F448722

General Info

Members Datasets Scaffolds Average Seq Length
461 243 922 121

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11506556|Ga0105241_115065562
Length 134
Sequence VLDPTLNLKPMETVMANPFVHVELNTTDVAKAKAFYGKLFNWKMEDIPMPDFTYTTISVGEGTGGGLLKNPMSGVPSFWLAYVLVDDINAATQKAKSLGAEVVKEVTEVKDMGWLSIIKDPTGAGLGLWKPKSR

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 2.39
Rhizosphere 95.66
Stem 0
Stem Tuber 0
Unclassified 28.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_11506556 3300009174 Unclassified 647
2 Ga0058860_11490257 3300004801 Unclassified 522
3 Ga0065714_10007855 3300005288 Bacteria 2954
4 Ga0065704_10342895 3300005289 Bacteria 807
5 Ga0065715_10008294 3300005293 Bacteria 2885
6 Ga0065715_10181355 3300005293 Unclassified 1474
7 Ga0065715_10777252 3300005293 Bacteria 619
8 Ga0065707_10296856 3300005295 Bacteria 999
9 Ga0065707_10576642 3300005295 Bacteria 704
10 Ga0065707_10786505 3300005295 Bacteria 604
11 Ga0070676_10025820 3300005328 Bacteria 3323
12 Ga0070683_100101506 3300005329 Bacteria 2709
13 Ga0070683_101305931 3300005329 Unclassified 697
14 Ga0070690_100078842 3300005330 Bacteria 2153
15 Ga0070690_101238192 3300005330 Unclassified 596
16 Ga0070690_101245937 3300005330 Unclassified 594
17 Ga0070670_100001903 3300005331 Bacteria 17072
18 Ga0070670_100442400 3300005331 Bacteria 1151
19 Ga0070670_100493615 3300005331 Bacteria 1088
20 Ga0070670_102150763 3300005331 Unclassified 514
21 Ga0068869_100001540 3300005334 Bacteria 13700
22 Ga0068869_100145555 3300005334 Unclassified 1833
23 Ga0068869_100355966 3300005334 Unclassified 1194
24 Ga0068869_100369537 3300005334 Bacteria 1173
25 Ga0070666_10366819 3300005335 Unclassified 1032
26 Ga0070666_11208202 3300005335 Unclassified 563
27 Ga0070680_100028471 3300005336 Bacteria 4481
28 Ga0068868_100072645 3300005338 Bacteria 2745
29 Ga0068868_101442369 3300005338 Bacteria 643
30 Ga0070689_100500932 3300005340 Bacteria 1040
31 Ga0070689_100563242 3300005340 Unclassified 983
32 Ga0070687_100460579 3300005343 Unclassified 848
33 Ga0070687_100573534 3300005343 Bacteria 771
34 Ga0070661_100555359 3300005344 Unclassified 924
35 Ga0070668_100013347 3300005347 Bacteria 6129
36 Ga0070669_100013707 3300005353 Bacteria 5764
37 Ga0070669_100344870 3300005353 Unclassified 1208
38 Ga0070669_100569698 3300005353 Bacteria 946
39 Ga0070675_100067529 3300005354 Bacteria 2959
40 Ga0070675_100149007 3300005354 Bacteria 2005
41 Ga0070675_100799063 3300005354 Unclassified 862
42 Ga0070671_100733473 3300005355 Bacteria 858
43 Ga0070674_101409934 3300005356 Bacteria 624
44 Ga0070673_100015357 3300005364 Bacteria 5376
45 Ga0070673_100260004 3300005364 Bacteria 1516
46 Ga0070673_100549183 3300005364 Bacteria 1049
47 Ga0070688_100071455 3300005365 Unclassified 2222
48 Ga0070659_100474125 3300005366 Bacteria 1064
49 Ga0070714_101075347 3300005435 Bacteria 784
50 Ga0070714_101140670 3300005435 Bacteria 760
51 Ga0070701_11363241 3300005438 Unclassified 509
52 Ga0070705_100153312 3300005440 Bacteria 1531
53 Ga0070705_101749828 3300005440 Unclassified 526
54 Ga0070700_100037188 3300005441 Bacteria 2959
55 Ga0070700_100229253 3300005441 Bacteria 1321
56 Ga0070694_100016680 3300005444 Bacteria 4625
57 Ga0070694_100668438 3300005444 Bacteria 842
58 Ga0070694_101568666 3300005444 Unclassified 558
59 Ga0070708_100120219 3300005445 Bacteria 2423
60 Ga0070708_100483285 3300005445 Unclassified 1168
61 Ga0070708_100544425 3300005445 Unclassified 1095
62 Ga0070708_100548792 3300005445 Bacteria 1090
63 Ga0070678_100421127 3300005456 Bacteria 1164
64 Ga0070678_100969479 3300005456 Bacteria 780
65 Ga0070678_102047187 3300005456 Unclassified 542
66 Ga0070662_100080264 3300005457 Bacteria 2428
67 Ga0070662_100842475 3300005457 Unclassified 781
68 Ga0070662_100897915 3300005457 Bacteria 756
69 Ga0070681_10148427 3300005458 Bacteria 2272
70 Ga0068867_100007253 3300005459 Bacteria 7838
71 Ga0068867_100596057 3300005459 Bacteria 963
72 Ga0068867_100889272 3300005459 Bacteria 801
73 Ga0070706_100051001 3300005467 Bacteria 3817
74 Ga0070706_100122591 3300005467 Bacteria 2423
75 Ga0070706_100356499 3300005467 Unclassified 1363
76 Ga0070706_100488978 3300005467 Bacteria 1145
77 Ga0070707_100065829 3300005468 Bacteria 3482
78 Ga0070707_100205212 3300005468 Bacteria 1921
79 Ga0070707_100363315 3300005468 Unclassified 1406
80 Ga0070707_100643365 3300005468 Unclassified 1023
