F448632

General Info

Members Datasets Scaffolds Average Seq Length
460 322 918 392

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_48530_c1|nmdc:mga0sz30_48530_c1_36_1394
Length 452
Sequence MTDEGLHRAVLGGDVESLFEHFGVSSYLHHASTLLGFPQQESLGSEMMKRLLFCSAALAVAAXXAPAPAQQLTDGVVKIGVLTDMSSLYSDINGPGAVIAVQMAIEDFGGTVGGKKIEIVQADVQNKADVAATIAGRWFDTEQVDVILGAGASSSSIATSRVAADKKKIYIAPDPASSDITGKLCNAYTVHWVYDTFALANGTGSAVVKSGGDSWFFLTADYAFGYALQRDVANVVTKAGGKVVGEVKHPINTNDFSSFLLQAQASKAKVIGLANAGGDTINSIKQAAEFGIVKGGQKLAGLLVFVSDVHSLGLERAQGLNLTEAFYWDLNDKTRAFSKRFAAKHNGKMPTSVQAGFYSGALQYLNAVKAANTDNSDAVMTKLKEIKWDDPVFGQSYIRADGRKMHDMYLFEVKKPSESKGPWDYYKLVTKMSAEEAFRPMDQGECPLVKKN

Samples

Sample ID Description Type Environment
1 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
191 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
192 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
193 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
194 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
288 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
289 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
299 2643221569 Achromobacter sp. Root565 Isolate Unclassified
300 2643221585 Pelomonas sp. Root662 Isolate Unclassified
301 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
302 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
303 2643221651 Afipia sp. Root123D2 Isolate Unclassified
304 2643221656 Pelomonas sp. Root405 Isolate Unclassified
305 2738541337 Pelomonas sp. BT06 Isolate Unclassified
306 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
307 2818991467 Bosea vestrisii 3192 Isolate Unclassified
308 2831864461 Roseateles noduli HZ7 Isolate Nodule
309 2842694124 Methylopila sp. R-72369 Isolate Unclassified
310 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
311 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
312 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
313 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
314 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
315 2904699407
316 2906610324
317 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
318 2922425934
319 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
320 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
321 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
322 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.75
Metatranscriptomes 0.22
Isolates 5.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.65
Nodule 1.96
Rhizoplane 3.48
Rhizosphere 68.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0sz30_48530_c1 3300050516 Bacteria 1796
2 JGI24740J21852_10004007 3300001979 Bacteria 6388
3 JGI25165J46597_1005848 3300003214 Bacteria 2281
4 JGI25153J46596_10004425 3300003215 Bacteria 7580
5 rootL2_10003147 3300003322 Bacteria 13037
6 Ga0055525_1000036 3300003759 Bacteria 298878
7 Ga0055524_1000476 3300003775 Bacteria 31968
8 Ga0055524_1005030 3300003775 Bacteria 5984
9 Ga0055540_1012379 3300003792 Bacteria 2681
10 Ga0055531_10003091 3300003794 Bacteria 10752
11 Ga0055531_10013519 3300003794 Bacteria 3755
12 Ga0055531_10018148 3300003794 Bacteria 2921
13 Ga0065712_10077719 3300005290 Bacteria 3442
14 Ga0065715_10103856 3300005293 Bacteria 3003
15 Ga0070676_10009564 3300005328 Bacteria 5236
16 Ga0070670_100041873 3300005331 Bacteria 3936
17 Ga0068869_100007254 3300005334 Bacteria 7065
18 Ga0070680_100014771 3300005336 Bacteria 6108
19 Ga0070682_100011831 3300005337 Bacteria 4992
20 Ga0068868_100066200 3300005338 Bacteria 2872
21 Ga0070660_100001299 3300005339 Bacteria 17019
22 Ga0070660_100068264 3300005339 Bacteria 2771
23 Ga0070689_100014176 3300005340 Bacteria 5786
24 Ga0070661_100002142 3300005344 Bacteria 13609
25 Ga0070692_10000667 3300005345 Bacteria 10947
26 Ga0070668_100142788 3300005347 Bacteria 1931
27 Ga0070688_100058724 3300005365 Bacteria 2423
28 Ga0070659_100000151 3300005366 Bacteria 53009
29 Ga0070659_100029489 3300005366 Bacteria 4241
30 Ga0070659_100047115 3300005366 Bacteria 3380
31 Ga0070667_100136601 3300005367 Bacteria 2144
32 Ga0070714_100056126 3300005435 Bacteria 3368
