Unclassified 2393
176 Ga0207699_10105563 3300025906 Unclassified 1796
177 Ga0207645_10014629 3300025907 Bacteria 5243
178 Ga0207645_10054372 3300025907 Unclassified 2557
179 Ga0207643_10000148 3300025908 Archaea 47948
180 Ga0207643_10007030 3300025908 Archaea 6030
181 Ga0207684_10145792 3300025910 Archaea 2036
182 Ga0207707_10341375 3300025912 Bacteria 1291
183 Ga0207693_10036379 3300025915 Archaea 3881
184 Ga0207693_10092211 3300025915 Bacteria 2374
185 Ga0207663_10003770 3300025916 Bacteria 7475
186 Ga0207663_10040634 3300025916 Archaea 2829
187 Ga0207663_10051215 3300025916 Unclassified 2570
188 Ga0207660_10034133 3300025917 Bacteria 3524
189 Ga0207660_10068451 3300025917 Archaea 2575
190 Ga0207662_10048334 3300025918 Archaea 2520
191 Ga0207646_10176271 3300025922 Archaea 1931
192 Ga0207646_10398150 3300025922 Unclassified 1244
193 Ga0207681_10006949 3300025923 Bacteria 6941
194 Ga0207650_10083869 3300025925 Bacteria 2421
195 Ga0207687_10087088 3300025927 Bacteria 2269
196 Ga0207700_10009058 3300025928 Archaea 6197
197 Ga0207700_10019566 3300025928 Archaea 4575
198 Ga0207664_10037908 3300025929 Archaea 3734
199 Ga0207690_10117671 3300025932 Unclassified 1924
200 Ga0207706_10008772 3300025933 Archaea 9305
201 Ga0207665_10003295 3300025939 Archaea 10817
202 Ga0207665_10074951 3300025939 Archaea 2317
203 Ga0207691_10047324 3300025940 Bacteria 3947
204 Ga0207689_10010081 3300025942 Archaea 8143
205 Ga0207661_10031342 3300025944 Unclassified 4106
206 Ga0207661_10150287 3300025944 Bacteria 2013
207 Ga0207661_10308013 3300025944 Archaea 1421
208 Ga0207679_10107277 3300025945 Bacteria 2197
209 Ga0207679_10231923 3300025945 Archaea 1559
210 Ga0207651_10011629 3300025960 Archaea 4935
211 Ga0207712_10003399 3300025961 Archaea 10062
212 Ga0207668_10136525 3300025972 Bacteria 1880
213 Ga0207678_10015929 3300026067 Archaea 6603
214 Ga0207708_10001487 3300026075 Archaea 17483
215 Ga0207702_10071615 3300026078 Unclassified 2985
216 Ga0207676_10125693 3300026095 Unclassified 2171
217 Ga0207683_10135858 3300026121 Unclassified 2214
218 Ga0209967_1000651 3300027364 Bacteria 4463
219 Ga0209981_1000124 3300027378 Archaea 8999
220 Ga0209996_1001487 3300027395 Bacteria 2838
221 Ga0209984_1000958 3300027424 Bacteria 3087
222 Ga0209995_1000081 3300027471 Archaea 15003
223 Ga0209968_1000440 3300027526 Archaea 6694
224 Ga0209982_1001098 3300027552 Bacteria 3619
225 Ga0209970_1001843 3300027614 Bacteria 3672
226 Ga0209983_1000361 3300027665 Archaea 9599
227 Ga0209971_1002787 3300027682 Archaea 4177
228 Ga0209966_1000405 3300027695 Archaea 12650
229 Ga0209998_10001444 3300027717 Archaea 5740
230 Ga0209974_10009244 3300027876 Bacteria 3347
231 Ga0207428_10000126 3300027907 Archaea 105456
232 Ga0207428_10000157 3300027907 Archaea 93146
233 Ga0207428_10000396 3300027907 Archaea 54187
234 Ga0207428_10040568 3300027907 Archaea 3774
235 Ga0207428_10111976 3300027907 Unclassified 2100
236 Ga0268266_10000164 3300028379 Bacteria 123070
237 Ga0268265_10037250 3300028380 Bacteria 3568
238 Ga0265334_10060790 3300028573 Bacteria 1425
239 Ga0265323_10023922 3300028653 Bacteria 2327
240 Ga0265323_10064181 3300028653 Bacteria 1270
241 Ga0265338_10141482 3300028800 Bacteria 1884
242 Ga0265324_10051411 3300029957 Bacteria 1416
243 Ga0265330_10001742 3300031235 Bacteria 12247
244 Ga0265330_10002557 3300031235 Bacteria 9886
245 Ga0265329_10000103 3300031242 Bacteria 40556
246 Ga0265316_10000017 3300031344 Bacteria 198446
247 Ga0265314_10000943 3300031711 Bacteria 34205
248 Ga0265342_10000532 3300031712 Bacteria 40555
249 Ga0307405_10029393 3300031731 Archaea 3212
250 Ga0307405_10088038 3300031731 Archaea 2048
251 Ga0316577_10144985 3300031733 Bacteria 1338
252 Ga0307413_10025688 3300031824 Archaea 3233
253 Ga0307410_10029048 3300031852 Archaea 3516
254 Ga0307406_10023022 3300031901 Archaea 3702
255 Ga0307406_10269434 3300031901 Unclassified 1293
256 Ga0307412_10186705 3300031911 Bacteria 1564
257 Ga0307409_100024492 3300031995 Archaea 4211
258 Ga0307409_100091147 3300031995 Bacteria 2497
259 Ga0307416_100035336 3300032002 Archaea 3815
260 Ga0307416_100124847 3300032002 Archaea 2303
261 Ga0307416_100139634 3300032002 Archaea 2200
262 Ga0307416_100233696 3300032002 Archaea 1775
263 Ga0307416_100327923 3300032002 Bacteria 1537
264 Ga0307414_10016126 3300032004 Archaea 4533
265 Ga0307411_10018986 3300032005 Archaea 3959
266 Ga0307411_10045321 3300032005 Archaea 2828
267 Ga0307411_10114029 3300032005 Bacteria 1941
268 Ga0307415_100012771 3300032126 Archaea 4871
269 Ga0307415_100028406 3300032126 Archaea 3559
270 Ga0307415_100095671 3300032126 Bacteria 2163
271 Ga0307415_100147408 3300032126 Archaea 1806
272 Ga0316585_10074771 3300032137 Bacteria 1101
273 Ga0373927_0320185 3300035695 Bacteria 1021
274 Ga0373947_0270146 3300035725 Bacteria 1129
275 Ga0316582_0168897 3300036647 Bacteria 1484
276 Ga0316582_0250193 3300036647 Bacteria 1214
277 Ga0373925_0057788 3300037068 Bacteria 2907
278 Ga0373925_0177815 3300037068 Unclassified 1683
279 Ga0395899_0170341 3300037312 Bacteria 1533
280 Ga0242422_01262 3300038699 Bacteria 1741
281 Ga0400490_13337 3300038726 Bacteria 9962
282 Ga0242420_000292 3300038996 Bacteria 5511
283 Ga0400489_00074 3300039093 Archaea 3484
284 Ga0436362_0183664 3300039453 Archaea 2837
285 Ga0439450_004407 3300042008 Unclassified 2402
286 Ga0450923_002655 3300042125 Archaea 2594
287 Ga0450906_000528 3300042145 Archaea 8050
