F448881

General Info

Members Datasets Scaffolds Average Seq Length
462 277 924 116

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10119430|Ga0075432_101194302
Length 119
Sequence MTTATIEKAKRRLRRRRKVRSKVIGTSERPRLSIYRSNRGVFAQLIDDERGQTLASVNWTESDLRSLKPMEGATKAGKMLAERAQAAGLETCVFDRGGYRYHGRVKALADGARDGGLKF

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 3.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.76
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10119430 3300006058 Bacteria 989
2 JGI24737J22298_10054083 3300001990 Bacteria 1215
3 JGI24744J21845_10030275 3300002077 Bacteria 1037
4 Ga0070676_10425631 3300005328 Bacteria 929
5 Ga0070683_100612228 3300005329 Bacteria 1042
6 Ga0070690_100027868 3300005330 Bacteria 3495
7 Ga0070670_100570605 3300005331 Bacteria 1011
8 Ga0070670_101048382 3300005331 Bacteria 742
9 Ga0070670_101263052 3300005331 Bacteria 676
10 Ga0068869_100296856 3300005334 Bacteria 1303
11 Ga0070666_10367922 3300005335 Bacteria 1031
12 Ga0070680_101352385 3300005336 Bacteria 617
13 Ga0070682_100345395 3300005337 Bacteria 1108
14 Ga0070682_100918553 3300005337 Bacteria 720
15 Ga0068868_100418775 3300005338 Bacteria 1159
16 Ga0068868_100487690 3300005338 Bacteria 1077
17 Ga0068868_101647993 3300005338 Bacteria 603
18 Ga0070660_100132763 3300005339 Bacteria 1994
19 Ga0070660_100259252 3300005339 Bacteria 1419
20 Ga0070689_100134267 3300005340 Bacteria 1986
21 Ga0070689_101589120 3300005340 Bacteria 594
22 Ga0070689_101716114 3300005340 Bacteria 572
23 Ga0070691_10197342 3300005341 Bacteria 1056
24 Ga0070691_10236268 3300005341 Bacteria 975
25 Ga0070691_10239574 3300005341 Bacteria 969
26 Ga0070687_100024182 3300005343 Bacteria 2896
27 Ga0070687_100114439 3300005343 Bacteria 1532
28 Ga0070661_100449117 3300005344 Bacteria 1026
29 Ga0070661_100477007 3300005344 Bacteria 996
30 Ga0070692_10035876 3300005345 Bacteria 2513
31 Ga0070692_10285035 3300005345 Bacteria 1003
32 Ga0070692_10444411 3300005345 Bacteria 828
33 Ga0070668_100058208 3300005347 Bacteria 2989
34 Ga0070668_100600864 3300005347 Bacteria 962
35 Ga0070669_100301659 3300005353 Bacteria 1288
36 Ga0070669_101118934 3300005353 Bacteria 679
37 Ga0070675_100128725 3300005354 Bacteria 2156
38 Ga0070675_100815035 3300005354 Bacteria 853
39 Ga0070675_100873657 3300005354 Bacteria 824
40 Ga0070674_100365028 3300005356 Bacteria 1170
41 Ga0070674_100702706 3300005356 Bacteria 864
42 Ga0070674_100842564 3300005356 Bacteria 795
43 Ga0070659_100163758 3300005366 Bacteria 1819
44 Ga0070659_100417346 3300005366 Bacteria 1134
45 Ga0070659_100507454 3300005366 Bacteria 1028
46 Ga0070659_100781520 3300005366 Bacteria 829
47 Ga0070667_101981048 3300005367 Bacteria 548
48 Ga0070709_10314302 3300005434 Bacteria 1148
49 Ga0070710_10264789 3300005437 Bacteria 1110
50 Ga0070701_10045375 3300005438 Bacteria 2255
51 Ga0070701_10616124 3300005438 Bacteria 721
52 Ga0070700_100169788 3300005441 Bacteria 1509
53 Ga0070700_100662420 3300005441 Bacteria 825
54 Ga0070663_100178784 3300005455 Bacteria 1644
55 Ga0070663_100347817 3300005455 Bacteria 1199
56 Ga0070678_100317831 3300005456 Bacteria 1329
57 Ga0070678_100726438 3300005456 Bacteria 896
58 Ga0070662_100020737 3300005457 Bacteria 4481
59 Ga0070662_100102086 3300005457 Bacteria 2172
60 Ga0070662_100449349 3300005457 Bacteria 1069
61 Ga0070662_100627237 3300005457 Bacteria 906
62 Ga0068867_100587512 3300005459 Bacteria 969
63 Ga0068867_100659945 3300005459 Bacteria 919
64 Ga0068867_101537064 3300005459 Bacteria 620
65 Ga0070685_10023094 3300005466 Bacteria 3401
66 Ga0070685_10550376 3300005466 Bacteria 823
67 Ga0070684_100247385 3300005535 Bacteria 1629
68 Ga0070684_100633758 3300005535 Bacteria 995
69 Ga0070684_101584265 3300005535 Bacteria 618
70 Ga0068853_100363543 3300005539 Bacteria 1348
71 Ga0068853_100434044 3300005539 Bacteria 1233
72 Ga0068853_100777993 3300005539 Bacteria 916
73 Ga0070672_100119315 3300005543 Bacteria 2157
74 Ga0070672_100743366 3300005543 Bacteria 860
75 Ga0070686_100068990 3300005544 Bacteria 2307
76 Ga0070695_101123725 3300005545 Bacteria 644
77 Ga0070693_100184469 3300005547 Bacteria 1345
78 Ga0070665_100370697 3300005548 Bacteria 1438
79 Ga0070665_100395478 3300005548 Bacteria 1390
80 Ga0070665_100633125 3300005548 Bacteria 1083
81 Ga0070664_100038200 3300005564 Bacteria 4040