33 Ga0070714_100255722 3300005435 Bacteria 1621
34 Ga0070713_100054790 3300005436 Bacteria 3310
35 Ga0070713_100073641 3300005436 Bacteria 2891
36 Ga0070710_10042346 3300005437 Bacteria 2517
37 Ga0070711_100003407 3300005439 Bacteria 9262
38 Ga0070711_100085937 3300005439 Bacteria 2254
39 Ga0070711_100095039 3300005439 Bacteria 2156
40 Ga0070705_100165816 3300005440 Bacteria 1481
41 Ga0070700_100125110 3300005441 Bacteria 1728
42 Ga0070694_100000998 3300005444 Bacteria 16064
43 Ga0070663_100003733 3300005455 Bacteria 8830
44 Ga0070678_100074917 3300005456 Bacteria 2545
45 Ga0070681_10037501 3300005458 Bacteria 4863
46 Ga0070681_10038004 3300005458 Bacteria 4827
47 Ga0068867_100004614 3300005459 Bacteria 9695
48 Ga0070707_100169423 3300005468 Bacteria 2128
49 Ga0070698_100000271 3300005471 Bacteria 52585
50 Ga0070699_100029298 3300005518 Bacteria 4746
51 Ga0070679_100042170 3300005530 Bacteria 4544
52 Ga0070679_100097898 3300005530 Bacteria 2921
53 Ga0070697_100103841 3300005536 Bacteria 2363
54 Ga0070697_100138704 3300005536 Bacteria 2044
55 Ga0068853_100000770 3300005539 Bacteria 22242
56 Ga0068853_100004726 3300005539 Bacteria 10574
57 Ga0068853_100009577 3300005539 Bacteria 7806
58 Ga0068853_100026178 3300005539 Bacteria 4898
59 Ga0070672_100008661 3300005543 Bacteria 6974
60 Ga0070695_100025283 3300005545 Bacteria 3666
61 Ga0070696_100006635 3300005546 Bacteria 7732
62 Ga0070693_100000418 3300005547 Bacteria 19261
63 Ga0070704_100000772 3300005549 Bacteria 15796
64 Ga0068855_100001154 3300005563 Bacteria 32715
65 Ga0068855_100020751 3300005563 Bacteria 7879
66 Ga0068855_100033954 3300005563 Bacteria 6085
67 Ga0070664_100002406 3300005564 Bacteria 15035
68 Ga0068857_100016930 3300005577 Bacteria 6386
69 Ga0068854_100001859 3300005578 Bacteria 12861
70 Ga0068854_100014300 3300005578 Bacteria 5230
71 Ga0068856_100003112 3300005614 Bacteria 16941
72 Ga0068856_100008739 3300005614 Bacteria 9855
73 Ga0068856_100238466 3300005614 Bacteria 1834
74 Ga0068852_100003441 3300005616 Bacteria 11061
75 Ga0068852_100038612 3300005616 Bacteria 4015
76 Ga0068852_100106922 3300005616 Bacteria 2537
77 Ga0068859_100006563 3300005617 Bacteria 11808
78 Ga0068864_100005076 3300005618 Bacteria 10783
79 Ga0068861_100214018 3300005719 Bacteria 1625
80 Ga0068861_100303168 3300005719 Bacteria 1385
81 Ga0068870_10000280 3300005840 Bacteria 18887
82 Ga0068863_100036300 3300005841 Bacteria 4695
83 Ga0068858_100020715 3300005842 Bacteria 6143
84 Ga0068860_100031227 3300005843 Bacteria 5121
85 Ga0081455_10002680 3300005937 Bacteria 21036
86 Ga0081455_10019560 3300005937 Bacteria 6402
87 Ga0081455_10057680 3300005937 Bacteria 3290
88 Ga0081455_10062061 3300005937 Bacteria 3143
89 Ga0081455_10259592 3300005937 Bacteria 1266
90 Ga0081539_10003228 3300005985 Bacteria 20567
91 Ga0081539_10018779 3300005985 Bacteria 4772
92 Ga0075363_100028963 3300006048 Bacteria 2854
93 Ga0075364_10046821 3300006051 Bacteria 2816
94 Ga0075364_10108363 3300006051 Bacteria 1853
95 Ga0070715_10001010 3300006163 Bacteria 7916
96 Ga0070715_10081924 3300006163 Bacteria 1467
97 Ga0070712_100205124 3300006175 Bacteria 1551
98 Ga0075362_10002226 3300006177 Bacteria 6448
99 Ga0075367_10011310 3300006178 Bacteria 4716
100 Ga0075367_10079500 3300006178 Bacteria 1982
101 Ga0075369_10014051 3300006186 Bacteria 3192
102 Ga0075366_10006657 3300006195 Bacteria 6340
103 Ga0075366_10094684 3300006195 Bacteria 1790
104 Ga0075370_10035550 3300006353 Bacteria 2796
105 Ga0075434_100050075 3300006871 Bacteria 4149
106 Ga0075436_100065401 3300006914 Bacteria 2514
107 Ga0075436_100091318 3300006914 Bacteria 2117
108 Ga0097620_100006563 3300006931 Bacteria 11808
109 Ga0099823_1000014 3300006944 Bacteria 89398
110 Ga0075435_100048844 3300007076 Bacteria 3401
111 Ga0099795_10055515 3300007788 Bacteria 1455
112 Ga0105240_10008466 3300009093 Bacteria 14712
113 Ga0105240_10011176 3300009093 Bacteria 12531
114 Ga0105243_10038463 3300009148 Bacteria 3725
115 Ga0105241_10000054 3300009174 Bacteria 93205
116 Ga0105241_10007135 3300009174 Bacteria 8224
117 Ga0105248_10012987 3300009177 Bacteria 9180
118 Ga0105237_10003797 3300009545 Bacteria 17750