81 Ga0070707_100662986 3300005468 Unclassified 1006
82 Ga0070707_102352941 3300005468 Unclassified 500
83 Ga0070698_100098015 3300005471 Bacteria 2906
84 Ga0070698_100173657 3300005471 Bacteria 2095
85 Ga0070698_100344446 3300005471 Bacteria 1422
86 Ga0070698_100509776 3300005471 Bacteria 1141
87 Ga0070698_101746558 3300005471 Unclassified 575
88 Ga0070699_100266446 3300005518 Bacteria 1533
89 Ga0070699_100369492 3300005518 Bacteria 1294
90 Ga0070699_100385927 3300005518 Unclassified 1265
91 Ga0070699_101062949 3300005518 Unclassified 742
92 Ga0070699_101746374 3300005518 Bacteria 570
93 Ga0070679_100010869 3300005530 Bacteria 8648
94 Ga0070697_100016648 3300005536 Bacteria 5783
95 Ga0070697_100054232 3300005536 Bacteria 3258
96 Ga0070697_100684960 3300005536 Bacteria 904
97 Ga0070697_100951763 3300005536 Bacteria 763
98 Ga0070697_101183493 3300005536 Unclassified 681
99 Ga0068853_100025063 3300005539 Bacteria 5004
100 Ga0068853_100029182 3300005539 Bacteria 4648
101 Ga0070672_100011061 3300005543 Bacteria 6283
102 Ga0070672_100018917 3300005543 Bacteria 4990
103 Ga0070672_102145128 3300005543 Unclassified 504
104 Ga0070686_100434900 3300005544 Bacteria 1005
105 Ga0070695_100193756 3300005545 Bacteria 1448
106 Ga0070695_100195558 3300005545 Bacteria 1442
107 Ga0070695_100203121 3300005545 Bacteria 1417
108 Ga0070695_100601409 3300005545 Bacteria 863
109 Ga0070696_100234021 3300005546 Bacteria 1383
110 Ga0070696_100703486 3300005546 Bacteria 824
111 Ga0070696_100772104 3300005546 Bacteria 789
112 Ga0070696_100857524 3300005546 Unclassified 751
113 Ga0070696_101675273 3300005546 Unclassified 548
114 Ga0070693_100381299 3300005547 Bacteria 973
115 Ga0070665_100170811 3300005548 Bacteria 2175
116 Ga0070704_100021936 3300005549 Bacteria 4148
117 Ga0070704_100565173 3300005549 Bacteria 995
118 Ga0070704_100663056 3300005549 Unclassified 922
119 Ga0068855_100381409 3300005563 Unclassified 1548
120 Ga0068855_100776020 3300005563 Unclassified 1020
121 Ga0068855_101200969 3300005563 Bacteria 789
122 Ga0070664_101774612 3300005564 Unclassified 585
123 Ga0068857_100040343 3300005577 Bacteria 4139
124 Ga0068857_101600886 3300005577 Bacteria 636
125 Ga0068856_100041719 3300005614 Bacteria 4510
126 Ga0068856_100050698 3300005614 Bacteria 4092
127 Ga0068856_100227161 3300005614 Bacteria 1882
128 Ga0068852_100145591 3300005616 Bacteria 2197
129 Ga0068852_101353012 3300005616 Unclassified 734
130 Ga0068852_102012998 3300005616 Bacteria 600
131 Ga0068859_100001877 3300005617 Bacteria 21389
132 Ga0068859_100017363 3300005617 Bacteria 7228
133 Ga0068859_100025909 3300005617 Bacteria 5884
134 Ga0068864_100000708 3300005618 Bacteria 27982
135 Ga0068864_100063594 3300005618 Bacteria 3198
136 Ga0068861_100055638 3300005719 Unclassified 3018
137 Ga0068861_100886234 3300005719 Bacteria 844
138 Ga0068861_100986601 3300005719 Unclassified 803
139 Ga0068861_101295617 3300005719 Unclassified 708
140 Ga0068870_10012336 3300005840 Bacteria 3991
141 Ga0068863_100003249 3300005841 Bacteria 16070
142 Ga0068863_100325322 3300005841 Bacteria 1494
143 Ga0068863_100406262 3300005841 Unclassified 1333
144 Ga0068863_100896674 3300005841 Bacteria 887
145 Ga0068858_100011867 3300005842 Bacteria 8211
146 Ga0068858_100501834 3300005842 Unclassified 1172
147 Ga0068858_100790628 3300005842 Unclassified 925
148 Ga0068858_101547843 3300005842 Unclassified 654
149 Ga0068860_100003956 3300005843 Bacteria 15221
150 Ga0068860_100061845 3300005843 Unclassified 3558
151 Ga0068860_100949454 3300005843 Bacteria 877
152 Ga0068860_101164427 3300005843 Unclassified 791
153 Ga0068862_100319061 3300005844 Unclassified 1434
154 Ga0068862_100569029 3300005844 Unclassified 1084
155 Ga0068862_100622588 3300005844 Unclassified 1038
156 Ga0081540_1005613 3300005983 Bacteria 9340
157 Ga0081540_1078377 3300005983 Bacteria 1498
158 Ga0075432_10014241 3300006058 Bacteria 2707
159 Ga0070715_10000030 3300006163 Bacteria 88060
160 Ga0070716_100002075 3300006173 Bacteria 9185
161 Ga0075367_10972676 3300006178 Bacteria 542
162 Ga0097621_100995950 3300006237 Bacteria 784
163 Ga0068871_100167086 3300006358 Bacteria 1884
164 Ga0068871_100240338 3300006358 Bacteria 1574
165 Ga0068871_100358641 3300006358 Bacteria 1291
166 Ga0068871_101997177 3300006358 Bacteria 552
167 Ga0075428_102117177 3300006844 Unclassified 581
168 Ga0075433_10160925 3300006852 Bacteria 1998