82 Ga0070664_100104636 3300005564 Bacteria 2464
83 Ga0068857_100161760 3300005577 Bacteria 2032
84 Ga0068854_100227579 3300005578 Bacteria 1478
85 Ga0068854_100529572 3300005578 Bacteria 996
86 Ga0068854_100790155 3300005578 Bacteria 826
87 Ga0068854_101689748 3300005578 Bacteria 579
88 Ga0070702_100100832 3300005615 Bacteria 1770
89 Ga0070702_100538484 3300005615 Bacteria 864
90 Ga0070702_100947254 3300005615 Bacteria 678
91 Ga0068852_100058425 3300005616 Bacteria 3341
92 Ga0068852_100196562 3300005616 Bacteria 1906
93 Ga0068852_101046764 3300005616 Bacteria 835
94 Ga0068852_102047054 3300005616 Bacteria 594
95 Ga0068859_101413328 3300005617 Bacteria 767
96 Ga0068864_100037025 3300005618 Bacteria 4161
97 Ga0068866_10036975 3300005718 Bacteria 2395
98 Ga0068866_10543686 3300005718 Bacteria 776
99 Ga0068861_100047582 3300005719 Bacteria 3238
100 Ga0068861_100391021 3300005719 Bacteria 1231
101 Ga0068861_101200451 3300005719 Bacteria 734
102 Ga0068870_10191781 3300005840 Bacteria 1233
103 Ga0068870_10197583 3300005840 Bacteria 1217
104 Ga0068870_10399958 3300005840 Bacteria 893
105 Ga0068858_100341259 3300005842 Bacteria 1434
106 Ga0068858_102002015 3300005842 Bacteria 573
107 Ga0068860_102251840 3300005843 Bacteria 566
108 Ga0068860_102448935 3300005843 Bacteria 542
109 Ga0068862_100321367 3300005844 Bacteria 1429
110 Ga0068862_100598023 3300005844 Bacteria 1059
111 Ga0068862_100725660 3300005844 Bacteria 965
112 Ga0068862_101546213 3300005844 Bacteria 669
113 Ga0081455_10740837 3300005937 Bacteria 622
114 Ga0081539_10001787 3300005985 Bacteria 34104
115 Ga0070717_10245475 3300006028 Bacteria 1580
116 Ga0070717_10645672 3300006028 Bacteria 960
117 Ga0070716_100404467 3300006173 Bacteria 983
118 Ga0070712_100012973 3300006175 Bacteria 5312
119 Ga0075427_10057208 3300006194 Bacteria 679
120 Ga0068871_100046531 3300006358 Bacteria 3495
121 Ga0075428_100977568 3300006844 Bacteria 896
122 Ga0075430_101551551 3300006846 Bacteria 544
123 Ga0075433_10061451 3300006852 Bacteria 3291
124 Ga0075434_100623055 3300006871 Bacteria 1098
125 Ga0068865_100157423 3300006881 Bacteria 1729
126 Ga0068865_100163859 3300006881 Bacteria 1698
127 Ga0068865_100188946 3300006881 Bacteria 1591
128 Ga0068865_100327283 3300006881 Bacteria 1235
129 Ga0068865_101249948 3300006881 Bacteria 659
130 Ga0097620_101413286 3300006931 Bacteria 767
131 Ga0105240_11146770 3300009093 Unclassified 825
132 Ga0105240_12580268 3300009093 Bacteria 525
133 Ga0111539_10124228 3300009094 Bacteria 3025
134 Ga0111539_10586413 3300009094 Bacteria 1298
135 Ga0111539_10766501 3300009094 Bacteria 1123
136 Ga0105245_10539214 3300009098 Bacteria 1188
137 Ga0105247_10805890 3300009101 Bacteria 717
138 Ga0105247_11014332 3300009101 Bacteria 649
139 Ga0114129_10221937 3300009147 Bacteria 2549
140 Ga0114129_11143439 3300009147 Bacteria 972
141 Ga0105243_10288439 3300009148 Bacteria 1482
142 Ga0105243_10728082 3300009148 Bacteria 970
143 Ga0105243_11957517 3300009148 Bacteria 620
144 Ga0105243_12590005 3300009148 Bacteria 547
145 Ga0105242_11217102 3300009176 Bacteria 773
146 Ga0105242_11978633 3300009176 Bacteria 625
147 Ga0105242_12442316 3300009176 Bacteria 570
148 Ga0105248_10490865 3300009177 Bacteria 1384
149 Ga0105248_10706340 3300009177 Bacteria 1138
150 Ga0105248_12714911 3300009177 Bacteria 565
151 Ga0105237_10037314 3300009545 Bacteria 4913
152 Ga0105238_10752759 3300009551 Bacteria 988
153 Ga0105238_12246810 3300009551 Bacteria 580
154 Ga0105238_12866442 3300009551 Bacteria 518
155 Ga0105249_11153860 3300009553 Bacteria 845
156 Ga0105249_11433252 3300009553 Bacteria 763
157 Ga0105249_11827676 3300009553 Bacteria 680
158 Ga0105239_11169230 3300010375 Bacteria 886
159 Ga0105239_11643593 3300010375 Bacteria 743
160 Ga0105246_10544359 3300011119 Bacteria 994
161 Ga0105246_11004695 3300011119 Bacteria 755
162 Ga0105246_11143062 3300011119 Bacteria 713
163 Ga0157347_1010101 3300012502 Bacteria 986
164 Ga0157369_10818053 3300013105 Bacteria 957
165 Ga0157369_12232763 3300013105 Bacteria 555
166 Ga0157374_10618401 3300013296 Bacteria 1094
167 Ga0157378_12551874 3300013297 Bacteria 563
168 Ga0163162_11147202 3300013306 Bacteria 881
169 Ga0163162_12735858 3300013306 Bacteria 568
170 Ga0157375_10772758 3300013308 Bacteria 1111
171 Ga0157375_12418087 3300013308 Bacteria 627