119 Ga0105238_10017511 3300009551 Bacteria 7285
120 Ga0099796_10021404 3300010159 Bacteria 1991
121 Ga0105239_10175047 3300010375 Bacteria 2400
122 Ga0157319_1000002 3300012497 Bacteria 410803
123 Ga0157373_10001456 3300013100 Bacteria 18090
124 Ga0157371_10037389 3300013102 Bacteria 3474
125 Ga0157371_10084935 3300013102 Bacteria 2243
126 Ga0157370_10012717 3300013104 Bacteria 8711
127 Ga0157370_10017807 3300013104 Bacteria 7159
128 Ga0157369_10000578 3300013105 Bacteria 47949
129 Ga0157369_10029042 3300013105 Bacteria 6114
130 Ga0157369_10229309 3300013105 Bacteria 1942
131 Ga0163162_10167033 3300013306 Bacteria 2324
132 Ga0163162_10205556 3300013306 Bacteria 2098
133 Ga0157372_10002144 3300013307 Bacteria 21446
134 Ga0157372_10003319 3300013307 Bacteria 17386
135 Ga0157372_10102730 3300013307 Bacteria 3265
136 Ga0182008_10049256 3300014497 Bacteria 2091
137 Ga0213872_10000021 3300021361 Bacteria 158749
138 Ga0213872_10000022 3300021361 Bacteria 158011
139 Ga0213872_10000039 3300021361 Bacteria 123507
140 Ga0213872_10002016 3300021361 Bacteria 12335
141 Ga0213872_10056188 3300021361 Bacteria 1783
142 Ga0213876_10005567 3300021384 Bacteria 6912
143 Ga0213875_10001639 3300021388 Bacteria 14135
144 Ga0213875_10003872 3300021388 Bacteria 8382
145 Ga0213875_10009594 3300021388 Bacteria 4893
146 Ga0224712_10073709 3300022467 Bacteria 1393
147 Ga0209563_100014 3300025230 Bacteria 940582
148 Ga0209233_1003495 3300025261 Bacteria 5523
149 Ga0209673_1006890 3300025273 Bacteria 5382
150 Ga0209675_1000652 3300025291 Bacteria 24482
151 Ga0209564_1000401 3300025295 Bacteria 76992
152 Ga0209564_1008028 3300025295 Bacteria 5291
153 Ga0209050_1006526 3300025298 Bacteria 6874
154 Ga0209050_1009563 3300025298 Bacteria 4939
155 Ga0209050_1011194 3300025298 Bacteria 4293
156 Ga0209256_1000236 3300025299 Bacteria 98648
157 Ga0209256_1003758 3300025299 Bacteria 10248
158 Ga0209256_1018820 3300025299 Bacteria 2225
159 Ga0209051_1003840 3300025303 Bacteria 9619
160 Ga0209051_1011836 3300025303 Bacteria 4271
161 Ga0209257_1000016 3300025304 Bacteria 908015
162 Ga0209257_1000393 3300025304 Bacteria 86777
163 Ga0209257_1000723 3300025304 Bacteria 50410
164 Ga0207653_10001520 3300025885 Bacteria 7508
165 Ga0207692_10013122 3300025898 Bacteria 3585
166 Ga0207647_10049731 3300025904 Bacteria 2599
167 Ga0207699_10006503 3300025906 Bacteria 5665
168 Ga0207645_10000059 3300025907 Bacteria 78254
169 Ga0207643_10000014 3300025908 Bacteria 128891
170 Ga0207705_10065605 3300025909 Bacteria 2625
171 Ga0207684_10176828 3300025910 Bacteria 1840
172 Ga0207654_10000152 3300025911 Bacteria 43823
173 Ga0207654_10017742 3300025911 Bacteria 3726
174 Ga0207707_10000138 3300025912 Bacteria 74881
175 Ga0207707_10078153 3300025912 Bacteria 2889
176 Ga0207695_10003119 3300025913 Bacteria 23708
177 Ga0207671_10001858 3300025914 Bacteria 23570
178 Ga0207693_10029345 3300025915 Bacteria 4345
179 Ga0207693_10130057 3300025915 Bacteria 1979
180 Ga0207693_10280403 3300025915 Bacteria 1306
181 Ga0207663_10002043 3300025916 Bacteria 9602
182 Ga0207660_10000848 3300025917 Bacteria 20138
183 Ga0207657_10000135 3300025919 Bacteria 75248
184 Ga0207652_10004746 3300025921 Bacteria 11015
185 Ga0207646_10024080 3300025922 Bacteria 5581
186 Ga0207694_10000106 3300025924 Bacteria 88467
187 Ga0207650_10014879 3300025925 Bacteria 5413
188 Ga0207700_10074348 3300025928 Bacteria 2628
189 Ga0207700_10126776 3300025928 Bacteria 2078
190 Ga0207664_10008979 3300025929 Bacteria 7000
191 Ga0207709_10056926 3300025935 Bacteria 2422
192 Ga0207670_10033916 3300025936 Bacteria 3294
193 Ga0207670_10051821 3300025936 Bacteria 2758
194 Ga0207665_10018296 3300025939 Bacteria 4602
195 Ga0207691_10024412 3300025940 Bacteria 5686
196 Ga0207689_10000340 3300025942 Bacteria 43593
197 Ga0207679_10000212 3300025945 Bacteria 46385
198 Ga0207667_10000296 3300025949 Bacteria 68803
199 Ga0207667_10082531 3300025949 Bacteria 3329
200 Ga0207667_10126935 3300025949 Bacteria 2627
201 Ga0207668_10231455 3300025972 Bacteria 1490
202 Ga0207640_10004722 3300025981 Bacteria 7399
203 Ga0207703_10141088 3300026035 Bacteria 2091