169 Ga0075434_100159005 3300006871 Bacteria 2279
170 Ga0075434_100299435 3300006871 Bacteria 1629
171 Ga0075429_100461334 3300006880 Unclassified 1113
172 Ga0068865_100823312 3300006881 Unclassified 802
173 Ga0075436_100144911 3300006914 Bacteria 1670
174 Ga0075436_101542959 3300006914 Unclassified 505
175 Ga0097620_100001877 3300006931 Bacteria 21389
176 Ga0097620_100017363 3300006931 Bacteria 7228
177 Ga0097620_100025909 3300006931 Bacteria 5884
178 Ga0075435_100840202 3300007076 Bacteria 800
179 Ga0075435_100899730 3300007076 Unclassified 772
180 Ga0075435_101923153 3300007076 Unclassified 519
181 Ga0099794_10016152 3300007265 Bacteria 3306
182 Ga0105240_10005903 3300009093 Bacteria 18137
183 Ga0105240_10481821 3300009093 Bacteria 1383
184 Ga0105240_10491774 3300009093 Bacteria 1366
185 Ga0111539_10009513 3300009094 Bacteria 12268
186 Ga0111539_10280563 3300009094 Bacteria 1939
187 Ga0105245_10844484 3300009098 Unclassified 955
188 Ga0105245_11710344 3300009098 Bacteria 681
189 Ga0105247_10256230 3300009101 Unclassified 1198
190 Ga0105247_10305510 3300009101 Unclassified 1105
191 Ga0105247_10772339 3300009101 Bacteria 730
192 Ga0114129_10015871 3300009147 Bacteria 10710
193 Ga0114129_10054815 3300009147 Bacteria 5589
194 Ga0114129_11410910 3300009147 Bacteria 859
195 Ga0105243_10095955 3300009148 Bacteria 2452
196 Ga0105243_10420965 3300009148 Unclassified 1246
197 Ga0105241_10110986 3300009174 Bacteria 2195
198 Ga0105241_10411339 3300009174 Bacteria 1188
199 Ga0105242_10024468 3300009176 Bacteria 4769
200 Ga0105242_12586006 3300009176 Bacteria 556
201 Ga0105248_10001079 3300009177 Bacteria 30147
202 Ga0105248_10052302 3300009177 Bacteria 4583
203 Ga0105237_10688315 3300009545 Bacteria 1029
204 Ga0105237_10727442 3300009545 Bacteria 999
205 Ga0105238_10284757 3300009551 Bacteria 1634
206 Ga0105249_10347072 3300009553 Unclassified 1503
207 Ga0105249_12271442 3300009553 Bacteria 615
208 Ga0105249_12643973 3300009553 Unclassified 574
209 Ga0099796_10086458 3300010159 Bacteria 1159
210 Ga0105239_11023385 3300010375 Bacteria 950
211 Ga0105246_10287471 3300011119 Unclassified 1322
212 Ga0105246_11573183 3300011119 Bacteria 620
213 Ga0157373_10060368 3300013100 Bacteria 2687
214 Ga0157370_10903066 3300013104 Bacteria 802
215 Ga0157369_10091690 3300013105 Bacteria 3243
216 Ga0157369_10112997 3300013105 Bacteria 2885
217 Ga0157374_10063545 3300013296 Bacteria 3462
218 Ga0157374_11089187 3300013296 Unclassified 819
219 Ga0157378_10148016 3300013297 Bacteria 2186
220 Ga0157378_10202625 3300013297 Bacteria 1877
221 Ga0157378_10797677 3300013297 Unclassified 970
222 Ga0163162_10955975 3300013306 Bacteria 968
223 Ga0163162_11062593 3300013306 Bacteria 917
224 Ga0163162_12293517 3300013306 Bacteria 620
225 Ga0157372_10134602 3300013307 Bacteria 2845
226 Ga0157372_12805057 3300013307 Bacteria 559
227 Ga0157375_10020465 3300013308 Bacteria 6046
228 Ga0157375_10246816 3300013308 Bacteria 1946
229 Ga0163163_10004785 3300014325 Bacteria 11620
230 Ga0163163_10202829 3300014325 Bacteria 2032
231 Ga0163163_10378430 3300014325 Bacteria 1473
232 Ga0163163_10529853 3300014325 Bacteria 1240
233 Ga0163163_11190425 3300014325 Unclassified 825
234 Ga0163163_11851204 3300014325 Bacteria 664
235 Ga0163163_12175218 3300014325 Bacteria 614
236 Ga0157380_10257514 3300014326 Bacteria 1583
237 Ga0157380_10772875 3300014326 Unclassified 974
238 Ga0157377_10209399 3300014745 Bacteria 1242
239 Ga0157377_10626167 3300014745 Bacteria 771
240 Ga0157379_10001275 3300014968 Bacteria 20475
241 Ga0157379_10109287 3300014968 Bacteria 2483
242 Ga0157379_11070194 3300014968 Bacteria 771
243 Ga0157376_10407096 3300014969 Bacteria 1317
244 Ga0157376_10736786 3300014969 Unclassified 994
245 Ga0197907_10146513 3300020069 Bacteria 590
246 Ga0206356_10354537 3300020070 Bacteria 753
247 Ga0206349_1529913 3300020075 Bacteria 703
248 Ga0206355_1393271 3300020076 Bacteria 642
249 Ga0206351_10731247 3300020077 Bacteria 575
250 Ga0206352_10201302 3300020078 Bacteria 854
251 Ga0206354_11057210 3300020081 Bacteria 544
252 Ga0206353_10956871 3300020082 Bacteria 588
253 Ga0213876_10344538 3300021384 Unclassified 792
254 Ga0213875_10315869 3300021388 Bacteria 740
255 Ga0224712_10468078 3300022467 Bacteria 606
256 Ga0207653_10090599 3300025885 Bacteria 1070
257 Ga0207642_10029996 3300025899 Bacteria 2260
258 Ga0207710_10057252 3300025900 Bacteria 1761