288 Ga0439435_0025017 3300042436 Archaea 1580
289 Ga0439440_0037595 3300042993 Archaea 1169
290 Ga0453683_0028522 3300044673 Archaea 3534
291 Ga0495584_0041866 3300046491 Archaea 2312
292 Ga0495667_0003532 3300046559 Bacteria 10500
293 Ga0495656_0089690 3300046615 Archaea 1404
294 Ga0495581_0143615 3300047315 Bacteria 1393
295 Ga0496100_0128598 3300048903 Unclassified 1781
296 Ga0496102_0100719 3300048905 Unclassified 2684
297 Ga0496106_0028905 3300048909 Bacteria 4131
298 Ga0496106_0044419 3300048909 Unclassified 3335
299 Ga0496107_0092411 3300048910 Bacteria 2212
300 Ga0496107_0151412 3300048910 Unclassified 1716
301 Ga0496108_0111590 3300048911 Unclassified 2339
302 Ga0496114_0213524 3300048917 Bacteria 1693
303 Ga0501291_000582 3300049514 Archaea 4205
304 Ga0501292_002096 3300049515 Archaea 2536
305 Ga0501293_000785 3300049516 Archaea 2385
306 Ga0501297_000461 3300049520 Archaea 3722
307 Ga0501298_001111 3300049521 Archaea 3877
308 Ga0501299_019132 3300049522 Archaea 1236
309 Ga0501299_028408 3300049522 Archaea 1066
310 Ga0501031_0083501 3300049568 Archaea 2082
311 Ga0501032_0152478 3300049569 Archaea 1519
312 Ga0501033_0041185 3300049570 Archaea 3447
313 Ga0501034_0240566 3300049571 Bacteria 1756
314 Ga0501036_0000394 3300049572 Archaea 30759
315 Ga0501037_0007325 3300049573 Archaea 8071
316 Ga0501037_0023406 3300049573 Archaea 4568
317 Ga0501038_0010387 3300049574 Archaea 8514
318 Ga0501038_0318111 3300049574 Archaea 1218
319 Ga0501038_0334231 3300049574 Bacteria 1183
320 Ga0501038_0367878 3300049574 Unclassified 1117
321 Ga0501039_0021664 3300049575 Archaea 4930
322 Ga0501039_0117392 3300049575 Archaea 2084
323 Ga0501040_0000979 3300049576 Archaea 18069
324 Ga0501040_0129161 3300049576 Archaea 1776
325 Ga0501041_0000349 3300049577 Archaea 22790
326 Ga0501041_0065737 3300049577 Archaea 2222
327 Ga0501041_0102521 3300049577 Archaea 1772
328 Ga0501042_0028810 3300049578 Archaea 3916
329 Ga0501042_0090349 3300049578 Archaea 2198
330 Ga0501042_0139618 3300049578 Unclassified 1747
331 Ga0501042_0188824 3300049578 Bacteria 1486
332 Ga0501042_0316076 3300049578 Bacteria 1128
333 Ga0501043_0141682 3300049579 Unclassified 1883
334 Ga0501046_0000453 3300049580 Archaea 41083
335 Ga0501046_0035062 3300049580 Archaea 4045
336 Ga0501046_0051841 3300049580 Archaea 3237
337 Ga0501046_0074960 3300049580 Archaea 2624
338 Ga0501046_0152779 3300049580 Archaea 1741
339 Ga0501048_0138827 3300049582 Archaea 1718
340 Ga0501067_0145991 3300049583 Archaea 1318
341 Ga0501068_0083876 3300049584 Archaea 1959
342 Ga0501071_0006236 3300049587 Archaea 7736
343 Ga0501071_0027845 3300049587 Archaea 3979
344 Ga0501071_0145814 3300049587 Archaea 1764
345 Ga0501075_0000464 3300049591 Archaea 24074
346 Ga0501075_0086176 3300049591 Archaea 2379
347 Ga0501075_0117545 3300049591 Unclassified 2021
348 Ga0501075_0356017 3300049591 Archaea 1115
349 Ga0501076_0003500 3300049592 Archaea 11034
350 Ga0501076_0014338 3300049592 Archaea 5968
351 Ga0501076_0122637 3300049592 Archaea 2104
352 Ga0501077_0009960 3300049593 Archaea 5915
353 Ga0501077_0022705 3300049593 Archaea 3976
354 Ga0501201_002945 3300049651 Archaea 1560
355 Ga0501202_003365 3300049652 Archaea 2735
356 Ga0501202_013163 3300049652 Archaea 1570
357 Ga0501206_003128 3300049653 Archaea 2100
358 Ga0501209_012314 3300049656 Archaea 1820
359 Ga0501211_005505 3300049658 Archaea 1263
360 Ga0501214_000497 3300049659 Archaea 2641
361 Ga0501217_005352 3300049661 Archaea 2679
362 Ga0501217_008752 3300049661 Archaea 2193
363 Ga0501217_032568 3300049661 Bacteria 1291
364 Ga0501223_012012 3300049663 Archaea 1736
365 Ga0501224_000892 3300049664 Archaea 3837
366 Ga0501227_011134 3300049665 Archaea 1956
367 Ga0501228_000614 3300049666 Archaea 2326
368 Ga0501230_004283 3300049667 Archaea 1954
369 Ga0501233_027149 3300049668 Archaea 1269
370 Ga0501235_009024 3300049669 Archaea 2176
371 Ga0501236_003098 3300049670 Archaea 1930
372 Ga0501242_003274 3300049674 Archaea 1746
373 Ga0501243_000718 3300049675 Archaea 4587
374 Ga0501243_015621 3300049675 Archaea 1221
375 Ga0501249_021238 3300049679 Archaea 1416
376 Ga0501256_001247 3300049685 Archaea 1838
377 Ga0501257_007588 3300049686 Archaea 2423
378 Ga0501259_003637 3300049688 Archaea 2447
379 Ga0501261_000953 3300049690 Archaea 3568
380 Ga0501225_0021018 3300049705 Archaea 1803
381 Ga0501225_0024603 3300049705 Unclassified 1658
382 Ga0501225_0046646 3300049705 Archaea 1201
383 Ga0501245_014175 3300049708 Archaea 1187
384 Ga0501079_0000218 3300049741 Archaea 33983
385 Ga0501079_0057628 3300049741 Archaea 2998
386 Ga0501081_0000342 3300049743 Archaea 25025
387 Ga0501081_0002870 3300049743 Archaea 10943
388 Ga0501081_0075990 3300049743 Archaea 2345
389 Ga0501081_0157046 3300049743 Archaea 1637
390 Ga0501232_001924 3300049757 Archaea 1735
391 Ga0501265_004845 3300049762 Unclassified 1544
392 Ga0501266_001595 3300049763 Archaea 2894
393 Ga0501270_003324 3300049767 Archaea 1726
394 Ga0501271_000256 3300049768 Archaea 4515
395 Ga0501271_000811 3300049768 Archaea 2658
396 Ga0501274_001250 3300049771 Archaea 1923
397 Ga0501276_001500 3300049773 Archaea 1588
398 Ga0501278_002559 3300049774 Archaea 1276
399 Ga0501279_004328 3300049775 Archaea 1862
400 Ga0501282_002443 3300049778 Archaea 2018
401 Ga0501283_003416 3300049779 Archaea 2097
402 Ga0501035_0114756 3300049822 Archaea 2358
403 Ga0501035_0134760 3300049822 Archaea 2151
404 Ga0501044_0112714 3300049823 Archaea 2726