204 Ga0207639_10001773 3300026041 Bacteria 14523
205 Ga0207639_10019515 3300026041 Bacteria 4837
206 Ga0207639_10024481 3300026041 Bacteria 4370
207 Ga0207678_10008386 3300026067 Bacteria 9116
208 Ga0207678_10016463 3300026067 Bacteria 6491
209 Ga0207702_10000004 3300026078 Bacteria 422182
210 Ga0207702_10001150 3300026078 Bacteria 27070
211 Ga0207702_10087052 3300026078 Bacteria 2726
212 Ga0207648_10001239 3300026089 Bacteria 28649
213 Ga0207676_10001946 3300026095 Bacteria 15063
214 Ga0207674_10000684 3300026116 Bacteria 44066
215 Ga0207674_10004810 3300026116 Bacteria 16173
216 Ga0207674_10100592 3300026116 Bacteria 2872
217 Ga0207675_100013598 3300026118 Bacteria 7598
218 Ga0207683_10046872 3300026121 Bacteria 3784
219 Ga0207683_10163213 3300026121 Bacteria 2015
220 Ga0207698_10019126 3300026142 Bacteria 4681
221 Ga0207698_10034278 3300026142 Bacteria 3698
222 Ga0209389_1001254 3300027296 Bacteria 17626
223 Ga0209179_1031579 3300027512 Bacteria 1088
224 Ga0268265_10222553 3300028380 Bacteria 1652
225 Ga0268264_10070544 3300028381 Bacteria 2958
226 Ga0265334_10017782 3300028573 Bacteria 2933
227 Ga0307515_10044801 3300028794 Bacteria 6819
228 Ga0265325_10056708 3300031241 Bacteria 2000
229 Ga0265331_10018875 3300031250 Bacteria 3565
230 Ga0265327_10000266 3300031251 Bacteria 103308
231 Ga0265316_10078242 3300031344 Bacteria 2539
232 Ga0307408_100000039 3300031548 Bacteria 177825
233 Ga0265314_10003835 3300031711 Bacteria 14352
234 Ga0307413_10174711 3300031824 Bacteria 1525
235 Ga0307410_10025806 3300031852 Bacteria 3691
236 Ga0307409_100032337 3300031995 Bacteria 3792
237 Ga0307409_100075580 3300031995 Bacteria 2698
238 Ga0307411_10000159 3300032005 Bacteria 21542
239 Ga0307510_10161790 3300033180 Bacteria 1834
240 Ga0373948_0009486 3300034817 Bacteria 1679
241 Ga0373934_0000354 3300035086 Bacteria 16098
242 Ga0373949_0004036 3300035090 Bacteria 3400
243 Ga0373956_0000015 3300035119 Bacteria 52635
244 Ga0373946_0051803 3300035171 Bacteria 1719
245 Ga0373955_0106984 3300035172 Bacteria 1613
246 Ga0373961_0007877 3300035241 Bacteria 2584
247 Ga0373924_0013787 3300035410 Bacteria 3042
248 Ga0373931_0008185 3300035691 Bacteria 4952
249 Ga0373927_0051775 3300035695 Bacteria 2655
250 Ga0373947_0077059 3300035725 Bacteria 2056
251 Ga0373937_0000182 3300036401 Bacteria 61628
252 Ga0373937_0028789 3300036401 Bacteria 5029
253 Ga0373937_0145264 3300036401 Bacteria 2220
254 Ga0395899_0000102 3300037312 Bacteria 149017
255 Ga0395899_0092164 3300037312 Bacteria 2195
256 Ga0395900_0000067 3300037418 Bacteria 193958
257 Ga0395900_0020296 3300037418 Bacteria 6782
258 Ga0395900_0138982 3300037418 Bacteria 2488
259 Ga0395898_0000214 3300037466 Bacteria 149002
260 Ga0395905_0000060 3300037471 Bacteria 193958
261 Ga0395905_0038449 3300037471 Bacteria 4490
262 Ga0395905_0040243 3300037471 Bacteria 4384
263 Ga0436364_0074250 3300037853 Bacteria 26320
264 Ga0436364_0499356 3300037853 Bacteria 2082
265 Ga0436364_0514631 3300037853 Bacteria 102563
266 Ga0436364_1207831 3300037853 Bacteria 8488
267 Ga0436364_1518622 3300037853 Bacteria 1976
268 Ga0395901_0000063 3300038443 Bacteria 149493
269 Ga0395901_0253864 3300038443 Bacteria 1831
270 Ga0436365_0529078 3300039437 Bacteria 9890
271 Ga0436360_0945100 3300039438 Bacteria 6705
272 Ga0436361_0053631 3300039447 Bacteria 5050
273 Ga0436361_0354255 3300039447 Bacteria 247479
274 Ga0436361_0577165 3300039447 Bacteria 73575
275 Ga0436361_0675000 3300039447 Bacteria 73288
276 Ga0436361_1070817 3300039447 Bacteria 30666
277 Ga0436361_1187303 3300039447 Bacteria 3445
278 Ga0436363_1146452 3300039450 Bacteria 2703
279 Ga0439437_000905 3300042000 Bacteria 3080
280 Ga0439448_0006616 3300042005 Bacteria 3336
281 Ga0439455_0013521 3300042012 Bacteria 1849
282 Ga0450917_000327 3300042120 Bacteria 3545
283 Ga0450888_000542 3300042126 Bacteria 3560
284 Ga0450891_000499 3300042129 Bacteria 4106
285 Ga0450892_000826 3300042130 Bacteria 3406
286 Ga0450889_001496 3300042144 Bacteria 2409
287 Ga0439459_0000131 3300042438 Bacteria 7447
288 Ga0439459_0000155 3300042438 Bacteria 7102