172 Ga0163163_10278700 3300014325 Bacteria 1723
173 Ga0157380_10121421 3300014326 Bacteria 2214
174 Ga0157380_11453778 3300014326 Bacteria 737
175 Ga0157380_12025107 3300014326 Bacteria 638
176 Ga0157380_12201779 3300014326 Bacteria 615
177 Ga0182008_10476104 3300014497 Bacteria 683
178 Ga0182008_10537980 3300014497 Bacteria 647
179 Ga0157377_10385373 3300014745 Bacteria 950
180 Ga0157377_11162710 3300014745 Bacteria 595
181 Ga0157379_10668736 3300014968 Bacteria 973
182 Ga0157379_11857337 3300014968 Bacteria 593
183 Ga0157376_11426850 3300014969 Bacteria 724
184 Ga0163161_10166675 3300017792 Bacteria 1682
185 Ga0163161_10822357 3300017792 Bacteria 782
186 Ga0197907_11474715 3300020069 Bacteria 645
187 Ga0206350_11553086 3300020080 Bacteria 574
188 Ga0213873_10036464 3300021358 Bacteria 1248
189 Ga0213874_10007273 3300021377 Bacteria 2651
190 Ga0213876_10219700 3300021384 Bacteria 1010
191 Ga0213876_10359779 3300021384 Bacteria 774
192 Ga0213875_10058618 3300021388 Bacteria 1802
193 Ga0224712_10232785 3300022467 Bacteria 846
194 Ga0207653_10225436 3300025885 Bacteria 713
195 Ga0207682_10012598 3300025893 Bacteria 3299
196 Ga0207710_10272104 3300025900 Bacteria 851
197 Ga0207688_10014487 3300025901 Bacteria 4286
198 Ga0207688_10130830 3300025901 Bacteria 1471
199 Ga0207680_10473516 3300025903 Bacteria 890
200 Ga0207647_10537151 3300025904 Bacteria 649
201 Ga0207645_10174002 3300025907 Bacteria 1411
202 Ga0207643_10241615 3300025908 Bacteria 1110
203 Ga0207643_10439185 3300025908 Bacteria 829
204 Ga0207705_10350804 3300025909 Bacteria 1137
205 Ga0207671_10507116 3300025914 Bacteria 962
206 Ga0207693_10615078 3300025915 Bacteria 845
207 Ga0207660_11117003 3300025917 Bacteria 642
208 Ga0207662_11081515 3300025918 Bacteria 570
209 Ga0207657_10241916 3300025919 Bacteria 1441
210 Ga0207657_10959581 3300025919 Bacteria 657
211 Ga0207649_10949949 3300025920 Bacteria 675
212 Ga0207649_11220744 3300025920 Bacteria 594
213 Ga0207694_10837351 3300025924 Bacteria 777
214 Ga0207650_10207728 3300025925 Bacteria 1571
215 Ga0207650_10668593 3300025925 Bacteria 876
216 Ga0207650_11717988 3300025925 Bacteria 532
217 Ga0207659_10877817 3300025926 Bacteria 771
218 Ga0207687_10097367 3300025927 Bacteria 2158
219 Ga0207687_10419134 3300025927 Bacteria 1105
220 Ga0207690_10055403 3300025932 Bacteria 2670
221 Ga0207690_10258504 3300025932 Bacteria 1348
222 Ga0207690_10718278 3300025932 Bacteria 822
223 Ga0207706_10317721 3300025933 Bacteria 1355
224 Ga0207706_10599855 3300025933 Bacteria 946
225 Ga0207686_10243278 3300025934 Bacteria 1310
226 Ga0207686_11118700 3300025934 Bacteria 643
227 Ga0207709_10509508 3300025935 Bacteria 940
228 Ga0207670_10185941 3300025936 Bacteria 1568
229 Ga0207670_11047657 3300025936 Bacteria 687
230 Ga0207669_10041848 3300025937 Bacteria 2670
231 Ga0207669_10122368 3300025937 Bacteria 1769
232 Ga0207669_10198493 3300025937 Bacteria 1454
233 Ga0207704_10613346 3300025938 Bacteria 892
234 Ga0207704_10663315 3300025938 Bacteria 860
235 Ga0207704_11079781 3300025938 Bacteria 681
236 Ga0207691_10459683 3300025940 Bacteria 1083
237 Ga0207691_10548028 3300025940 Bacteria 981
238 Ga0207711_10289888 3300025941 Bacteria 1508
239 Ga0207689_10013833 3300025942 Bacteria 6875
240 Ga0207661_10752331 3300025944 Bacteria 897
241 Ga0207679_10073821 3300025945 Bacteria 2582
242 Ga0207651_10421472 3300025960 Bacteria 1140
243 Ga0207712_10281407 3300025961 Bacteria 1358
244 Ga0207712_10510615 3300025961 Bacteria 1029
245 Ga0207668_10049888 3300025972 Bacteria 2880
246 Ga0207668_10945444 3300025972 Bacteria 768
247 Ga0207658_10148842 3300025986 Bacteria 1905
248 Ga0207703_11439445 3300026035 Bacteria 663
249 Ga0207703_11812139 3300026035 Bacteria 586
250 Ga0207639_10100143 3300026041 Bacteria 2340
251 Ga0207639_10535959 3300026041 Bacteria 1073
252 Ga0207639_12115803 3300026041 Bacteria 524
253 Ga0207678_10176215 3300026067 Bacteria 1826
254 Ga0207678_10266474 3300026067 Bacteria 1469
255 Ga0207678_10297105 3300026067 Bacteria 1388
256 Ga0207678_10456565 3300026067 Bacteria 1111
257 Ga0207708_10008513 3300026075 Bacteria 7595
258 Ga0207708_10025712 3300026075 Bacteria 4455
259 Ga0207708_10737782 3300026075 Bacteria 844
260 Ga0207648_10597758 3300026089 Bacteria 1017
261 Ga0207676_10589020 3300026095 Bacteria 1067
262 Ga0207676_10984198 3300026095 Bacteria 830