259 Ga0207710_10438884 3300025900 Unclassified 673
260 Ga0207688_10154977 3300025901 Bacteria 1355
261 Ga0207680_11246964 3300025903 Unclassified 530
262 Ga0207685_10000009 3300025905 Bacteria 242842
263 Ga0207699_10297759 3300025906 Bacteria 1126
264 Ga0207699_10417304 3300025906 Bacteria 958
265 Ga0207645_10035832 3300025907 Unclassified 3186
266 Ga0207645_10724122 3300025907 Bacteria 676
267 Ga0207684_10032298 3300025910 Bacteria 4452
268 Ga0207684_10075363 3300025910 Bacteria 2867
269 Ga0207684_10237754 3300025910 Bacteria 1571
270 Ga0207684_10389846 3300025910 Bacteria 1198
271 Ga0207654_10398615 3300025911 Bacteria 956
272 Ga0207695_10241782 3300025913 Bacteria 1706
273 Ga0207695_10896815 3300025913 Unclassified 766
274 Ga0207660_10019066 3300025917 Bacteria 4582
275 Ga0207649_10656367 3300025920 Unclassified 811
276 Ga0207652_11124896 3300025921 Bacteria 686
277 Ga0207646_10056192 3300025922 Bacteria 3519
278 Ga0207646_10067679 3300025922 Bacteria 3188
279 Ga0207646_10069906 3300025922 Bacteria 3136
280 Ga0207646_10173807 3300025922 Bacteria 1945
281 Ga0207646_10458310 3300025922 Bacteria 1150
282 Ga0207646_11505602 3300025922 Unclassified 583
283 Ga0207646_11828904 3300025922 Bacteria 519
284 Ga0207681_10021347 3300025923 Bacteria 4115
285 Ga0207681_11449106 3300025923 Unclassified 576
286 Ga0207650_10034569 3300025925 Bacteria 3666
287 Ga0207650_10836259 3300025925 Unclassified 781
288 Ga0207650_11584870 3300025925 Unclassified 556
289 Ga0207659_10054003 3300025926 Bacteria 2868
290 Ga0207659_10076471 3300025926 Bacteria 2461
291 Ga0207687_11006009 3300025927 Unclassified 715
292 Ga0207706_10098884 3300025933 Bacteria 2567
293 Ga0207706_10154422 3300025933 Bacteria 2019
294 Ga0207706_10733601 3300025933 Bacteria 842
295 Ga0207686_10024624 3300025934 Bacteria 3490
296 Ga0207709_10481786 3300025935 Unclassified 965
297 Ga0207709_11040480 3300025935 Bacteria 670
298 Ga0207670_10422337 3300025936 Bacteria 1070
299 Ga0207669_10008106 3300025937 Bacteria 4913
300 Ga0207665_10000001 3300025939 Bacteria 279842
301 Ga0207665_10179658 3300025939 Unclassified 1532
302 Ga0207665_10309671 3300025939 Bacteria 1183
303 Ga0207691_10018632 3300025940 Bacteria 6577
304 Ga0207691_10024899 3300025940 Bacteria 5624
305 Ga0207691_10223281 3300025940 Bacteria 1633
306 Ga0207691_10908474 3300025940 Bacteria 737
307 Ga0207711_10005821 3300025941 Bacteria 10411
308 Ga0207711_11621762 3300025941 Bacteria 590
309 Ga0207689_10000457 3300025942 Bacteria 38364
310 Ga0207689_10052890 3300025942 Bacteria 3345
311 Ga0207689_10198854 3300025942 Bacteria 1654
312 Ga0207689_10623149 3300025942 Bacteria 908
313 Ga0207661_10071515 3300025944 Bacteria 2835
314 Ga0207667_10112038 3300025949 Unclassified 2814
315 Ga0207651_10089189 3300025960 Bacteria 2250
316 Ga0207651_10266461 3300025960 Bacteria 1409
317 Ga0207651_10694662 3300025960 Bacteria 896
318 Ga0207668_10017296 3300025972 Bacteria 4514
319 Ga0207668_10815476 3300025972 Bacteria 827
320 Ga0207677_10217849 3300026023 Bacteria 1529
321 Ga0207677_10259859 3300026023 Unclassified 1415
322 Ga0207703_10003953 3300026035 Bacteria 12287
323 Ga0207703_10656534 3300026035 Unclassified 995
324 Ga0207703_11215517 3300026035 Unclassified 724
325 Ga0207639_11094759 3300026041 Bacteria 747
326 Ga0207708_10040041 3300026075 Bacteria 3572
327 Ga0207708_10721643 3300026075 Bacteria 853
328 Ga0207708_12004282 3300026075 Unclassified 507
329 Ga0207702_10011771 3300026078 Bacteria 7285
330 Ga0207702_10099917 3300026078 Bacteria 2558
331 Ga0207702_10100275 3300026078 Bacteria 2554
332 Ga0207641_10368100 3300026088 Bacteria 1374
333 Ga0207648_10003647 3300026089 Bacteria 16118
334 Ga0207648_10180565 3300026089 Bacteria 1868
335 Ga0207648_11282690 3300026089 Unclassified 688
336 Ga0207648_11962495 3300026089 Unclassified 547
337 Ga0207676_10228339 3300026095 Bacteria 1662
338 Ga0207676_10714837 3300026095 Unclassified 972
339 Ga0207674_10036569 3300026116 Bacteria 5113
340 Ga0207674_11582826 3300026116 Bacteria 624
341 Ga0207675_100002892 3300026118 Bacteria 16879
342 Ga0207675_100034716 3300026118 Unclassified 4704
343 Ga0207675_100835759 3300026118 Bacteria 935
344 Ga0207683_10350906 3300026121 Bacteria 1354
345 Ga0207683_10402366 3300026121 Bacteria 1260
346 Ga0209588_1023773 3300027671 Bacteria 1933
347 Ga0209974_10033716 3300027876 Bacteria 1699
348 Ga0207428_10005319 3300027907 Bacteria 12002