289 Ga0450893_0000157 3300042532 Bacteria 8548
290 Ga0451577_0003247 3300042876 Bacteria 18283
291 Ga0466966_0065690 3300044684 Bacteria 2281
292 Ga0466966_0095182 3300044684 Bacteria 1845
293 Ga0466961_0151867 3300044693 Bacteria 1446
294 Ga0466963_0014048 3300044694 Bacteria 4932
295 Ga0453684_0179776 3300044712 Bacteria 2484
296 Ga0466957_0038288 3300044842 Bacteria 2889
297 Ga0466958_0003150 3300045836 Bacteria 8487
298 Ga0466967_0038179 3300045976 Bacteria 4117
299 Ga0466967_0069854 3300045976 Bacteria 3140
300 Ga0495629_0009196 3300046459 Bacteria 7233
301 Ga0495638_0000399 3300046460 Bacteria 53351
302 Ga0495651_0000027 3300046462 Bacteria 107496
303 Ga0495651_0005758 3300046462 Bacteria 9452
304 Ga0495580_0208923 3300046472 Bacteria 1343
305 Ga0495582_0106193 3300046473 Bacteria 1575
306 Ga0495664_0074462 3300046477 Bacteria 2031
307 Ga0495594_0103277 3300046499 Bacteria 1604
308 Ga0495607_0000757 3300046501 Bacteria 30953
309 Ga0495616_0039198 3300046513 Bacteria 2428
310 Ga0495643_0005167 3300046522 Bacteria 8912
311 Ga0495648_0000325 3300046524 Bacteria 52966
312 Ga0495666_0064287 3300046526 Bacteria 1751
313 Ga0495642_0026405 3300046528 Bacteria 2306
314 Ga0495640_0054849 3300046533 Bacteria 2728
315 Ga0495597_0006107 3300046542 Bacteria 6271
316 Ga0495645_0032716 3300046543 Bacteria 3793
317 Ga0495645_0048039 3300046543 Bacteria 3109
318 Ga0495622_0041175 3300046557 Bacteria 2148
319 Ga0495635_0007187 3300046663 Bacteria 7777
320 Ga0495661_0005157 3300046665 Bacteria 9309
321 Ga0495661_0014837 3300046665 Bacteria 5212
322 Ga0495657_0012808 3300046675 Bacteria 6217
323 Ga0495646_0005175 3300046680 Bacteria 8224
324 Ga0495624_0149799 3300046690 Bacteria 1427
325 Ga0495670_0180312 3300046691 Bacteria 1115
326 Ga0495600_0011456 3300046809 Bacteria 5526
327 Ga0495581_0077321 3300047315 Bacteria 1926
328 Ga0495604_0011181 3300047317 Bacteria 7128
329 Ga0495676_0059492 3300047321 Bacteria 3000
330 Ga0495676_0118332 3300047321 Bacteria 1932
331 Ga0495687_004838 3300047443 Bacteria 8859
332 Ga0495686_0018787 3300047472 Bacteria 4630
333 Ga0495593_0030599 3300047673 Bacteria 2945
334 Ga0495602_0045387 3300048088 Bacteria 3977
335 Ga0495626_0096848 3300048091 Bacteria 1291
336 Ga0496100_0005558 3300048903 Bacteria 6803
337 Ga0496101_0053402 3300048904 Bacteria 2916
338 Ga0496102_0037639 3300048905 Bacteria 4365
339 Ga0496102_0078667 3300048905 Bacteria 3036
340 Ga0496104_0004215 3300048907 Bacteria 12487
341 Ga0496104_0006609 3300048907 Bacteria 10198
342 Ga0496105_0008253 3300048908 Bacteria 8098
343 Ga0496107_0031143 3300048910 Bacteria 3804
344 Ga0496107_0202364 3300048910 Bacteria 1476
345 Ga0496108_0008972 3300048911 Bacteria 8106
346 Ga0496109_0078870 3300048912 Bacteria 3033
347 Ga0496112_0009417 3300048915 Bacteria 8799
348 Ga0496112_0323745 3300048915 Bacteria 1486
349 Ga0496113_0080832 3300048916 Bacteria 2490
350 Ga0496115_0004586 3300048918 Bacteria 10008
351 Ga0496115_0083029 3300048918 Bacteria 2611
352 Ga0496116_0074680 3300048919 Bacteria 2131
353 Ga0496117_0116722 3300048920 Bacteria 1649
354 Ga0496118_0021316 3300048921 Bacteria 5709
355 Ga0496119_0011534 3300048922 Bacteria 7303
356 Ga0496120_0111854 3300048923 Bacteria 1425
357 Ga0496121_0002564 3300048924 Bacteria 27512
358 Ga0496121_0007994 3300048924 Bacteria 12628
359 Ga0496121_0170726 3300048924 Bacteria 1580
360 Ga0496122_0048473 3300048925 Bacteria 3265
361 Ga0496122_0156758 3300048925 Bacteria 1396
362 Ga0496124_0013107 3300048927 Bacteria 8117
363 Ga0496124_0173435 3300048927 Bacteria 1667
364 Ga0496125_0000048 3300048928 Bacteria 290651
365 Ga0496125_0000746 3300048928 Bacteria 53671
366 Ga0496125_0042772 3300048928 Bacteria 3853
367 Ga0496125_0051843 3300048928 Bacteria 3380
368 Ga0496126_0006097 3300048929 Bacteria 13518
369 Ga0496126_0036705 3300048929 Bacteria 4580
370 Ga0496126_0158855 3300048929 Bacteria 1933
371 Ga0496126_0204468 3300048929 Bacteria 1665
372 Ga0501034_0055553 3300049571 Bacteria 3984
373 Ga0501034_0173301 3300049571 Bacteria 2124
374 Ga0501034_0196269 3300049571 Bacteria 1978
375 Ga0501042_0067242 3300049578 Bacteria 2562