405 Ga0501044_0116059 3300049823 Archaea 2683
406 Ga0501045_0006017 3300049824 Archaea 8398
407 Ga0501045_0078815 3300049824 Archaea 2429
408 Ga0501045_0185837 3300049824 Archaea 1548
409 Ga0501045_0264337 3300049824 Archaea 1281
410 Ga0501204_000341 3300049850 Archaea 3951
411 Ga0501212_001320 3300049851 Archaea 2770
412 Ga0501212_005158 3300049851 Archaea 1715
413 Ga0501226_004003 3300049853 Archaea 1722
414 nmdc:mga05p37_177648_c1 3300050507 Unclassified 2593
415 nmdc:mga05p37_354858_c1 3300050507 Archaea 1726
416 nmdc:mga05p37_3641_c1 3300050507 Archaea 18016
417 nmdc:mga05p37_45187_c1 3300050507 Archaea 5419
418 nmdc:mga05p37_52380_c1 3300050507 Archaea 5019
419 nmdc:mga05p37_52681_c1 3300050507 Bacteria 5003
420 nmdc:mga05p37_9509_c1 3300050507 Archaea 11511
421 nmdc:mga09592_19134_c1 3300050508 Bacteria 5620
422 nmdc:mga09592_272434_c1 3300050508 Archaea 1468
423 nmdc:mga09592_273292_c1 3300050508 Archaea 1466
424 nmdc:mga09592_34653_c1 3300050508 Archaea 4221
425 nmdc:mga09592_4309_c1 3300050508 Archaea 11496
426 nmdc:mga09592_55263_c1 3300050508 Archaea 3355
427 nmdc:mga09592_73_c1 3300050508 Archaea 56945
428 nmdc:mga0qj67_10932_c1 3300050509 Archaea 6793
429 nmdc:mga0qj67_38921_c1 3300050509 Archaea 3732
430 nmdc:mga0qj67_618_c1 3300050509 Archaea 24374
431 nmdc:mga06r32_144674_c1 3300050510 Archaea 2355
432 nmdc:mga06r32_21179_c1 3300050510 Archaea 6000
433 nmdc:mga06r32_5365_c1 3300050510 Archaea 11536
434 nmdc:mga08y16_17728_c1 3300050511 Archaea 7498
435 nmdc:mga08y16_441823_c1 3300050511 Archaea 1328
436 nmdc:mga08y16_44284_c1 3300050511 Archaea 4663
437 nmdc:mga08y16_5188_c1 3300050511 Archaea 13607
438 nmdc:mga0n895_2468_c1 3300050512 Archaea 14452
439 nmdc:mga0n895_34768_c1 3300050512 Archaea 4854
440 nmdc:mga0rr50_332899_c1 3300050513 Archaea 1275
441 nmdc:mga08x19_188818_c1 3300050514 Bacteria 1409
442 nmdc:mga0a205_16339_c1 3300050515 Archaea 6951
443 nmdc:mga0a205_42014_c1 3300050515 Bacteria 4405
444 Ga0501084_0001530 3300054114 Archaea 18369
445 Ga0501084_0013182 3300054114 Archaea 6839
446 Ga0590071_003747 3300059421 Archaea 3729
447 Ga0590074_004471 3300059423 Archaea 2312
448 Ga0590075_001429 3300059424 Archaea 5980
449 Ga0590075_006743 3300059424 Archaea 2720
450 Ga0590075_018900 3300059424 Unclassified 1707
451 Ga0590077_000833 3300059426 Archaea 7974
452 Ga0590077_002513 3300059426 Archaea 3893
453 Ga0501082_0002269 3300060353 Archaea 16842
454 Ga0501082_0008196 3300060353 Archaea 9017
455 Ga0501082_0012644 3300060353 Archaea 7256
456 Ga0501082_0092207 3300060353 Archaea 2617
457 Ga0501082_0127011 3300060353 Bacteria 2212
458 Ga0530510_0015284 3300061734 Archaea 5422
459 Ga0530510_0039901 3300061734 Archaea 3388
460 Ga0530510_0110885 3300061734 Archaea 2009
461 Ga0530510_0247395 3300061734 Archaea 1328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0250193 Ga0316582_0250193_330_1157 270
2 3300009098 Ga0105245_10186810 Ga0105245_101868102 272
3 3300025927 Ga0207687_10087088 Ga0207687_100870882 272
4 3300013297 Ga0157378_10153296 Ga0157378_101532962 274
5 3300005293 Ga0065715_10131113 Ga0065715_101311132 277
6 3300005548 Ga0070665_100000046 Ga0070665_100000046253 279
7 3300028379 Ga0268266_10000164 Ga0268266_1000016477 279
8 3300039093 Ga0400489_00074 Ga0400489_00074_2099_3040 280
9 3300037068 Ga0373925_0057788 Ga0373925_0057788_1818_2708 281
10 3300035695 Ga0373927_0320185 Ga0373927_0320185_75_977 282
11 3300035725 Ga0373947_0270146 Ga0373947_0270146_107_1009 282
12 3300047315 Ga0495581_0143615 Ga0495581_0143615_164_1066 282
13 3300005617 Ga0068859_100579899 Ga0068859_1005798992 284
14 3300006931 Ga0097620_100579856 Ga0097620_1005798561 284
15 iso_pu_bacteria 2867302475 2867308290 288
16 iso_pu_bacteria 2867507094 2867507510 290
17 3300038726 Ga0400490_13337 Ga0400490_13337_6253_7164 291
18 3300049571 Ga0501034_0240566 Ga0501034_0240566_463_1515 292
19 3300049587 Ga0501071_0027845 Ga0501071_0027845_764_1825 292
20 3300049591 Ga0501075_0086176 Ga0501075_0086176_57_1118 292
21 3300049592 Ga0501076_0014338 Ga0501076_0014338_2256_3317 292
22 3300049822 Ga0501035_0114756 Ga0501035_0114756_1218_2279 292
23 3300061734 Ga0530510_0039901 Ga0530510_0039901_1234_2295 292
24 3300009098 Ga0105245_10190976 Ga0105245_101909762 293
25 3300009177 Ga0105248_10053631 Ga0105248_100536315 293
26 3300010375 Ga0105239_10280490 Ga0105239_102804902 293
27 3300013308 Ga0157375_10355133 Ga0157375_103551332 293
28 3300014325 Ga0163163_10147763 Ga0163163_101477633 293
29 3300025944 Ga0207661_10150287 Ga0207661_101502872 293
30 3300048917 Ga0496114_0213524 Ga0496114_0213524_37_987 293
31 3300025898 Ga0207692_10066160 Ga0207692_100661602 294
32 3300005981 Ga0081538_10002499 Ga0081538_1000249918 296
33 3300031911 Ga0307412_10186705 Ga0307412_101867052 296
34 3300031995 Ga0307409_100091147 Ga0307409_1000911471 296
35 3300003373 JGI25407J50210_10002622 JGI25407J50210_100026224 297
36 3300005340 Ga0070689_100057087 Ga0070689_1000570872 297
37 3300006880 Ga0075429_100062415 Ga0075429_1000624152 297
38 3300006173 Ga0070716_100215406 Ga0070716_1002154061 298
39 3300006871 Ga0075434_100012094 Ga0075434_1000120941 298
40 3300014497 Ga0182008_10025632 Ga0182008_100256324 298
41 3300028573 Ga0265334_10060790 Ga0265334_100607901 298
42 3300037312 Ga0395899_0170341 Ga0395899_0170341_76_1002 298
43 3300049661 Ga0501217_032568 Ga0501217_032568_127_1053 298
44 3300049705 Ga0501225_0024603 Ga0501225_0024603_522_1445 298