349 Ga0207428_10926747 3300027907 Unclassified 615
350 Ga0268266_10144256 3300028379 Bacteria 2139
351 Ga0268266_10798358 3300028379 Unclassified 912
352 Ga0268265_10006647 3300028380 Bacteria 7824
353 Ga0268265_10172382 3300028380 Bacteria 1851
354 Ga0268265_10456173 3300028380 Unclassified 1195
355 Ga0268265_10763970 3300028380 Unclassified 939
356 Ga0268264_10002494 3300028381 Bacteria 16181
357 Ga0268264_10117792 3300028381 Bacteria 2336
358 Ga0268264_11051195 3300028381 Unclassified 822
359 Ga0307406_10718798 3300031901 Bacteria 836
360 Ga0307407_11680526 3300031903 Unclassified 505
361 Ga0307409_100392539 3300031995 Unclassified 1323
362 Ga0307414_11486452 3300032004 Bacteria 630
363 Ga0307411_10961595 3300032005 Bacteria 762
364 Ga0307415_100878185 3300032126 Bacteria 825
365 Ga0373926_0054130 3300035083 Bacteria 1453
366 Ga0373951_0275547 3300035091 Unclassified 512
367 Ga0373923_0001287 3300035111 Bacteria 7080
368 Ga0373954_0096562 3300035118 Unclassified 1423
369 Ga0373956_0120932 3300035119 Unclassified 1223
370 Ga0373957_0187530 3300035120 Unclassified 859
371 Ga0373946_0220193 3300035171 Unclassified 916
372 Ga0373955_0123597 3300035172 Unclassified 1506
373 Ga0373931_0778276 3300035691 Bacteria 637
374 Ga0373935_0066259 3300035692 Unclassified 2319
375 Ga0373935_0954265 3300035692 Unclassified 636
376 Ga0373937_0904597 3300036401 Bacteria 831
377 Ga0373937_1058776 3300036401 Bacteria 760
378 Ga0395899_0362272 3300037312 Bacteria 967
379 Ga0395900_0070439 3300037418 Bacteria 3595
380 Ga0395898_0030949 3300037466 Bacteria 5352
381 Ga0436364_1179699 3300037853 Bacteria 3076
382 Ga0395901_0143594 3300038443 Bacteria 2509
383 Ga0436365_0417456 3300039437 Unclassified 807
384 Ga0436360_0298916 3300039438 Bacteria 1054
385 Ga0436360_0446595 3300039438 Unclassified 532
386 Ga0436360_1321160 3300039438 Unclassified 954
387 Ga0436361_0625345 3300039447 Bacteria 734
388 Ga0436363_0686295 3300039450 Unclassified 1205
389 Ga0436363_1567576 3300039450 Bacteria 888
390 Ga0451807_0437444 3300041486 Unclassified 514
391 Ga0439455_0127257 3300042012 Unclassified 717
392 Ga0451577_0958272 3300042876 Bacteria 769
393 Ga0466966_0215782 3300044684 Bacteria 1159
394 Ga0466963_0312233 3300044694 Unclassified 1106
395 Ga0466957_0654046 3300044842 Bacteria 739
396 Ga0451576_2158246 3300045051 Unclassified 572
397 Ga0495592_0191815 3300046454 Bacteria 1384
398 Ga0495651_0000024 3300046462 Bacteria 113645
399 Ga0495651_0069051 3300046462 Bacteria 2692
400 Ga0495653_0026480 3300046463 Unclassified 4649
401 Ga0495653_0227780 3300046463 Archaea 1249
402 Ga0495580_0062458 3300046472 Bacteria 2613
403 Ga0495664_0108392 3300046477 Unclassified 1675
404 Ga0495664_0360861 3300046477 Archaea 874
405 Ga0495608_0044912 3300046511 Bacteria 2947
406 Ga0495608_0050865 3300046511 Bacteria 2748
407 Ga0495608_0675528 3300046511 Archaea 616
408 Ga0495618_0648835 3300046514 Unclassified 624
409 Ga0495628_0018342 3300046516 Bacteria 5798
410 Ga0495663_0307531 3300046525 Bacteria 572
411 Ga0495665_0009051 3300046531 Bacteria 5399
412 Ga0495587_0042674 3300046536 Unclassified 2704
413 Ga0495587_0468970 3300046536 Archaea 697
414 Ga0495645_0192109 3300046543 Archaea 1390
415 Ga0495667_0001158 3300046559 Bacteria 17193
416 Ga0495667_0042410 3300046559 Bacteria 3017
417 Ga0495635_0023490 3300046663 Unclassified 4296
418 Ga0495657_0040971 3300046675 Bacteria 3172
419 Ga0495657_0127065 3300046675 Bacteria 1600
420 Ga0495599_0100453 3300046678 Unclassified 1803
421 Ga0495623_0093594 3300046679 Unclassified 1839
422 Ga0495647_0286523 3300046681 Bacteria 740
423 Ga0495613_0062223 3300046689 Bacteria 2732
424 Ga0495624_0093409 3300046690 Bacteria 1855
425 Ga0495600_0175612 3300046809 Archaea 1381
426 Ga0495674_0049743 3300047319 Bacteria 3702
427 Ga0495674_0571011 3300047319 Unclassified 898
428 Ga0495672_0177510 3300047320 Bacteria 1081
429 Ga0495680_0000188 3300047322 Bacteria 65939
430 Ga0495675_0002670 3300047444 Bacteria 10683
431 Ga0495684_0000552 3300047471 Bacteria 30354
432 Ga0495684_0047415 3300047471 Unclassified 3286
433 Ga0495593_0021660 3300047673 Bacteria 3586
434 Ga0495602_0421202 3300048088 Archaea 948
435 Ga0495602_0432039 3300048088 Unclassified 933
436 Ga0495614_0015511 3300048089 Unclassified 3322
437 Ga0496101_0005781 3300048904 Bacteria 7907
438 Ga0496102_0016827 3300048905 Bacteria 6397