376 Ga0501043_0257896 3300049579 Bacteria 1342
377 Ga0501047_0062693 3300049581 Bacteria 3586
378 Ga0501047_0123997 3300049581 Bacteria 2464
379 Ga0501069_0145749 3300049585 Bacteria 1359
380 Ga0501070_0034299 3300049586 Bacteria 4244
381 Ga0501076_0160544 3300049592 Bacteria 1831
382 Ga0501227_002272 3300049665 Bacteria 4248
383 Ga0501079_0113600 3300049741 Bacteria 2105
384 Ga0501079_0198199 3300049741 Bacteria 1568
385 Ga0501080_0101934 3300049742 Bacteria 2663
386 Ga0501081_0141151 3300049743 Bacteria 1726
387 Ga0501035_0124142 3300049822 Bacteria 2255
388 Ga0501044_0117690 3300049823 Bacteria 2661
389 Ga0501044_0401466 3300049823 Bacteria 1283
390 nmdc:mga03683_17879_c1 3300050489 Bacteria 2688
391 nmdc:mga03683_29561_c1 3300050489 Bacteria 2186
392 nmdc:mga03683_3042_c1 3300050489 Bacteria 5317
393 nmdc:mga03683_37496_c1 3300050489 Bacteria 1975
394 nmdc:mga03683_527_c1 3300050489 Bacteria 5175
395 nmdc:mga03n38_3972_c1 3300050490 Bacteria 4830
396 nmdc:mga03n38_70670_c1 3300050490 Bacteria 1615
397 nmdc:mga00v17_109328_c1 3300050491 Bacteria 1752
398 nmdc:mga0yw44_124008_c1 3300050492 Bacteria 1667
399 nmdc:mga0yw44_17336_c1 3300050492 Bacteria 3917
400 nmdc:mga0yw44_73799_c1 3300050492 Bacteria 2123
401 nmdc:mga0k408_106478_c1 3300050493 Bacteria 1656
402 nmdc:mga0k408_6009_c1 3300050493 Bacteria 6478
403 nmdc:mga06z11_25226_c1 3300050494 Bacteria 2815
404 nmdc:mga06z11_38981_c1 3300050494 Bacteria 2363
405 nmdc:mga07m45_13011_c1 3300050496 Bacteria 4403
406 nmdc:mga07m45_1679_c1 3300050496 Bacteria 8400
407 nmdc:mga07m45_38797_c1 3300050496 Bacteria 2660
408 nmdc:mga0n895_42435_c1 3300050512 Bacteria 4425
409 nmdc:mga0rr50_310594_c1 3300050513 Bacteria 1320
410 nmdc:mga0rr50_55503_c1 3300050513 Bacteria 2956
411 nmdc:mga08x19_113807_c1 3300050514 Bacteria 1807
412 nmdc:mga08x19_76962_c1 3300050514 Bacteria 2184
413 nmdc:mga0sz30_5232_c1 3300050516 Bacteria 2838
414 nmdc:mga0sz30_5712_c1 3300050516 Bacteria 4137
415 Ga0495612_0012909 3300053078 Bacteria 3365
416 Ga0500651_0007299 3300053093 Bacteria 6447
417 Ga0500641_0000784 3300053096 Bacteria 11491
418 Ga0500650_0003830 3300053098 Bacteria 5324
419 Ga0500556_0000019 3300053104 Bacteria 186017
420 Ga0500569_001241 3300053109 Bacteria 4750
421 Ga0500592_005263 3300053116 Bacteria 2057
422 Ga0500593_031073 3300053117 Bacteria 2387
423 Ga0500595_038774 3300053119 Bacteria 1546
424 Ga0500568_0000242 3300053139 Bacteria 46479
425 Ga0500568_0001422 3300053139 Bacteria 15533
426 Ga0500586_007700 3300053145 Bacteria 2890
427 Ga0500616_0000059 3300053153 Bacteria 259741
428 Ga0500616_0003033 3300053153 Bacteria 13228
429 Ga0500636_0011421 3300053177 Bacteria 5201
430 Ga0500552_000601 3300053733 Bacteria 3380
431 Ga0501084_0318752 3300054114 Bacteria 1313
432 Ga0590071_004689 3300059421 Bacteria 3302
433 Ga0501082_0026259 3300060353 Bacteria 5018
434 2524538020 2524023228 Bacteria 10118060
435 2643859024 2643221569 Bacteria 6064337
436 2643934795 2643221585 Bacteria 5812563
437 2644220635 2643221639 Bacteria 6649903
438 2644259572 2643221646 Bacteria 6433402
439 2644290683 2643221651 Bacteria 4798932
440 2644316282 2643221656 Bacteria 5809961
441 2739053822 2738541337 Bacteria 6183410
442 2793071734 2791355197 Bacteria 8420563
443 2819721459 2818991467 Bacteria 5893227
444 2831864739 2831864461 Bacteria 6502356
445 2842694733 2842694124 Bacteria 4063419
446 2857580318 2857576091 Bacteria 5465855
447 2885380970 2885374607 Bacteria 8927485
448 2886851840 2886848708 Bacteria 5632523
449 2891636793 2891633521 Bacteria 4602265
450 2897808538 2897803580 Bacteria 7000062
451 2904701626
452 2906610394
453 2908743915 2908739725 Bacteria 8628932
454 2922428967
455 2939634396 2939631187 Bacteria 6118131
456 2939634397 2939631187 Bacteria 6118131
457 8019557962 8019555841 Bacteria 9642137
458 8019567324 8019565922 Bacteria 9639779
459 8057533927 8057529695 Bacteria 6306553
460 nmdc:mga0sz30_48530_c1
461 JGI24740J21852_10004007
462 JGI25165J46597_1005848
463 JGI25153J46596_10004425
464 rootL2_10003147
465 Ga0055525_1000036
466 Ga0055524_1000476
467 Ga0055524_1005030
468 Ga0055540_1012379
469 Ga0055531_10003091