45 3300005347 Ga0070668_100148069 Ga0070668_1001480692 299
46 3300005546 Ga0070696_100124849 Ga0070696_1001248493 299
47 3300005937 Ga0081455_10017577 Ga0081455_100175776 299
48 3300005434 Ga0070709_10080733 Ga0070709_100807332 300
49 3300005435 Ga0070714_100080817 Ga0070714_1000808173 303
50 3300005436 Ga0070713_100276992 Ga0070713_1002769922 303
51 3300006163 Ga0070715_10022677 Ga0070715_100226772 303
52 3300006844 Ga0075428_100035972 Ga0075428_1000359722 303
53 3300006846 Ga0075430_100088555 Ga0075430_1000885553 303
54 3300006847 Ga0075431_100045578 Ga0075431_1000455782 303
55 3300006852 Ga0075433_10116327 Ga0075433_101163271 303
56 3300006871 Ga0075434_100043312 Ga0075434_1000433121 303
57 3300006880 Ga0075429_100056258 Ga0075429_1000562582 303
58 3300007076 Ga0075435_100081877 Ga0075435_1000818773 303
59 3300009094 Ga0111539_10079108 Ga0111539_100791081 303
60 3300009147 Ga0114129_10062681 Ga0114129_100626813 303
61 3300015262 Ga0182007_10019587 Ga0182007_100195872 303
62 3300025905 Ga0207685_10025021 Ga0207685_100250211 303
63 3300025915 Ga0207693_10092211 Ga0207693_100922111 303
64 3300032002 Ga0307416_100139634 Ga0307416_1001396342 303
65 3300050507 nmdc:mga05p37_52380_c1 nmdc:mga05p37_52380_c1_39_1088 303
66 3300050508 nmdc:mga09592_273292_c1 nmdc:mga09592_273292_c1_269_1315 303
67 3300050509 nmdc:mga0qj67_10932_c1 nmdc:mga0qj67_10932_c1_2732_3781 303
68 3300050510 nmdc:mga06r32_21179_c1 nmdc:mga06r32_21179_c1_2101_3150 303
69 3300048905 Ga0496102_0100719 Ga0496102_0100719_667_1665 306
70 3300005436 Ga0070713_100025658 Ga0070713_1000256586 307
71 3300005437 Ga0070710_10022516 Ga0070710_100225162 307
72 3300005437 Ga0070710_10058434 Ga0070710_100584342 307
73 3300005439 Ga0070711_100018972 Ga0070711_1000189724 307
74 3300005439 Ga0070711_100057460 Ga0070711_1000574602 307
75 3300005518 Ga0070699_100026289 Ga0070699_1000262892 307
76 3300005530 Ga0070679_100028922 Ga0070679_1000289222 307
77 3300025915 Ga0207693_10036379 Ga0207693_100363792 307
78 3300025916 Ga0207663_10051215 Ga0207663_100512154 307
79 3300025928 Ga0207700_10009058 Ga0207700_100090584 307
80 3300031733 Ga0316577_10144985 Ga0316577_101449852 308
81 3300036647 Ga0316582_0168897 Ga0316582_0168897_193_1167 308
82 3300005336 Ga0070680_100055025 Ga0070680_1000550253 310
83 3300005440 Ga0070705_100036243 Ga0070705_1000362434 310
84 3300005444 Ga0070694_100000057 Ga0070694_10000005710 310
85 3300005444 Ga0070694_100023536 Ga0070694_1000235364 310
86 3300005471 Ga0070698_100010479 Ga0070698_10001047911 310
87 3300005536 Ga0070697_100056968 Ga0070697_1000569684 310
88 3300005536 Ga0070697_100116168 Ga0070697_1001161681 310
89 3300005545 Ga0070695_100098868 Ga0070695_1000988683 310
90 3300005549 Ga0070704_100017843 Ga0070704_1000178433 310
91 3300005981 Ga0081538_10033880 Ga0081538_100338802 310
92 3300005981 Ga0081538_10033932 Ga0081538_100339322 310
93 3300006846 Ga0075430_100121707 Ga0075430_1001217072 310
94 3300006880 Ga0075429_100315324 Ga0075429_1003153242 310
95 3300009147 Ga0114129_10043051 Ga0114129_100430516 310
96 3300025917 Ga0207660_10068451 Ga0207660_100684514 310
97 3300031731 Ga0307405_10029393 Ga0307405_100293932 310
98 3300032002 Ga0307416_100233696 Ga0307416_1002336962 310
99 3300032002 Ga0307416_100327923 Ga0307416_1003279231 310
100 3300032005 Ga0307411_10045321 Ga0307411_100453213 310
101 3300032126 Ga0307415_100095671 Ga0307415_1000956713 310
102 3300032126 Ga0307415_100147408 Ga0307415_1001474082 310
103 3300042125 Ga0450923_002655 Ga0450923_002655_677_1621 310
104 3300042145 Ga0450906_000528 Ga0450906_000528_768_1712 310
105 3300044673 Ga0453683_0028522 Ga0453683_0028522_1238_2188 310
106 3300049515 Ga0501292_002096 Ga0501292_002096_1263_2207 310
107 3300049516 Ga0501293_000785 Ga0501293_000785_727_1671 310
108 3300049520 Ga0501297_000461 Ga0501297_000461_979_1923 310
109 3300049521 Ga0501298_001111 Ga0501298_001111_1037_1981 310
110 3300049522 Ga0501299_019132 Ga0501299_019132_113_1057 310
111 3300049569 Ga0501032_0152478 Ga0501032_0152478_95_1045 310
112 3300049573 Ga0501037_0023406 Ga0501037_0023406_37_987 310
113 3300049574 Ga0501038_0318111 Ga0501038_0318111_159_1109 310
114 3300049574 Ga0501038_0334231 Ga0501038_0334231_103_1056 310
115 3300049578 Ga0501042_0090349 Ga0501042_0090349_680_1630 310
116 3300049578 Ga0501042_0188824 Ga0501042_0188824_203_1156 310
117 3300049580 Ga0501046_0051841 Ga0501046_0051841_1522_2472 310
118 3300049580 Ga0501046_0074960 Ga0501046_0074960_1151_2113 310
119 3300049587 Ga0501071_0145814 Ga0501071_0145814_116_1078 310
120 3300049591 Ga0501075_0356017 Ga0501075_0356017_90_1052 310
121 3300049592 Ga0501076_0003500 Ga0501076_0003500_5232_6194 310
122 3300049651 Ga0501201_002945 Ga0501201_002945_344_1288 310
123 3300049652 Ga0501202_013163 Ga0501202_013163_104_1048 310
124 3300049653 Ga0501206_003128 Ga0501206_003128_45_989 310
125 3300049656 Ga0501209_012314 Ga0501209_012314_520_1464 310
126 3300049658 Ga0501211_005505 Ga0501211_005505_92_1036 310
127 3300049659 Ga0501214_000497 Ga0501214_000497_604_1548 310
128 3300049661 Ga0501217_008752 Ga0501217_008752_535_1479 310
129 3300049663 Ga0501223_012012 Ga0501223_012012_230_1174 310
130 3300049664 Ga0501224_000892 Ga0501224_000892_1953_2897 310
131 3300049665 Ga0501227_011134 Ga0501227_011134_999_1943 310
132 3300049666 Ga0501228_000614 Ga0501228_000614_743_1687 310
133 3300049667 Ga0501230_004283 Ga0501230_004283_191_1135 310