263 Ga0207674_10275153 3300026116 Bacteria 1631
264 Ga0207674_10452676 3300026116 Bacteria 1241
265 Ga0207674_10641517 3300026116 Bacteria 1025
266 Ga0207675_100024485 3300026118 Bacteria 5612
267 Ga0207675_100071876 3300026118 Bacteria 3235
268 Ga0207675_101450730 3300026118 Bacteria 707
269 Ga0207675_101683833 3300026118 Bacteria 654
270 Ga0207675_101842584 3300026118 Bacteria 624
271 Ga0207683_10025472 3300026121 Bacteria 5104
272 Ga0207683_10639440 3300026121 Bacteria 985
273 Ga0207698_10415523 3300026142 Bacteria 1289
274 Ga0207698_10804527 3300026142 Bacteria 942
275 Ga0207698_11655084 3300026142 Bacteria 655
276 Ga0207428_10120383 3300027907 Bacteria 2013
277 Ga0207428_10128203 3300027907 Bacteria 1942
278 Ga0207428_11005967 3300027907 Bacteria 586
279 Ga0268266_10494456 3300028379 Bacteria 1167
280 Ga0268266_11382874 3300028379 Bacteria 679
281 Ga0268265_10917331 3300028380 Bacteria 861
282 Ga0268264_10845211 3300028381 Bacteria 916
283 Ga0268264_11371793 3300028381 Bacteria 717
284 Ga0307408_100588435 3300031548 Bacteria 987
285 Ga0307405_10587213 3300031731 Bacteria 907
286 Ga0307410_10265144 3300031852 Bacteria 1341
287 Ga0307406_10141826 3300031901 Bacteria 1702
288 Ga0307407_11585490 3300031903 Bacteria 519
289 Ga0307409_100156161 3300031995 Bacteria 1988
290 Ga0307409_100702107 3300031995 Bacteria 1011
291 Ga0307409_102003997 3300031995 Bacteria 608
292 Ga0307416_100674766 3300032002 Bacteria 1120
293 Ga0307414_11385368 3300032004 Bacteria 653
294 Ga0307414_12104080 3300032004 Bacteria 527
295 Ga0307411_10664141 3300032005 Bacteria 904
296 Ga0307415_100013486 3300032126 Bacteria 4772
297 Ga0307415_102280868 3300032126 Bacteria 531
298 Ga0316593_10001783 3300032168 Bacteria 4897
299 Ga0316596_1054341 3300033541 Bacteria 1063
300 Ga0373958_0040603 3300034819 Bacteria 950
301 Ga0373959_0010441 3300034820 Bacteria 1622
302 Ga0373938_0006842 3300034957 Bacteria 1987
303 Ga0373941_0206747 3300035115 Bacteria 749
304 Ga0373960_0099183 3300035121 Bacteria 942
305 Ga0373961_0017389 3300035241 Bacteria 1865
306 Ga0373931_0321681 3300035691 Bacteria 961
307 Ga0436364_0003395 3300037853 Bacteria 885
308 Ga0436364_0118702 3300037853 Bacteria 988
309 Ga0436364_0544274 3300037853 Bacteria 2558
310 Ga0395901_0794794 3300038443 Bacteria 936
311 Ga0395901_1442761 3300038443 Bacteria 646
312 Ga0436365_0037258 3300039437 Bacteria 1370
313 Ga0436365_1874589 3300039437 Bacteria 1674
314 Ga0436361_0400557 3300039447 Bacteria 1180
315 Ga0436363_0464487 3300039450 Bacteria 1263
316 Ga0436363_1416214 3300039450 Bacteria 3509
317 Ga0436362_0385976 3300039453 Bacteria 603
318 Ga0436362_1005958 3300039453 Bacteria 1468
319 Ga0439453_0031811 3300041408 Bacteria 1003
320 Ga0451798_0729566 3300041458 Bacteria 546
321 Ga0439448_0141920 3300042005 Bacteria 831
322 Ga0439463_017891 3300042016 Bacteria 1761
323 Ga0439458_0137443 3300042157 Bacteria 650
324 Ga0439458_0161183 3300042157 Bacteria 604
325 Ga0439444_0001353 3300042437 Bacteria 3151
326 Ga0439459_0016937 3300042438 Bacteria 1352
327 Ga0439464_0012839 3300042439 Bacteria 2235
328 Ga0439460_0083376 3300042461 Bacteria 1006
329 Ga0450916_016697 3300042530 Bacteria 976
330 Ga0451577_0785471 3300042876 Bacteria 860
331 Ga0451577_1233327 3300042876 Unclassified 666
332 Ga0439440_0004989 3300042993 Bacteria 2620
333 Ga0466965_0177336 3300044683 Bacteria 1123
334 Ga0466963_0510753 3300044694 Bacteria 848
335 Ga0466963_0529104 3300044694 Bacteria 832
336 Ga0466964_0169495 3300044706 Bacteria 1027
337 Ga0453684_0024422 3300044712 Bacteria 8837
338 Ga0453684_0263102 3300044712 Bacteria 1975
339 Ga0466971_0017214 3300044719 Bacteria 3195
340 Ga0466968_0187966 3300044735 Bacteria 963
341 Ga0466968_0699692 3300044735 Bacteria 517
342 Ga0466957_0022294 3300044842 Bacteria 3735
343 Ga0466960_0193353 3300044901 Bacteria 1108
344 Ga0466960_0348225 3300044901 Bacteria 844
345 Ga0466967_0002408 3300045976 Bacteria 11613
346 Ga0466967_0051187 3300045976 Bacteria 3618
347 Ga0466967_0126249 3300045976 Bacteria 2370
348 Ga0466967_0729015 3300045976 Bacteria 982
349 Ga0466967_1928233 3300045976 Bacteria 587
350 Ga0495603_0364470 3300046455 Bacteria 829
351 Ga0495603_0465668 3300046455 Bacteria 724
352 Ga0495629_0259033 3300046459 Bacteria 1196
353 Ga0495641_0001140 3300046461 Bacteria 22893
354 Ga0495650_0118374 3300046471 Bacteria 977