470 Ga0055531_10013519
471 Ga0055531_10018148
472 Ga0065712_10077719
473 Ga0065715_10103856
474 Ga0070676_10009564
475 Ga0070670_100041873
476 Ga0068869_100007254
477 Ga0070680_100014771
478 Ga0070682_100011831
479 Ga0068868_100066200
480 Ga0070660_100001299
481 Ga0070660_100068264
482 Ga0070689_100014176
483 Ga0070661_100002142
484 Ga0070692_10000667
485 Ga0070668_100142788
486 Ga0070688_100058724
487 Ga0070659_100000151
488 Ga0070659_100029489
489 Ga0070659_100047115
490 Ga0070667_100136601
491 Ga0070714_100056126
492 Ga0070714_100255722
493 Ga0070713_100054790
494 Ga0070713_100073641
495 Ga0070710_10042346
496 Ga0070711_100003407
497 Ga0070711_100085937
498 Ga0070711_100095039
499 Ga0070705_100165816
500 Ga0070700_100125110
501 Ga0070694_100000998
502 Ga0070663_100003733
503 Ga0070678_100074917
504 Ga0070681_10037501
505 Ga0070681_10038004
506 Ga0068867_100004614
507 Ga0070707_100169423
508 Ga0070698_100000271
509 Ga0070699_100029298
510 Ga0070679_100042170
511 Ga0070679_100097898
512 Ga0070697_100103841
513 Ga0070697_100138704
514 Ga0068853_100000770
515 Ga0068853_100004726
516 Ga0068853_100009577
517 Ga0068853_100026178
518 Ga0070672_100008661
519 Ga0070695_100025283
520 Ga0070696_100006635
521 Ga0070693_100000418
522 Ga0070704_100000772
523 Ga0068855_100001154
524 Ga0068855_100020751
525 Ga0068855_100033954
526 Ga0070664_100002406
527 Ga0068857_100016930
528 Ga0068854_100001859
529 Ga0068854_100014300
530 Ga0068856_100003112
531 Ga0068856_100008739
532 Ga0068856_100238466
533 Ga0068852_100003441
534 Ga0068852_100038612
535 Ga0068852_100106922
536 Ga0068859_100006563
537 Ga0068864_100005076
538 Ga0068861_100214018
539 Ga0068861_100303168
540 Ga0068870_10000280
541 Ga0068863_100036300
542 Ga0068858_100020715
543 Ga0068860_100031227
544 Ga0081455_10002680
545 Ga0081455_10019560
546 Ga0081455_10057680
547 Ga0081455_10062061
548 Ga0081455_10259592
549 Ga0081539_10003228
550 Ga0081539_10018779
551 Ga0075363_100028963
552 Ga0075364_10046821
553 Ga0075364_10108363
554 Ga0070715_10001010
555 Ga0070715_10081924
556 Ga0070712_100205124
557 Ga0075362_10002226
558 Ga0075367_10011310
559 Ga0075367_10079500
560 Ga0075369_10014051
561 Ga0075366_10006657
562 Ga0075366_10094684
563 Ga0075370_10035550
564 Ga0075434_100050075
565 Ga0075436_100065401
566 Ga0075436_100091318
567 Ga0097620_100006563
568 Ga0099823_1000014
569 Ga0075435_100048844
570 Ga0099795_10055515
571 Ga0105240_10008466
572 Ga0105240_10011176
573 Ga0105243_10038463
574 Ga0105241_10000054
575 Ga0105241_10007135
576 Ga0105248_10012987
577 Ga0105237_10003797
578 Ga0105238_10017511
579 Ga0099796_10021404
580 Ga0105239_10175047
581 Ga0157319_1000002
582 Ga0157373_10001456
583 Ga0157371_10037389
584 Ga0157371_10084935
585 Ga0157370_10012717
586 Ga0157370_10017807
587 Ga0157369_10000578
588 Ga0157369_10029042
589 Ga0157369_10229309
590 Ga0163162_10167033
591 Ga0163162_10205556
592 Ga0157372_10002144
593 Ga0157372_10003319
594 Ga0157372_10102730
595 Ga0182008_10049256
596 Ga0213872_10000021
597 Ga0213872_10000022
598 Ga0213872_10000039
599 Ga0213872_10002016
600 Ga0213872_10056188
601 Ga0213876_10005567
602 Ga0213875_10001639
603 Ga0213875_10003872
604 Ga0213875_10009594
605 Ga0224712_10073709
606 Ga0209563_100014
607 Ga0209233_1003495
608 Ga0209673_1006890
609 Ga0209675_1000652
610 Ga0209564_1000401
611 Ga0209564_1008028
612 Ga0209050_1006526
613 Ga0209050_1009563
614 Ga0209050_1011194
615 Ga0209256_1000236
616 Ga0209256_1003758
617 Ga0209256_1018820
618 Ga0209051_1003840
619 Ga0209051_1011836
620 Ga0209257_1000016
621 Ga0209257_1000393
622 Ga0209257_1000723
623 Ga0207653_10001520
624 Ga0207692_10013122
625 Ga0207647_10049731
626 Ga0207699_10006503
627 Ga0207645_10000059
628 Ga0207643_10000014
629 Ga0207705_10065605
630 Ga0207684_10176828
631 Ga0207654_10000152
632 Ga0207654_10017742
633 Ga0207707_10000138
634 Ga0207707_10078153
635 Ga0207695_10003119
636 Ga0207671_10001858
637 Ga0207693_10029345
638 Ga0207693_10130057
639 Ga0207693_10280403
640 Ga0207663_10002043
641 Ga0207660_10000848
642 Ga0207657_10000135
643 Ga0207652_10004746
644 Ga0207646_10024080
645 Ga0207694_10000106