134 3300049668 Ga0501233_027149 Ga0501233_027149_252_1196 310
135 3300049669 Ga0501235_009024 Ga0501235_009024_828_1772 310
136 3300049670 Ga0501236_003098 Ga0501236_003098_339_1283 310
137 3300049674 Ga0501242_003274 Ga0501242_003274_450_1394 310
138 3300049675 Ga0501243_000718 Ga0501243_000718_983_1927 310
139 3300049679 Ga0501249_021238 Ga0501249_021238_218_1162 310
140 3300049685 Ga0501256_001247 Ga0501256_001247_180_1124 310
141 3300049686 Ga0501257_007588 Ga0501257_007588_640_1584 310
142 3300049688 Ga0501259_003637 Ga0501259_003637_353_1297 310
143 3300049690 Ga0501261_000953 Ga0501261_000953_1639_2583 310
144 3300049705 Ga0501225_0021018 Ga0501225_0021018_253_1197 310
145 3300049708 Ga0501245_014175 Ga0501245_014175_103_1047 310
146 3300049741 Ga0501079_0057628 Ga0501079_0057628_1266_2228 310
147 3300049743 Ga0501081_0075990 Ga0501081_0075990_860_1810 310
148 3300049762 Ga0501265_004845 Ga0501265_004845_346_1290 310
149 3300049763 Ga0501266_001595 Ga0501266_001595_1121_2065 310
150 3300049767 Ga0501270_003324 Ga0501270_003324_145_1089 310
151 3300049768 Ga0501271_000811 Ga0501271_000811_988_1932 310
152 3300049771 Ga0501274_001250 Ga0501274_001250_14_958 310
153 3300049773 Ga0501276_001500 Ga0501276_001500_86_1030 310
154 3300049774 Ga0501278_002559 Ga0501278_002559_75_1019 310
155 3300049775 Ga0501279_004328 Ga0501279_004328_14_958 310
156 3300049778 Ga0501282_002443 Ga0501282_002443_565_1509 310
157 3300049779 Ga0501283_003416 Ga0501283_003416_42_986 310
158 3300049823 Ga0501044_0112714 Ga0501044_0112714_226_1176 310
159 3300049824 Ga0501045_0006017 Ga0501045_0006017_2825_3787 310
160 3300049850 Ga0501204_000341 Ga0501204_000341_1295_2239 310
161 3300049851 Ga0501212_001320 Ga0501212_001320_253_1197 310
162 3300049853 Ga0501226_004003 Ga0501226_004003_255_1199 310
163 3300050508 nmdc:mga09592_272434_c1 nmdc:mga09592_272434_c1_355_1317 310
164 3300054114 Ga0501084_0013182 Ga0501084_0013182_5219_6181 310
165 3300059421 Ga0590071_003747 Ga0590071_003747_589_1533 310
166 3300059423 Ga0590074_004471 Ga0590074_004471_802_1746 310
167 3300059424 Ga0590075_001429 Ga0590075_001429_263_1207 310
168 3300059424 Ga0590075_006743 Ga0590075_006743_194_1138 310
169 3300059424 Ga0590075_018900 Ga0590075_018900_428_1381 310
170 3300059426 Ga0590077_000833 Ga0590077_000833_4336_5280 310
171 3300059426 Ga0590077_002513 Ga0590077_002513_1257_2201 310
172 3300060353 Ga0501082_0012644 Ga0501082_0012644_1500_2462 310
173 3300060353 Ga0501082_0127011 Ga0501082_0127011_26_985 310
174 3300061734 Ga0530510_0015284 Ga0530510_0015284_3527_4489 310
175 3300005468 Ga0070707_100311124 Ga0070707_1003111242 311
176 3300006846 Ga0075430_100013535 Ga0075430_1000135353 311
177 3300006880 Ga0075429_100026731 Ga0075429_1000267315 311
178 3300009147 Ga0114129_10011859 Ga0114129_100118597 311
179 3300025922 Ga0207646_10398150 Ga0207646_103981501 311
180 3300031731 Ga0307405_10088038 Ga0307405_100880382 311
181 3300031824 Ga0307413_10025688 Ga0307413_100256882 311
182 3300031901 Ga0307406_10023022 Ga0307406_100230226 311
183 3300032002 Ga0307416_100124847 Ga0307416_1001248472 311
184 3300032005 Ga0307411_10018986 Ga0307411_100189866 311
185 3300032126 Ga0307415_100012771 Ga0307415_1000127716 311
186 3300049514 Ga0501291_000582 Ga0501291_000582_842_1789 311
187 3300049522 Ga0501299_028408 Ga0501299_028408_49_996 311
188 3300049575 Ga0501039_0117392 Ga0501039_0117392_247_1200 311
189 3300049652 Ga0501202_003365 Ga0501202_003365_883_1830 311
190 3300049661 Ga0501217_005352 Ga0501217_005352_1038_1985 311
191 3300049675 Ga0501243_015621 Ga0501243_015621_257_1204 311
192 3300049705 Ga0501225_0046646 Ga0501225_0046646_41_988 311
193 3300049757 Ga0501232_001924 Ga0501232_001924_676_1623 311
194 3300049768 Ga0501271_000256 Ga0501271_000256_2938_3885 311
195 3300049851 Ga0501212_005158 Ga0501212_005158_93_1040 311
196 3300050508 nmdc:mga09592_55263_c1 nmdc:mga09592_55263_c1_1174_2121 311
197 3300006846 Ga0075430_100000075 Ga0075430_1000000756 312
198 3300006847 Ga0075431_100012709 Ga0075431_1000127096 312
199 3300006880 Ga0075429_100008054 Ga0075429_1000080546 312
200 3300009094 Ga0111539_10024367 Ga0111539_100243674 312
201 3300009147 Ga0114129_10032006 Ga0114129_100320064 312
202 3300027907 Ga0207428_10000396 Ga0207428_1000039653 312
203 3300031852 Ga0307410_10029048 Ga0307410_100290482 312
204 3300031901 Ga0307406_10269434 Ga0307406_102694342 312
205 3300031995 Ga0307409_100024492 Ga0307409_1000244922 312
206 3300032002 Ga0307416_100035336 Ga0307416_1000353361 312
207 3300032004 Ga0307414_10016126 Ga0307414_100161263 312
208 3300032005 Ga0307411_10114029 Ga0307411_101140292 312
209 3300032126 Ga0307415_100028406 Ga0307415_1000284065 312
210 3300050507 nmdc:mga05p37_9509_c1 nmdc:mga05p37_9509_c1_2890_3855 312
211 3300050508 nmdc:mga09592_73_c1 nmdc:mga09592_73_c1_8835_9800 312
212 3300050509 nmdc:mga0qj67_618_c1 nmdc:mga0qj67_618_c1_10905_11870 312
213 3300050510 nmdc:mga06r32_5365_c1 nmdc:mga06r32_5365_c1_2867_3832 312
214 3300050511 nmdc:mga08y16_5188_c1 nmdc:mga08y16_5188_c1_2891_3856 312
215 3300005434 Ga0070709_10007182 Ga0070709_100071828 313
216 3300005435 Ga0070714_100001327 Ga0070714_1000013272 313
217 3300005437 Ga0070710_10012702 Ga0070710_100127025 313
218 3300005439 Ga0070711_100037046 Ga0070711_1000370462 313
219 3300005439 Ga0070711_100132770 Ga0070711_1001327702 313
220 3300005445 Ga0070708_100226364 Ga0070708_1002263642 313