355 Ga0495639_0024827 3300046475 Bacteria 2640
356 Ga0495584_0623372 3300046491 Bacteria 550
357 Ga0495596_0116637 3300046500 Bacteria 1037
358 Ga0495596_0292928 3300046500 Bacteria 633
359 Ga0495620_0279381 3300046515 Bacteria 635
360 Ga0495620_0415388 3300046515 Bacteria 509
361 Ga0495630_0101619 3300046517 Bacteria 2175
362 Ga0495631_0131246 3300046518 Bacteria 1076
363 Ga0495631_0245243 3300046518 Bacteria 764
364 Ga0495637_0138191 3300046520 Bacteria 926
365 Ga0495644_0008478 3300046523 Bacteria 3959
366 Ga0495663_0257504 3300046525 Bacteria 621
367 Ga0495621_0109432 3300046539 Bacteria 1058
368 Ga0495656_0001550 3300046615 Bacteria 7511
369 Ga0495647_0407645 3300046681 Bacteria 625
370 Ga0495658_0084667 3300046683 Bacteria 1867
371 Ga0495670_0331157 3300046691 Bacteria 818
372 Ga0495589_0241360 3300046794 Bacteria 846
373 Ga0495660_0195245 3300046810 Bacteria 970
374 Ga0495660_0531558 3300046810 Bacteria 500
375 Ga0495676_0313597 3300047321 Bacteria 1055
376 Ga0495679_132797 3300047446 Bacteria 675
377 Ga0495673_0044963 3300047469 Bacteria 1966
378 Ga0495681_0090380 3300047470 Bacteria 1353
379 Ga0495686_0024116 3300047472 Bacteria 4000
380 Ga0495615_0129325 3300048090 Bacteria 737
381 Ga0496100_0024347 3300048903 Bacteria 3692
382 Ga0496100_0943949 3300048903 Bacteria 678
383 Ga0496100_1646393 3300048903 Bacteria 507
384 Ga0496101_0105540 3300048904 Bacteria 2114
385 Ga0496102_0350186 3300048905 Bacteria 1390
386 Ga0496103_0033834 3300048906 Bacteria 3123
387 Ga0496103_0485089 3300048906 Bacteria 792
388 Ga0496104_0036497 3300048907 Bacteria 4595
389 Ga0496106_0147663 3300048909 Bacteria 1853
390 Ga0496106_0253408 3300048909 Bacteria 1407
391 Ga0496108_0535274 3300048911 Bacteria 1022
392 Ga0496108_0913596 3300048911 Bacteria 753
393 Ga0496109_0169840 3300048912 Bacteria 2045
394 Ga0496109_0319536 3300048912 Bacteria 1465
395 Ga0496110_0164022 3300048913 Bacteria 2014
396 Ga0496111_0306740 3300048914 Bacteria 1176
397 Ga0496111_1100386 3300048914 Bacteria 566
398 Ga0496112_0024276 3300048915 Bacteria 5803
399 Ga0496112_0193955 3300048915 Bacteria 1992
400 Ga0496114_0018473 3300048917 Bacteria 5637
401 Ga0496115_0396386 3300048918 Bacteria 1120
402 Ga0496126_0782510 3300048929 Bacteria 734
403 Ga0501308_007344 3300049128 Bacteria 1151
404 Ga0501307_077270 3300049162 Bacteria 539
405 Ga0501311_052375 3300049527 Bacteria 642
406 Ga0501313_048418 3300049529 Bacteria 584
407 Ga0501315_047515 3300049531 Bacteria 666
408 Ga0501316_014548 3300049532 Bacteria 939
409 Ga0501317_035572 3300049533 Bacteria 741
410 Ga0501320_056629 3300049536 Bacteria 544
411 Ga0501323_019773 3300049539 Bacteria 880
412 Ga0501323_072604 3300049539 Bacteria 552
413 Ga0501031_0045032 3300049568 Bacteria 2879
414 Ga0501034_0817711 3300049571 Bacteria 824
415 Ga0501036_0246032 3300049572 Bacteria 1499
416 Ga0501039_0029293 3300049575 Bacteria 4239
417 Ga0501039_0030233 3300049575 Bacteria 4176
418 Ga0501040_0032136 3300049576 Bacteria 3551
419 Ga0501040_0322773 3300049576 Bacteria 1104
420 Ga0501040_1033279 3300049576 Bacteria 596
421 Ga0501041_0101653 3300049577 Bacteria 1780
422 Ga0501042_0034012 3300049578 Bacteria 3615
423 Ga0501048_0129715 3300049582 Bacteria 1783
424 Ga0501048_0535881 3300049582 Bacteria 840
425 Ga0501067_0242372 3300049583 Bacteria 1003
426 Ga0501069_0760802 3300049585 Bacteria 586
427 Ga0501070_0710045 3300049586 Bacteria 795
428 Ga0501071_0049596 3300049587 Bacteria 3023
429 Ga0501071_0301461 3300049587 Bacteria 1215
430 Ga0501071_0874328 3300049587 Bacteria 693
431 Ga0501072_0025442 3300049588 Bacteria 4611
432 Ga0501074_0605700 3300049590 Bacteria 775
433 Ga0501075_0027042 3300049591 Bacteria 4227
434 Ga0501076_0220909 3300049592 Bacteria 1549
435 Ga0501077_0041863 3300049593 Bacteria 2915
436 Ga0501235_182859 3300049669 Bacteria 560
437 Ga0501079_0111889 3300049741 Bacteria 2122
438 Ga0501079_1440447 3300049741 Bacteria 542
439 Ga0501081_0008282 3300049743 Bacteria 6747
440 Ga0501081_0284546 3300049743 Bacteria 1211
441 Ga0501083_0221065 3300049744 Bacteria 1234
442 Ga0501265_059382 3300049762 Bacteria 621
443 Ga0501045_0053944 3300049824 Bacteria 2938
444 Ga0501045_0296395 3300049824 Bacteria 1203
445 nmdc:mga05p37_2153324_c1 3300050507 Bacteria 520
446 nmdc:mga09592_993514_c1 3300050508 Bacteria 702