439 Ga0496102_0505099 3300048905 Bacteria 1131
440 Ga0496106_0264778 3300048909 Bacteria 1376
441 Ga0496108_0171016 3300048911 Bacteria 1880
442 Ga0496110_0156545 3300048913 Bacteria 2064
443 Ga0496111_0295633 3300048914 Bacteria 1201
444 Ga0496113_0278047 3300048916 Bacteria 1338
445 Ga0496113_0299594 3300048916 Bacteria 1287
446 Ga0496113_1530506 3300048916 Unclassified 514
447 nmdc:mga06z11_890945_c1 3300050494 Bacteria 542
448 nmdc:mga05p37_12809_c1 3300050507 Bacteria 10026
449 nmdc:mga05p37_302323_c1 3300050507 Bacteria 1900
450 nmdc:mga05p37_49900_c1 3300050507 Bacteria 5147
451 nmdc:mga09592_472992_c1 3300050508 Unclassified 1080
452 nmdc:mga08y16_2007108_c1 3300050511 Bacteria 528
453 nmdc:mga0n895_159562_c1 3300050512 Bacteria 2286
454 nmdc:mga0n895_182158_c1 3300050512 Bacteria 2132
455 nmdc:mga0n895_543395_c1 3300050512 Bacteria 1168
456 nmdc:mga0rr50_1712640_c1 3300050513 Unclassified 530
457 nmdc:mga08x19_69520_c1 3300050514 Bacteria 2293
458 nmdc:mga08x19_765741_c1 3300050514 Bacteria 685
459 nmdc:mga0a205_446160_c1 3300050515 Bacteria 1154
460 nmdc:mga0a205_656565_c1 3300050515 Bacteria 900
461 Ga0495619_0986270 3300053085 Unclassified 564
462 Ga0105241_11506556
463 Ga0058860_11490257
464 Ga0065714_10007855
465 Ga0065704_10342895
466 Ga0065715_10008294
467 Ga0065715_10181355
468 Ga0065715_10777252
469 Ga0065707_10296856
470 Ga0065707_10576642
471 Ga0065707_10786505
472 Ga0070676_10025820
473 Ga0070683_100101506
474 Ga0070683_101305931
475 Ga0070690_100078842
476 Ga0070690_101238192
477 Ga0070690_101245937
478 Ga0070670_100001903
479 Ga0070670_100442400
480 Ga0070670_100493615
481 Ga0070670_102150763
482 Ga0068869_100001540
483 Ga0068869_100145555
484 Ga0068869_100355966
485 Ga0068869_100369537
486 Ga0070666_10366819
487 Ga0070666_11208202
488 Ga0070680_100028471
489 Ga0068868_100072645
490 Ga0068868_101442369
491 Ga0070689_100500932
492 Ga0070689_100563242
493 Ga0070687_100460579
494 Ga0070687_100573534
495 Ga0070661_100555359
496 Ga0070668_100013347
497 Ga0070669_100013707
498 Ga0070669_100344870
499 Ga0070669_100569698
500 Ga0070675_100067529
501 Ga0070675_100149007
502 Ga0070675_100799063
503 Ga0070671_100733473
504 Ga0070674_101409934
505 Ga0070673_100015357
506 Ga0070673_100260004
507 Ga0070673_100549183
508 Ga0070688_100071455
509 Ga0070659_100474125
510 Ga0070714_101075347
511 Ga0070714_101140670
512 Ga0070701_11363241
513 Ga0070705_100153312
514 Ga0070705_101749828
515 Ga0070700_100037188
516 Ga0070700_100229253
517 Ga0070694_100016680
518 Ga0070694_100668438
519 Ga0070694_101568666
520 Ga0070708_100120219
521 Ga0070708_100483285
522 Ga0070708_100544425
523 Ga0070708_100548792
524 Ga0070678_100421127
525 Ga0070678_100969479
526 Ga0070678_102047187
527 Ga0070662_100080264
528 Ga0070662_100842475
529 Ga0070662_100897915
530 Ga0070681_10148427
531 Ga0068867_100007253
532 Ga0068867_100596057
533 Ga0068867_100889272
534 Ga0070706_100051001
535 Ga0070706_100122591
536 Ga0070706_100356499
537 Ga0070706_100488978
538 Ga0070707_100065829
539 Ga0070707_100205212
540 Ga0070707_100363315
541 Ga0070707_100643365
542 Ga0070707_100662986
543 Ga0070707_102352941
544 Ga0070698_100098015
545 Ga0070698_100173657
546 Ga0070698_100344446
547 Ga0070698_100509776
548 Ga0070698_101746558
549 Ga0070699_100266446
550 Ga0070699_100369492
551 Ga0070699_100385927
552 Ga0070699_101062949
553 Ga0070699_101746374
554 Ga0070679_100010869
555 Ga0070697_100016648
556 Ga0070697_100054232
557 Ga0070697_100684960
558 Ga0070697_100951763
559 Ga0070697_101183493
560 Ga0068853_100025063
561 Ga0068853_100029182
562 Ga0070672_100011061
563 Ga0070672_100018917
564 Ga0070672_102145128
565 Ga0070686_100434900
566 Ga0070695_100193756
567 Ga0070695_100195558
568 Ga0070695_100203121
569 Ga0070695_100601409
570 Ga0070696_100234021
571 Ga0070696_100703486
572 Ga0070696_100772104
573 Ga0070696_100857524
574 Ga0070696_101675273
575 Ga0070693_100381299
576 Ga0070665_100170811
577 Ga0070704_100021936
578 Ga0070704_100565173
579 Ga0070704_100663056
580 Ga0068855_100381409
581 Ga0068855_100776020
582 Ga0068855_101200969
583 Ga0070664_101774612
584 Ga0068857_100040343
585 Ga0068857_101600886
586 Ga0068856_100041719
587 Ga0068856_100050698
588 Ga0068856_100227161
589 Ga0068852_100145591
590 Ga0068852_101353012
591 Ga0068852_102012998
592 Ga0068859_100001877
593 Ga0068859_100017363
594 Ga0068859_100025909
595 Ga0068864_100000708