221 3300005467 Ga0070706_100021914 Ga0070706_1000219143 313
222 3300006028 Ga0070717_10015993 Ga0070717_100159939 313
223 3300006163 Ga0070715_10166139 Ga0070715_101661391 313
224 3300006173 Ga0070716_100198716 Ga0070716_1001987162 313
225 3300025898 Ga0207692_10048525 Ga0207692_100485252 313
226 3300025906 Ga0207699_10053576 Ga0207699_100535761 313
227 3300025906 Ga0207699_10105563 Ga0207699_101055632 313
228 3300025910 Ga0207684_10145792 Ga0207684_101457922 313
229 3300025916 Ga0207663_10003770 Ga0207663_100037709 313
230 3300025916 Ga0207663_10040634 Ga0207663_100406343 313
231 3300025922 Ga0207646_10176271 Ga0207646_101762712 313
232 3300025928 Ga0207700_10019566 Ga0207700_100195664 313
233 3300025929 Ga0207664_10037908 Ga0207664_100379084 313
234 3300025939 Ga0207665_10074951 Ga0207665_100749513 313
235 3300006871 Ga0075434_100289696 Ga0075434_1002896962 314
236 3300032137 Ga0316585_10074771 Ga0316585_100747711 314
237 3300037068 Ga0373925_0177815 Ga0373925_0177815_262_1233 314
238 3300042436 Ga0439435_0025017 Ga0439435_0025017_397_1428 314
239 3300049570 Ga0501033_0041185 Ga0501033_0041185_723_1754 314
240 3300049572 Ga0501036_0000394 Ga0501036_0000394_26834_27865 314
241 3300049573 Ga0501037_0007325 Ga0501037_0007325_1086_2117 314
242 3300049574 Ga0501038_0010387 Ga0501038_0010387_6725_7756 314
243 3300049575 Ga0501039_0021664 Ga0501039_0021664_809_1840 314
244 3300049576 Ga0501040_0000979 Ga0501040_0000979_9600_10631 314
245 3300049577 Ga0501041_0000349 Ga0501041_0000349_15044_16075 314
246 3300049578 Ga0501042_0028810 Ga0501042_0028810_750_1781 314
247 3300049580 Ga0501046_0000453 Ga0501046_0000453_34079_35110 314
248 3300049582 Ga0501048_0138827 Ga0501048_0138827_519_1550 314
249 3300049584 Ga0501068_0083876 Ga0501068_0083876_582_1613 314
250 3300049587 Ga0501071_0006236 Ga0501071_0006236_6024_7055 314
251 3300049591 Ga0501075_0000464 Ga0501075_0000464_10590_11621 314
252 3300049592 Ga0501076_0122637 Ga0501076_0122637_351_1382 314
253 3300049593 Ga0501077_0009960 Ga0501077_0009960_4202_5233 314
254 3300049741 Ga0501079_0000218 Ga0501079_0000218_16630_17661 314
255 3300049743 Ga0501081_0000342 Ga0501081_0000342_11725_12756 314
256 3300049822 Ga0501035_0134760 Ga0501035_0134760_243_1274 314
257 3300049823 Ga0501044_0116059 Ga0501044_0116059_704_1735 314
258 3300049824 Ga0501045_0185837 Ga0501045_0185837_337_1368 314
259 3300054114 Ga0501084_0001530 Ga0501084_0001530_3252_4283 314
260 3300060353 Ga0501082_0002269 Ga0501082_0002269_1424_2455 314
261 3300061734 Ga0530510_0110885 Ga0530510_0110885_810_1841 314
262 3300005337 Ga0070682_100015969 Ga0070682_1000159694 315
263 3300005338 Ga0068868_100031148 Ga0068868_1000311484 315
264 3300005366 Ga0070659_100146878 Ga0070659_1001468781 315
265 3300005455 Ga0070663_100102605 Ga0070663_1001026052 315
266 3300005456 Ga0070678_100139618 Ga0070678_1001396182 315
267 3300005535 Ga0070684_100103559 Ga0070684_1001035592 315
268 3300005547 Ga0070693_100042283 Ga0070693_1000422832 315
269 3300005614 Ga0068856_100049449 Ga0068856_1000494494 315
270 3300005614 Ga0068856_100396812 Ga0068856_1003968121 315
271 3300005615 Ga0070702_100043653 Ga0070702_1000436532 315
272 3300009176 Ga0105242_10189728 Ga0105242_101897282 315
273 3300011119 Ga0105246_10303665 Ga0105246_103036652 315
274 3300013296 Ga0157374_10030596 Ga0157374_100305962 315
275 3300013297 Ga0157378_10136042 Ga0157378_101360422 315
276 3300014969 Ga0157376_10435798 Ga0157376_104357982 315
277 3300025932 Ga0207690_10117671 Ga0207690_101176712 315
278 3300025944 Ga0207661_10031342 Ga0207661_100313423 315
279 3300025944 Ga0207661_10308013 Ga0207661_103080131 315
280 3300026078 Ga0207702_10071615 Ga0207702_100716153 315
281 3300026121 Ga0207683_10135858 Ga0207683_101358581 315
282 3300039453 Ga0436362_0183664 Ga0436362_0183664_1146_2174 315
283 3300042008 Ga0439450_004407 Ga0439450_004407_498_1529 315
284 3300048903 Ga0496100_0128598 Ga0496100_0128598_560_1585 315
285 3300048909 Ga0496106_0044419 Ga0496106_0044419_2225_3250 315
286 3300048910 Ga0496107_0151412 Ga0496107_0151412_628_1653 315
287 3300048911 Ga0496108_0111590 Ga0496108_0111590_521_1546 315
288 3300014497 Ga0182008_10008794 Ga0182008_100087943 316
289 3300025939 Ga0207665_10003295 Ga0207665_100032958 316
290 3300028653 Ga0265323_10023922 Ga0265323_100239222 316
291 3300028800 Ga0265338_10141482 Ga0265338_101414822 316
292 3300029957 Ga0265324_10051411 Ga0265324_100514111 316
293 3300031235 Ga0265330_10001742 Ga0265330_1000174213 316
294 3300031235 Ga0265330_10002557 Ga0265330_1000255720 316
295 3300031242 Ga0265329_10000103 Ga0265329_100001034 316
296 3300031344 Ga0265316_10000017 Ga0265316_100000174 316
297 3300031711 Ga0265314_10000943 Ga0265314_100009435 316
298 3300031712 Ga0265342_10000532 Ga0265342_1000053244 316
299 3300038699 Ga0242422_01262 Ga0242422_01262_30_1028 316
300 3300038996 Ga0242420_000292 Ga0242420_000292_1687_2685 316
301 3300046559 Ga0495667_0003532 Ga0495667_0003532_9447_10430 316
302 3300048909 Ga0496106_0028905 Ga0496106_0028905_2879_3877 316
303 3300048910 Ga0496107_0092411 Ga0496107_0092411_912_1910 316
304 3300050514 nmdc:mga08x19_188818_c1 nmdc:mga08x19_188818_c1_160_1155 316
305 3300050515 nmdc:mga0a205_42014_c1 nmdc:mga0a205_42014_c1_3267_4262 316
306 3300006844 Ga0075428_100304279 Ga0075428_1003042792 317
307 3300028653 Ga0265323_10064181 Ga0265323_100641812 317
308 2162886011 MRS1b_contig_1248338 MRS1b_0266.00002400 320