447 nmdc:mga08y16_405919_c1 3300050511 Bacteria 604
448 nmdc:mga08y16_618126_c1 3300050511 Bacteria 1091
449 nmdc:mga08y16_954416_c1 3300050511 Bacteria 840
450 nmdc:mga08y16_99536_c1 3300050511 Bacteria 3027
451 nmdc:mga0n895_1387342_c1 3300050512 Bacteria 671
452 nmdc:mga0n895_534040_c1 3300050512 Bacteria 1180
453 nmdc:mga08x19_669366_c1 3300050514 Bacteria 736
454 nmdc:mga0a205_79219_c1 3300050515 Bacteria 3174
455 Ga0495655_0224730 3300053083 Bacteria 623
456 Ga0495655_0329963 3300053083 Bacteria 530
457 Ga0501084_0264729 3300054114 Bacteria 1451
458 Ga0587128_094978 3300059630 Bacteria 617
459 Ga0501082_0265101 3300060353 Bacteria 1495
460 Ga0530510_0015250 3300061734 Bacteria 5427
461 Ga0530510_0142715 3300061734 Bacteria 1765
462 Ga0530510_0899545 3300061734 Bacteria 676
463 Ga0075432_10119430
464 JGI24737J22298_10054083
465 JGI24744J21845_10030275
466 Ga0070676_10425631
467 Ga0070683_100612228
468 Ga0070690_100027868
469 Ga0070670_100570605
470 Ga0070670_101048382
471 Ga0070670_101263052
472 Ga0068869_100296856
473 Ga0070666_10367922
474 Ga0070680_101352385
475 Ga0070682_100345395
476 Ga0070682_100918553
477 Ga0068868_100418775
478 Ga0068868_100487690
479 Ga0068868_101647993
480 Ga0070660_100132763
481 Ga0070660_100259252
482 Ga0070689_100134267
483 Ga0070689_101589120
484 Ga0070689_101716114
485 Ga0070691_10197342
486 Ga0070691_10236268
487 Ga0070691_10239574
488 Ga0070687_100024182
489 Ga0070687_100114439
490 Ga0070661_100449117
491 Ga0070661_100477007
492 Ga0070692_10035876
493 Ga0070692_10285035
494 Ga0070692_10444411
495 Ga0070668_100058208
496 Ga0070668_100600864
497 Ga0070669_100301659
498 Ga0070669_101118934
499 Ga0070675_100128725
500 Ga0070675_100815035
501 Ga0070675_100873657
502 Ga0070674_100365028
503 Ga0070674_100702706
504 Ga0070674_100842564
505 Ga0070659_100163758
506 Ga0070659_100417346
507 Ga0070659_100507454
508 Ga0070659_100781520
509 Ga0070667_101981048
510 Ga0070709_10314302
511 Ga0070710_10264789
512 Ga0070701_10045375
513 Ga0070701_10616124
514 Ga0070700_100169788
515 Ga0070700_100662420
516 Ga0070663_100178784
517 Ga0070663_100347817
518 Ga0070678_100317831
519 Ga0070678_100726438
520 Ga0070662_100020737
521 Ga0070662_100102086
522 Ga0070662_100449349
523 Ga0070662_100627237
524 Ga0068867_100587512
525 Ga0068867_100659945
526 Ga0068867_101537064
527 Ga0070685_10023094
528 Ga0070685_10550376
529 Ga0070684_100247385
530 Ga0070684_100633758
531 Ga0070684_101584265
532 Ga0068853_100363543
533 Ga0068853_100434044
534 Ga0068853_100777993
535 Ga0070672_100119315
536 Ga0070672_100743366
537 Ga0070686_100068990
538 Ga0070695_101123725
539 Ga0070693_100184469
540 Ga0070665_100370697
541 Ga0070665_100395478
542 Ga0070665_100633125
543 Ga0070664_100038200
544 Ga0070664_100104636
545 Ga0068857_100161760
546 Ga0068854_100227579
547 Ga0068854_100529572
548 Ga0068854_100790155
549 Ga0068854_101689748
550 Ga0070702_100100832
551 Ga0070702_100538484
552 Ga0070702_100947254
553 Ga0068852_100058425
554 Ga0068852_100196562
555 Ga0068852_101046764
556 Ga0068852_102047054
557 Ga0068859_101413328
558 Ga0068864_100037025
559 Ga0068866_10036975
560 Ga0068866_10543686
561 Ga0068861_100047582
562 Ga0068861_100391021
563 Ga0068861_101200451
564 Ga0068870_10191781
565 Ga0068870_10197583
566 Ga0068870_10399958
567 Ga0068858_100341259
568 Ga0068858_102002015
569 Ga0068860_102251840
570 Ga0068860_102448935
571 Ga0068862_100321367
572 Ga0068862_100598023
573 Ga0068862_100725660
574 Ga0068862_101546213
575 Ga0081455_10740837
576 Ga0081539_10001787
577 Ga0070717_10245475
578 Ga0070717_10645672
579 Ga0070716_100404467
580 Ga0070712_100012973
581 Ga0075427_10057208
582 Ga0068871_100046531
583 Ga0075428_100977568
584 Ga0075430_101551551
585 Ga0075433_10061451
586 Ga0075434_100623055
587 Ga0068865_100157423
588 Ga0068865_100163859
589 Ga0068865_100188946
590 Ga0068865_100327283
591 Ga0068865_101249948
592 Ga0097620_101413286
593 Ga0105240_11146770
594 Ga0105240_12580268
595 Ga0111539_10124228
596 Ga0111539_10586413
597 Ga0111539_10766501
598 Ga0105245_10539214
599 Ga0105247_10805890
600 Ga0105247_11014332
601 Ga0114129_10221937
602 Ga0114129_11143439
603 Ga0105243_10288439
604 Ga0105243_10728082
605 Ga0105243_11957517
606 Ga0105243_12590005
607 Ga0105242_11217102
608 Ga0105242_11978633
609 Ga0105242_12442316
610 Ga0105248_10490865
611 Ga0105248_10706340