596 Ga0068864_100063594
597 Ga0068861_100055638
598 Ga0068861_100886234
599 Ga0068861_100986601
600 Ga0068861_101295617
601 Ga0068870_10012336
602 Ga0068863_100003249
603 Ga0068863_100325322
604 Ga0068863_100406262
605 Ga0068863_100896674
606 Ga0068858_100011867
607 Ga0068858_100501834
608 Ga0068858_100790628
609 Ga0068858_101547843
610 Ga0068860_100003956
611 Ga0068860_100061845
612 Ga0068860_100949454
613 Ga0068860_101164427
614 Ga0068862_100319061
615 Ga0068862_100569029
616 Ga0068862_100622588
617 Ga0081540_1005613
618 Ga0081540_1078377
619 Ga0075432_10014241
620 Ga0070715_10000030
621 Ga0070716_100002075
622 Ga0075367_10972676
623 Ga0097621_100995950
624 Ga0068871_100167086
625 Ga0068871_100240338
626 Ga0068871_100358641
627 Ga0068871_101997177
628 Ga0075428_102117177
629 Ga0075433_10160925
630 Ga0075434_100159005
631 Ga0075434_100299435
632 Ga0075429_100461334
633 Ga0068865_100823312
634 Ga0075436_100144911
635 Ga0075436_101542959
636 Ga0097620_100001877
637 Ga0097620_100017363
638 Ga0097620_100025909
639 Ga0075435_100840202
640 Ga0075435_100899730
641 Ga0075435_101923153
642 Ga0099794_10016152
643 Ga0105240_10005903
644 Ga0105240_10481821
645 Ga0105240_10491774
646 Ga0111539_10009513
647 Ga0111539_10280563
648 Ga0105245_10844484
649 Ga0105245_11710344
650 Ga0105247_10256230
651 Ga0105247_10305510
652 Ga0105247_10772339
653 Ga0114129_10015871
654 Ga0114129_10054815
655 Ga0114129_11410910
656 Ga0105243_10095955
657 Ga0105243_10420965
658 Ga0105241_10110986
659 Ga0105241_10411339
660 Ga0105242_10024468
661 Ga0105242_12586006
662 Ga0105248_10001079
663 Ga0105248_10052302
664 Ga0105237_10688315
665 Ga0105237_10727442
666 Ga0105238_10284757
667 Ga0105249_10347072
668 Ga0105249_12271442
669 Ga0105249_12643973
670 Ga0099796_10086458
671 Ga0105239_11023385
672 Ga0105246_10287471
673 Ga0105246_11573183
674 Ga0157373_10060368
675 Ga0157370_10903066
676 Ga0157369_10091690
677 Ga0157369_10112997
678 Ga0157374_10063545
679 Ga0157374_11089187
680 Ga0157378_10148016
681 Ga0157378_10202625
682 Ga0157378_10797677
683 Ga0163162_10955975
684 Ga0163162_11062593
685 Ga0163162_12293517
686 Ga0157372_10134602
687 Ga0157372_12805057
688 Ga0157375_10020465
689 Ga0157375_10246816
690 Ga0163163_10004785
691 Ga0163163_10202829
692 Ga0163163_10378430
693 Ga0163163_10529853
694 Ga0163163_11190425
695 Ga0163163_11851204
696 Ga0163163_12175218
697 Ga0157380_10257514
698 Ga0157380_10772875
699 Ga0157377_10209399
700 Ga0157377_10626167
701 Ga0157379_10001275
702 Ga0157379_10109287
703 Ga0157379_11070194
704 Ga0157376_10407096
705 Ga0157376_10736786
706 Ga0197907_10146513
707 Ga0206356_10354537
708 Ga0206349_1529913
709 Ga0206355_1393271
710 Ga0206351_10731247
711 Ga0206352_10201302
712 Ga0206354_11057210
713 Ga0206353_10956871
714 Ga0213876_10344538
715 Ga0213875_10315869
716 Ga0224712_10468078
717 Ga0207653_10090599
718 Ga0207642_10029996
719 Ga0207710_10057252
720 Ga0207710_10438884
721 Ga0207688_10154977
722 Ga0207680_11246964
723 Ga0207685_10000009
724 Ga0207699_10297759
725 Ga0207699_10417304
726 Ga0207645_10035832
727 Ga0207645_10724122
728 Ga0207684_10032298
729 Ga0207684_10075363
730 Ga0207684_10237754
731 Ga0207684_10389846
732 Ga0207654_10398615
733 Ga0207695_10241782
734 Ga0207695_10896815
735 Ga0207660_10019066
736 Ga0207649_10656367
737 Ga0207652_11124896
738 Ga0207646_10056192
739 Ga0207646_10067679
740 Ga0207646_10069906
741 Ga0207646_10173807
742 Ga0207646_10458310
743 Ga0207646_11505602
744 Ga0207646_11828904
745 Ga0207681_10021347
746 Ga0207681_11449106
747 Ga0207650_10034569
748 Ga0207650_10836259
749 Ga0207650_11584870
750 Ga0207659_10054003
751 Ga0207659_10076471
752 Ga0207687_11006009
753 Ga0207706_10098884
754 Ga0207706_10154422
755 Ga0207706_10733601
756 Ga0207686_10024624
757 Ga0207709_10481786
758 Ga0207709_11040480
759 Ga0207670_10422337
760 Ga0207669_10008106
761 Ga0207665_10000001
762 Ga0207665_10179658
763 Ga0207665_10309671
764 Ga0207691_10018632
765 Ga0207691_10024899
766 Ga0207691_10223281
767 Ga0207691_10908474
768 Ga0207711_10005821
769 Ga0207711_11621762
770 Ga0207689_10000457
771 Ga0207689_10052890
772 Ga0207689_10198854
773 Ga0207689_10623149
774 Ga0207661_10071515
775 Ga0207667_10112038
776 Ga0207651_10089189
777 Ga0207651_10266461
778 Ga0207651_10694662
779 Ga0207668_10017296
780 Ga0207668_10815476
781 Ga0207677_10217849
782 Ga0207677_10259859
783 Ga0207703_10003953
784 Ga0207703_10656534