309 2162886012 MBSR1b_contig_10382275 MBSR1b_0499.00007330 320
310 3300005290 Ga0065712_10000934 Ga0065712_100009342 320
311 3300005293 Ga0065715_10000541 Ga0065715_1000054112 320
312 3300006852 Ga0075433_10028411 Ga0075433_100284116 320
313 3300006871 Ga0075434_100001722 Ga0075434_1000017229 320
314 3300009147 Ga0114129_10006804 Ga0114129_100068045 320
315 3300050507 nmdc:mga05p37_52681_c1 nmdc:mga05p37_52681_c1_3933_4976 320
316 3300050512 nmdc:mga0n895_2468_c1 nmdc:mga0n895_2468_c1_12293_13336 320
317 2162886007 SwRhRL2b_contig_1653340 SwRhRL2b_0347.00005230 321
318 3300003371 JGI26145J50221_1000079 JGI26145J50221_10000795 321
319 3300003379 JGI26142J50222_100271 JGI26142J50222_1002712 321
320 3300003382 JGI26139J50223_100139 JGI26139J50223_1001394 321
321 3300003383 JGI26140J50224_100030 JGI26140J50224_1000303 321
322 3300003391 JGI26135J50243_100051 JGI26135J50243_1000512 321
323 3300003392 JGI26134J50242_100024 JGI26134J50242_10002410 321
324 3300003396 JGI26137J50245_100089 JGI26137J50245_1000893 321
325 3300003400 JGI26131J50246_100369 JGI26131J50246_1003691 321
326 3300003502 JGI26143J51219_1000196 JGI26143J51219_10001961 321
327 3300003503 JGI26141J51220_1000027 JGI26141J51220_10000275 321
328 3300003504 JGI26138J51218_100005 JGI26138J51218_1000055 321
329 3300005289 Ga0065704_10000863 Ga0065704_1000086338 321
330 3300005289 Ga0065704_10010343 Ga0065704_100103432 321
331 3300005289 Ga0065704_10083353 Ga0065704_100833534 321
332 3300005295 Ga0065707_10000205 Ga0065707_100002052 321
333 3300005295 Ga0065707_10000598 Ga0065707_100005981 321
334 3300005328 Ga0070676_10007966 Ga0070676_100079666 321
335 3300005328 Ga0070676_10119778 Ga0070676_101197782 321
336 3300005333 Ga0070677_10077501 Ga0070677_100775012 321
337 3300005336 Ga0070680_100008762 Ga0070680_1000087628 321
338 3300005338 Ga0068868_100069659 Ga0068868_1000696592 321
339 3300005339 Ga0070660_100332372 Ga0070660_1003323721 321
340 3300005341 Ga0070691_10018694 Ga0070691_100186942 321
341 3300005344 Ga0070661_100148222 Ga0070661_1001482221 321
342 3300005347 Ga0070668_100192286 Ga0070668_1001922862 321
343 3300005356 Ga0070674_100243371 Ga0070674_1002433711 321
344 3300005364 Ga0070673_100227014 Ga0070673_1002270142 321
345 3300005438 Ga0070701_10018736 Ga0070701_100187363 321
346 3300005440 Ga0070705_100020752 Ga0070705_1000207522 321
347 3300005455 Ga0070663_100167880 Ga0070663_1001678802 321
348 3300005458 Ga0070681_10016030 Ga0070681_100160301 321
349 3300005459 Ga0068867_100017198 Ga0068867_1000171982 321
350 3300005518 Ga0070699_100415375 Ga0070699_1004153752 321
351 3300005530 Ga0070679_100103336 Ga0070679_1001033361 321
352 3300005543 Ga0070672_100032318 Ga0070672_1000323182 321
353 3300005545 Ga0070695_100013833 Ga0070695_1000138337 321
354 3300005546 Ga0070696_100050233 Ga0070696_1000502332 321
355 3300005547 Ga0070693_100071962 Ga0070693_1000719622 321
356 3300005564 Ga0070664_100010108 Ga0070664_10001010812 321
357 3300005577 Ga0068857_100183493 Ga0068857_1001834931 321
358 3300005615 Ga0070702_100008110 Ga0070702_1000081104 321
359 3300005617 Ga0068859_100195939 Ga0068859_1001959391 321
360 3300005618 Ga0068864_100120580 Ga0068864_1001205802 321
361 3300005840 Ga0068870_10000733 Ga0068870_100007337 321
362 3300005840 Ga0068870_10019659 Ga0068870_100196594 321
363 3300005843 Ga0068860_100145351 Ga0068860_1001453511 321
364 3300005844 Ga0068862_100035311 Ga0068862_1000353112 321
365 3300005937 Ga0081455_10005946 Ga0081455_100059468 321
366 3300006058 Ga0075432_10005326 Ga0075432_100053262 321
367 3300006194 Ga0075427_10002847 Ga0075427_100028472 321
368 3300006844 Ga0075428_100091221 Ga0075428_1000912213 321
369 3300006844 Ga0075428_100225226 Ga0075428_1002252262 321
370 3300006846 Ga0075430_100123662 Ga0075430_1001236622 321
371 3300006847 Ga0075431_100034214 Ga0075431_1000342142 321
372 3300006880 Ga0075429_100008281 Ga0075429_1000082815 321
373 3300006880 Ga0075429_100232639 Ga0075429_1002326392 321
374 3300006881 Ga0068865_100025686 Ga0068865_1000256861 321
375 3300006931 Ga0097620_100195937 Ga0097620_1001959372 321
376 3300007076 Ga0075435_100130258 Ga0075435_1001302581 321
377 3300009093 Ga0105240_10627552 Ga0105240_106275521 321
378 3300009094 Ga0111539_10056526 Ga0111539_100565266 321
379 3300009147 Ga0114129_10019689 Ga0114129_1001968913 321
380 3300009174 Ga0105241_10244163 Ga0105241_102441631 321
381 3300009176 Ga0105242_10216037 Ga0105242_102160372 321
382 3300009553 Ga0105249_10008637 Ga0105249_100086374 321
383 3300011119 Ga0105246_10009517 Ga0105246_100095173 321
384 3300011119 Ga0105246_10070309 Ga0105246_100703093 321
385 3300013100 Ga0157373_10081181 Ga0157373_100811811 321
386 3300013297 Ga0157378_10057927 Ga0157378_100579275 321
387 3300025904 Ga0207647_10013957 Ga0207647_100139572 321
388 3300025907 Ga0207645_10014629 Ga0207645_100146292 321
389 3300025907 Ga0207645_10054372 Ga0207645_100543722 321
390 3300025908 Ga0207643_10000148 Ga0207643_1000014840 321
391 3300025908 Ga0207643_10007030 Ga0207643_100070304 321
392 3300025912 Ga0207707_10341375 Ga0207707_103413752 321
393 3300025917 Ga0207660_10034133 Ga0207660_100341333 321
394 3300025918 Ga0207662_10048334 Ga0207662_100483341 321
395 3300025923 Ga0207681_10006949 Ga0207681_100069491 321
396 3300025925 Ga0207650_10083869 Ga0207650_100838691 321
397 3300025933 Ga0207706_10008772 Ga0207706_100087727 321
398 3300025940 Ga0207691_10047324 Ga0207691_100473243 321