612 Ga0105248_12714911
613 Ga0105237_10037314
614 Ga0105238_10752759
615 Ga0105238_12246810
616 Ga0105238_12866442
617 Ga0105249_11153860
618 Ga0105249_11433252
619 Ga0105249_11827676
620 Ga0105239_11169230
621 Ga0105239_11643593
622 Ga0105246_10544359
623 Ga0105246_11004695
624 Ga0105246_11143062
625 Ga0157347_1010101
626 Ga0157369_10818053
627 Ga0157369_12232763
628 Ga0157374_10618401
629 Ga0157378_12551874
630 Ga0163162_11147202
631 Ga0163162_12735858
632 Ga0157375_10772758
633 Ga0157375_12418087
634 Ga0163163_10278700
635 Ga0157380_10121421
636 Ga0157380_11453778
637 Ga0157380_12025107
638 Ga0157380_12201779
639 Ga0182008_10476104
640 Ga0182008_10537980
641 Ga0157377_10385373
642 Ga0157377_11162710
643 Ga0157379_10668736
644 Ga0157379_11857337
645 Ga0157376_11426850
646 Ga0163161_10166675
647 Ga0163161_10822357
648 Ga0197907_11474715
649 Ga0206350_11553086
650 Ga0213873_10036464
651 Ga0213874_10007273
652 Ga0213876_10219700
653 Ga0213876_10359779
654 Ga0213875_10058618
655 Ga0224712_10232785
656 Ga0207653_10225436
657 Ga0207682_10012598
658 Ga0207710_10272104
659 Ga0207688_10014487
660 Ga0207688_10130830
661 Ga0207680_10473516
662 Ga0207647_10537151
663 Ga0207645_10174002
664 Ga0207643_10241615
665 Ga0207643_10439185
666 Ga0207705_10350804
667 Ga0207671_10507116
668 Ga0207693_10615078
669 Ga0207660_11117003
670 Ga0207662_11081515
671 Ga0207657_10241916
672 Ga0207657_10959581
673 Ga0207649_10949949
674 Ga0207649_11220744
675 Ga0207694_10837351
676 Ga0207650_10207728
677 Ga0207650_10668593
678 Ga0207650_11717988
679 Ga0207659_10877817
680 Ga0207687_10097367
681 Ga0207687_10419134
682 Ga0207690_10055403
683 Ga0207690_10258504
684 Ga0207690_10718278
685 Ga0207706_10317721
686 Ga0207706_10599855
687 Ga0207686_10243278
688 Ga0207686_11118700
689 Ga0207709_10509508
690 Ga0207670_10185941
691 Ga0207670_11047657
692 Ga0207669_10041848
693 Ga0207669_10122368
694 Ga0207669_10198493
695 Ga0207704_10613346
696 Ga0207704_10663315
697 Ga0207704_11079781
698 Ga0207691_10459683
699 Ga0207691_10548028
700 Ga0207711_10289888
701 Ga0207689_10013833
702 Ga0207661_10752331
703 Ga0207679_10073821
704 Ga0207651_10421472
705 Ga0207712_10281407
706 Ga0207712_10510615
707 Ga0207668_10049888
708 Ga0207668_10945444
709 Ga0207658_10148842
710 Ga0207703_11439445
711 Ga0207703_11812139
712 Ga0207639_10100143
713 Ga0207639_10535959
714 Ga0207639_12115803
715 Ga0207678_10176215
716 Ga0207678_10266474
717 Ga0207678_10297105
718 Ga0207678_10456565
719 Ga0207708_10008513
720 Ga0207708_10025712
721 Ga0207708_10737782
722 Ga0207648_10597758
723 Ga0207676_10589020
724 Ga0207676_10984198
725 Ga0207674_10275153
726 Ga0207674_10452676
727 Ga0207674_10641517
728 Ga0207675_100024485
729 Ga0207675_100071876
730 Ga0207675_101450730
731 Ga0207675_101683833
732 Ga0207675_101842584
733 Ga0207683_10025472
734 Ga0207683_10639440
735 Ga0207698_10415523
736 Ga0207698_10804527
737 Ga0207698_11655084
738 Ga0207428_10120383
739 Ga0207428_10128203
740 Ga0207428_11005967
741 Ga0268266_10494456
742 Ga0268266_11382874
743 Ga0268265_10917331
744 Ga0268264_10845211
745 Ga0268264_11371793
746 Ga0307408_100588435
747 Ga0307405_10587213
748 Ga0307410_10265144
749 Ga0307406_10141826
750 Ga0307407_11585490
751 Ga0307409_100156161
752 Ga0307409_100702107
753 Ga0307409_102003997
754 Ga0307416_100674766
755 Ga0307414_11385368
756 Ga0307414_12104080
757 Ga0307411_10664141
758 Ga0307415_100013486
759 Ga0307415_102280868
760 Ga0316593_10001783
761 Ga0316596_1054341
762 Ga0373958_0040603
763 Ga0373959_0010441
764 Ga0373938_0006842
765 Ga0373941_0206747
766 Ga0373960_0099183
767 Ga0373961_0017389
768 Ga0373931_0321681
769 Ga0436364_0003395
770 Ga0436364_0118702
771 Ga0436364_0544274
772 Ga0395901_0794794
773 Ga0395901_1442761
774 Ga0436365_0037258
775 Ga0436365_1874589
776 Ga0436361_0400557
777 Ga0436363_0464487
778 Ga0436363_1416214
779 Ga0436362_0385976
780 Ga0436362_1005958
781 Ga0439453_0031811
782 Ga0451798_0729566
783 Ga0439448_0141920
784 Ga0439463_017891
785 Ga0439458_0137443
786 Ga0439458_0161183
787 Ga0439444_0001353
788 Ga0439459_0016937
789 Ga0439464_0012839
790 Ga0439460_0083376
791 Ga0450916_016697
792 Ga0451577_0785471
793 Ga0451577_1233327
794 Ga0439440_0004989
795 Ga0466965_0177336
796 Ga0466963_0510753
797 Ga0466963_0529104
798 Ga0466964_0169495
799 Ga0453684_0024422