785 Ga0207703_11215517
786 Ga0207639_11094759
787 Ga0207708_10040041
788 Ga0207708_10721643
789 Ga0207708_12004282
790 Ga0207702_10011771
791 Ga0207702_10099917
792 Ga0207702_10100275
793 Ga0207641_10368100
794 Ga0207648_10003647
795 Ga0207648_10180565
796 Ga0207648_11282690
797 Ga0207648_11962495
798 Ga0207676_10228339
799 Ga0207676_10714837
800 Ga0207674_10036569
801 Ga0207674_11582826
802 Ga0207675_100002892
803 Ga0207675_100034716
804 Ga0207675_100835759
805 Ga0207683_10350906
806 Ga0207683_10402366
807 Ga0209588_1023773
808 Ga0209974_10033716
809 Ga0207428_10005319
810 Ga0207428_10926747
811 Ga0268266_10144256
812 Ga0268266_10798358
813 Ga0268265_10006647
814 Ga0268265_10172382
815 Ga0268265_10456173
816 Ga0268265_10763970
817 Ga0268264_10002494
818 Ga0268264_10117792
819 Ga0268264_11051195
820 Ga0307406_10718798
821 Ga0307407_11680526
822 Ga0307409_100392539
823 Ga0307414_11486452
824 Ga0307411_10961595
825 Ga0307415_100878185
826 Ga0373926_0054130
827 Ga0373951_0275547
828 Ga0373923_0001287
829 Ga0373954_0096562
830 Ga0373956_0120932
831 Ga0373957_0187530
832 Ga0373946_0220193
833 Ga0373955_0123597
834 Ga0373931_0778276
835 Ga0373935_0066259
836 Ga0373935_0954265
837 Ga0373937_0904597
838 Ga0373937_1058776
839 Ga0395899_0362272
840 Ga0395900_0070439
841 Ga0395898_0030949
842 Ga0436364_1179699
843 Ga0395901_0143594
844 Ga0436365_0417456
845 Ga0436360_0298916
846 Ga0436360_0446595
847 Ga0436360_1321160
848 Ga0436361_0625345
849 Ga0436363_0686295
850 Ga0436363_1567576
851 Ga0451807_0437444
852 Ga0439455_0127257
853 Ga0451577_0958272
854 Ga0466966_0215782
855 Ga0466963_0312233
856 Ga0466957_0654046
857 Ga0451576_2158246
858 Ga0495592_0191815
859 Ga0495651_0000024
860 Ga0495651_0069051
861 Ga0495653_0026480
862 Ga0495653_0227780
863 Ga0495580_0062458
864 Ga0495664_0108392
865 Ga0495664_0360861
866 Ga0495608_0044912
867 Ga0495608_0050865
868 Ga0495608_0675528
869 Ga0495618_0648835
870 Ga0495628_0018342
871 Ga0495663_0307531
872 Ga0495665_0009051
873 Ga0495587_0042674
874 Ga0495587_0468970
875 Ga0495645_0192109
876 Ga0495667_0001158
877 Ga0495667_0042410
878 Ga0495635_0023490
879 Ga0495657_0040971
880 Ga0495657_0127065
881 Ga0495599_0100453
882 Ga0495623_0093594
883 Ga0495647_0286523
884 Ga0495613_0062223
885 Ga0495624_0093409
886 Ga0495600_0175612
887 Ga0495674_0049743
888 Ga0495674_0571011
889 Ga0495672_0177510
890 Ga0495680_0000188
891 Ga0495675_0002670
892 Ga0495684_0000552
893 Ga0495684_0047415
894 Ga0495593_0021660
895 Ga0495602_0421202
896 Ga0495602_0432039
897 Ga0495614_0015511
898 Ga0496101_0005781
899 Ga0496102_0016827
900 Ga0496102_0505099
901 Ga0496106_0264778
902 Ga0496108_0171016
903 Ga0496110_0156545
904 Ga0496111_0295633
905 Ga0496113_0278047
906 Ga0496113_0299594
907 Ga0496113_1530506
908 nmdc:mga06z11_890945_c1
909 nmdc:mga05p37_12809_c1
910 nmdc:mga05p37_302323_c1
911 nmdc:mga05p37_49900_c1
912 nmdc:mga09592_472992_c1
913 nmdc:mga08y16_2007108_c1
914 nmdc:mga0n895_159562_c1
915 nmdc:mga0n895_182158_c1
916 nmdc:mga0n895_543395_c1
917 nmdc:mga0rr50_1712640_c1
918 nmdc:mga08x19_69520_c1
919 nmdc:mga08x19_765741_c1
920 nmdc:mga0a205_446160_c1
921 nmdc:mga0a205_656565_c1
922 Ga0495619_0986270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

128

0.9

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

18

60

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

21

128

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9102 4 117
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8129 5 119
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8017 4 117
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8011 1 119
8hz9-assembly1.cif.gz_A crystal structure of athppd-y181136 complex 0.7747 3 118
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9202 68 117 3.30.720.110
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8956 1 117 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8952 1 117 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.891 5 116 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8835 8 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2E9MML8-F1-model_v4 Glyoxalase 0.9515 5 119
AF-A0A537DRM5-F1-model_v4 VOC family protein 0.9493 6 119
AF-A0A7C5PS14-F1-model_v4 VOC family protein 0.9491 1 120
AF-A0A2V7YWT0-F1-model_v4 VOC domain-containing protein 0.9491 5 120
AF-A0A7J9YNH9-F1-model_v4 VOC family protein 0.9482 1 119

Map