399 3300025942 Ga0207689_10010081 Ga0207689_100100812 321
400 3300025945 Ga0207679_10107277 Ga0207679_101072772 321
401 3300025945 Ga0207679_10231923 Ga0207679_102319231 321
402 3300025960 Ga0207651_10011629 Ga0207651_100116294 321
403 3300025961 Ga0207712_10003399 Ga0207712_100033994 321
404 3300025972 Ga0207668_10136525 Ga0207668_101365252 321
405 3300026067 Ga0207678_10015929 Ga0207678_100159297 321
406 3300026075 Ga0207708_10001487 Ga0207708_1000148713 321
407 3300026095 Ga0207676_10125693 Ga0207676_101256932 321
408 3300027364 Ga0209967_1000651 Ga0209967_10006512 321
409 3300027378 Ga0209981_1000124 Ga0209981_100012411 321
410 3300027395 Ga0209996_1001487 Ga0209996_10014873 321
411 3300027424 Ga0209984_1000958 Ga0209984_10009582 321
412 3300027471 Ga0209995_1000081 Ga0209995_10000812 321
413 3300027526 Ga0209968_1000440 Ga0209968_10004405 321
414 3300027552 Ga0209982_1001098 Ga0209982_10010982 321
415 3300027614 Ga0209970_1001843 Ga0209970_10018432 321
416 3300027665 Ga0209983_1000361 Ga0209983_10003614 321
417 3300027682 Ga0209971_1002787 Ga0209971_10027874 321
418 3300027695 Ga0209966_1000405 Ga0209966_10004058 321
419 3300027717 Ga0209998_10001444 Ga0209998_100014443 321
420 3300027876 Ga0209974_10009244 Ga0209974_100092442 321
421 3300027907 Ga0207428_10000126 Ga0207428_1000012646 321
422 3300027907 Ga0207428_10000157 Ga0207428_1000015747 321
423 3300027907 Ga0207428_10040568 Ga0207428_100405685 321
424 3300027907 Ga0207428_10111976 Ga0207428_101119762 321
425 3300028380 Ga0268265_10037250 Ga0268265_100372503 321
426 3300042993 Ga0439440_0037595 Ga0439440_0037595_88_1053 321
427 3300046491 Ga0495584_0041866 Ga0495584_0041866_591_1556 321
428 3300046615 Ga0495656_0089690 Ga0495656_0089690_368_1333 321
429 3300049568 Ga0501031_0083501 Ga0501031_0083501_762_1727 321
430 3300049574 Ga0501038_0367878 Ga0501038_0367878_63_1028 321
431 3300049576 Ga0501040_0129161 Ga0501040_0129161_189_1154 321
432 3300049577 Ga0501041_0065737 Ga0501041_0065737_326_1291 321
433 3300049577 Ga0501041_0102521 Ga0501041_0102521_682_1647 321
434 3300049578 Ga0501042_0139618 Ga0501042_0139618_674_1639 321
435 3300049578 Ga0501042_0316076 Ga0501042_0316076_103_1068 321
436 3300049579 Ga0501043_0141682 Ga0501043_0141682_193_1158 321
437 3300049580 Ga0501046_0035062 Ga0501046_0035062_2825_3790 321
438 3300049580 Ga0501046_0152779 Ga0501046_0152779_536_1501 321
439 3300049583 Ga0501067_0145991 Ga0501067_0145991_53_1018 321
440 3300049591 Ga0501075_0117545 Ga0501075_0117545_836_1801 321
441 3300049593 Ga0501077_0022705 Ga0501077_0022705_532_1497 321
442 3300049743 Ga0501081_0002870 Ga0501081_0002870_949_1914 321
443 3300049743 Ga0501081_0157046 Ga0501081_0157046_659_1624 321
444 3300049824 Ga0501045_0078815 Ga0501045_0078815_620_1585 321
445 3300049824 Ga0501045_0264337 Ga0501045_0264337_116_1081 321
446 3300050507 nmdc:mga05p37_177648_c1 nmdc:mga05p37_177648_c1_1373_2338 321
447 3300050507 nmdc:mga05p37_354858_c1 nmdc:mga05p37_354858_c1_598_1563 321
448 3300050507 nmdc:mga05p37_3641_c1 nmdc:mga05p37_3641_c1_7959_8924 321
449 3300050507 nmdc:mga05p37_45187_c1 nmdc:mga05p37_45187_c1_4105_5070 321
450 3300050508 nmdc:mga09592_19134_c1 nmdc:mga09592_19134_c1_3185_4150 321
451 3300050508 nmdc:mga09592_34653_c1 nmdc:mga09592_34653_c1_598_1563 321
452 3300050508 nmdc:mga09592_4309_c1 nmdc:mga09592_4309_c1_6604_7569 321
453 3300050509 nmdc:mga0qj67_38921_c1 nmdc:mga0qj67_38921_c1_113_1078 321
454 3300050510 nmdc:mga06r32_144674_c1 nmdc:mga06r32_144674_c1_793_1758 321
455 3300050511 nmdc:mga08y16_17728_c1 nmdc:mga08y16_17728_c1_2381_3346 321
456 3300050511 nmdc:mga08y16_441823_c1 nmdc:mga08y16_441823_c1_222_1187 321
457 3300050511 nmdc:mga08y16_44284_c1 nmdc:mga08y16_44284_c1_1126_2091 321
458 3300050512 nmdc:mga0n895_34768_c1 nmdc:mga0n895_34768_c1_484_1449 321
459 3300050513 nmdc:mga0rr50_332899_c1 nmdc:mga0rr50_332899_c1_22_987 321
460 3300050515 nmdc:mga0a205_16339_c1 nmdc:mga0a205_16339_c1_2373_3338 321
461 3300060353 Ga0501082_0008196 Ga0501082_0008196_991_1956 321
462 3300060353 Ga0501082_0092207 Ga0501082_0092207_952_1917 321
463 3300061734 Ga0530510_0247395 Ga0530510_0247395_307_1272 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

195

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.961 2 224
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9447 2 216
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9384 2 220
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9345 2 220
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9343 2 224
ID Description Score Start End Superfamily
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9611 2 225 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 2 224 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 1 220 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 16 222 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 2 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9751 1 219 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9742 2 224 GO:0005524
GO:0016887
AF-A0A7Y4ZA76-F1-model_v4 ABC transporter ATP-binding protein 0.9715 2 215 GO:0005524
GO:0016887
AF-A0A7X7SX92-F1-model_v4 ABC transporter ATP-binding protein 0.9712 2 121 GO:0005524
GO:0016887
AF-A0A1F9CYT8-F1-model_v4 ABC transporter domain-containing protein 0.9673 17 219 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.65 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map