800 Ga0453684_0263102
801 Ga0466971_0017214
802 Ga0466968_0187966
803 Ga0466968_0699692
804 Ga0466957_0022294
805 Ga0466960_0193353
806 Ga0466960_0348225
807 Ga0466967_0002408
808 Ga0466967_0051187
809 Ga0466967_0126249
810 Ga0466967_0729015
811 Ga0466967_1928233
812 Ga0495603_0364470
813 Ga0495603_0465668
814 Ga0495629_0259033
815 Ga0495641_0001140
816 Ga0495650_0118374
817 Ga0495639_0024827
818 Ga0495584_0623372
819 Ga0495596_0116637
820 Ga0495596_0292928
821 Ga0495620_0279381
822 Ga0495620_0415388
823 Ga0495630_0101619
824 Ga0495631_0131246
825 Ga0495631_0245243
826 Ga0495637_0138191
827 Ga0495644_0008478
828 Ga0495663_0257504
829 Ga0495621_0109432
830 Ga0495656_0001550
831 Ga0495647_0407645
832 Ga0495658_0084667
833 Ga0495670_0331157
834 Ga0495589_0241360
835 Ga0495660_0195245
836 Ga0495660_0531558
837 Ga0495676_0313597
838 Ga0495679_132797
839 Ga0495673_0044963
840 Ga0495681_0090380
841 Ga0495686_0024116
842 Ga0495615_0129325
843 Ga0496100_0024347
844 Ga0496100_0943949
845 Ga0496100_1646393
846 Ga0496101_0105540
847 Ga0496102_0350186
848 Ga0496103_0033834
849 Ga0496103_0485089
850 Ga0496104_0036497
851 Ga0496106_0147663
852 Ga0496106_0253408
853 Ga0496108_0535274
854 Ga0496108_0913596
855 Ga0496109_0169840
856 Ga0496109_0319536
857 Ga0496110_0164022
858 Ga0496111_0306740
859 Ga0496111_1100386
860 Ga0496112_0024276
861 Ga0496112_0193955
862 Ga0496114_0018473
863 Ga0496115_0396386
864 Ga0496126_0782510
865 Ga0501308_007344
866 Ga0501307_077270
867 Ga0501311_052375
868 Ga0501313_048418
869 Ga0501315_047515
870 Ga0501316_014548
871 Ga0501317_035572
872 Ga0501320_056629
873 Ga0501323_019773
874 Ga0501323_072604
875 Ga0501031_0045032
876 Ga0501034_0817711
877 Ga0501036_0246032
878 Ga0501039_0029293
879 Ga0501039_0030233
880 Ga0501040_0032136
881 Ga0501040_0322773
882 Ga0501040_1033279
883 Ga0501041_0101653
884 Ga0501042_0034012
885 Ga0501048_0129715
886 Ga0501048_0535881
887 Ga0501067_0242372
888 Ga0501069_0760802
889 Ga0501070_0710045
890 Ga0501071_0049596
891 Ga0501071_0301461
892 Ga0501071_0874328
893 Ga0501072_0025442
894 Ga0501074_0605700
895 Ga0501075_0027042
896 Ga0501076_0220909
897 Ga0501077_0041863
898 Ga0501235_182859
899 Ga0501079_0111889
900 Ga0501079_1440447
901 Ga0501081_0008282
902 Ga0501081_0284546
903 Ga0501083_0221065
904 Ga0501265_059382
905 Ga0501045_0053944
906 Ga0501045_0296395
907 nmdc:mga05p37_2153324_c1
908 nmdc:mga09592_993514_c1
909 nmdc:mga08y16_405919_c1
910 nmdc:mga08y16_618126_c1
911 nmdc:mga08y16_954416_c1
912 nmdc:mga08y16_99536_c1
913 nmdc:mga0n895_1387342_c1
914 nmdc:mga0n895_534040_c1
915 nmdc:mga08x19_669366_c1
916 nmdc:mga0a205_79219_c1
917 Ga0495655_0224730
918 Ga0495655_0329963
919 Ga0501084_0264729
920 Ga0587128_094978
921 Ga0501082_0265101
922 Ga0530510_0015250
923 Ga0530510_0142715
924 Ga0530510_0899545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

6

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fr8-assembly1.cif.gz_D structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.9458 6 117
6ddg-assembly1.cif.gz_a structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9353 6 117
5xym-assembly1.cif.gz_O large subunit of mycobacterium smegmatis 0.934 6 117
6ddg-assembly1.cif.gz_a structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9265 6 117
8cvm-assembly1.cif.gz_n cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9179 1 117
ID Description Score Start End Superfamily
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.973 21 117 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9694 29 117 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9618 21 117 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9408 21 117 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9354 21 117 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A1X6X9C5-F1-model_v4 Large ribosomal subunit protein uL18 0.9837 21 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A068DSK2-F1-model_v4 Large ribosomal subunit protein uL18 0.9698 20 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A6G7TMP3-F1-model_v4 Large ribosomal subunit protein uL18 0.9688 21 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A840DMP2-F1-model_v4 deleted 0.9638 21 117
AF-A0A2M7DRY4-F1-model_v4 Large ribosomal subunit protein uL18 0.9632 21 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map