646 Ga0207650_10014879
647 Ga0207700_10074348
648 Ga0207700_10126776
649 Ga0207664_10008979
650 Ga0207709_10056926
651 Ga0207670_10033916
652 Ga0207670_10051821
653 Ga0207665_10018296
654 Ga0207691_10024412
655 Ga0207689_10000340
656 Ga0207679_10000212
657 Ga0207667_10000296
658 Ga0207667_10082531
659 Ga0207667_10126935
660 Ga0207668_10231455
661 Ga0207640_10004722
662 Ga0207703_10141088
663 Ga0207639_10001773
664 Ga0207639_10019515
665 Ga0207639_10024481
666 Ga0207678_10008386
667 Ga0207678_10016463
668 Ga0207702_10000004
669 Ga0207702_10001150
670 Ga0207702_10087052
671 Ga0207648_10001239
672 Ga0207676_10001946
673 Ga0207674_10000684
674 Ga0207674_10004810
675 Ga0207674_10100592
676 Ga0207675_100013598
677 Ga0207683_10046872
678 Ga0207683_10163213
679 Ga0207698_10019126
680 Ga0207698_10034278
681 Ga0209389_1001254
682 Ga0209179_1031579
683 Ga0268265_10222553
684 Ga0268264_10070544
685 Ga0265334_10017782
686 Ga0307515_10044801
687 Ga0265325_10056708
688 Ga0265331_10018875
689 Ga0265327_10000266
690 Ga0265316_10078242
691 Ga0307408_100000039
692 Ga0265314_10003835
693 Ga0307413_10174711
694 Ga0307410_10025806
695 Ga0307409_100032337
696 Ga0307409_100075580
697 Ga0307411_10000159
698 Ga0307510_10161790
699 Ga0373948_0009486
700 Ga0373934_0000354
701 Ga0373949_0004036
702 Ga0373956_0000015
703 Ga0373946_0051803
704 Ga0373955_0106984
705 Ga0373961_0007877
706 Ga0373924_0013787
707 Ga0373931_0008185
708 Ga0373927_0051775
709 Ga0373947_0077059
710 Ga0373937_0000182
711 Ga0373937_0028789
712 Ga0373937_0145264
713 Ga0395899_0000102
714 Ga0395899_0092164
715 Ga0395900_0000067
716 Ga0395900_0020296
717 Ga0395900_0138982
718 Ga0395898_0000214
719 Ga0395905_0000060
720 Ga0395905_0038449
721 Ga0395905_0040243
722 Ga0436364_0074250
723 Ga0436364_0499356
724 Ga0436364_0514631
725 Ga0436364_1207831
726 Ga0436364_1518622
727 Ga0395901_0000063
728 Ga0395901_0253864
729 Ga0436365_0529078
730 Ga0436360_0945100
731 Ga0436361_0053631
732 Ga0436361_0354255
733 Ga0436361_0577165
734 Ga0436361_0675000
735 Ga0436361_1070817
736 Ga0436361_1187303
737 Ga0436363_1146452
738 Ga0439437_000905
739 Ga0439448_0006616
740 Ga0439455_0013521
741 Ga0450917_000327
742 Ga0450888_000542
743 Ga0450891_000499
744 Ga0450892_000826
745 Ga0450889_001496
746 Ga0439459_0000131
747 Ga0439459_0000155
748 Ga0450893_0000157
749 Ga0451577_0003247
750 Ga0466966_0065690
751 Ga0466966_0095182
752 Ga0466961_0151867
753 Ga0466963_0014048
754 Ga0453684_0179776
755 Ga0466957_0038288
756 Ga0466958_0003150
757 Ga0466967_0038179
758 Ga0466967_0069854
759 Ga0495629_0009196
760 Ga0495638_0000399
761 Ga0495651_0000027
762 Ga0495651_0005758
763 Ga0495580_0208923
764 Ga0495582_0106193
765 Ga0495664_0074462
766 Ga0495594_0103277
767 Ga0495607_0000757
768 Ga0495616_0039198
769 Ga0495643_0005167
770 Ga0495648_0000325
771 Ga0495666_0064287
772 Ga0495642_0026405
773 Ga0495640_0054849
774 Ga0495597_0006107
775 Ga0495645_0032716
776 Ga0495645_0048039
777 Ga0495622_0041175
778 Ga0495635_0007187
779 Ga0495661_0005157
780 Ga0495661_0014837
781 Ga0495657_0012808
782 Ga0495646_0005175
783 Ga0495624_0149799
784 Ga0495670_0180312
785 Ga0495600_0011456
786 Ga0495581_0077321
787 Ga0495604_0011181
788 Ga0495676_0059492
789 Ga0495676_0118332
790 Ga0495687_004838
791 Ga0495686_0018787
792 Ga0495593_0030599
793 Ga0495602_0045387
794 Ga0495626_0096848
795 Ga0496100_0005558
796 Ga0496101_0053402
797 Ga0496102_0037639
798 Ga0496102_0078667
799 Ga0496104_0004215
800 Ga0496104_0006609
801 Ga0496105_0008253
802 Ga0496107_0031143
803 Ga0496107_0202364
804 Ga0496108_0008972
805 Ga0496109_0078870
806 Ga0496112_0009417
807 Ga0496112_0323745
808 Ga0496113_0080832
809 Ga0496115_0004586
810 Ga0496115_0083029
811 Ga0496116_0074680
812 Ga0496117_0116722
813 Ga0496118_0021316
814 Ga0496119_0011534
815 Ga0496120_0111854
816 Ga0496121_0002564
817 Ga0496121_0007994
818 Ga0496121_0170726
819 Ga0496122_0048473
820 Ga0496122_0156758
821 Ga0496124_0013107
822 Ga0496124_0173435
823 Ga0496125_0000048
824 Ga0496125_0000746
825 Ga0496125_0042772
826 Ga0496125_0051843
827 Ga0496126_0006097
828 Ga0496126_0036705
829 Ga0496126_0158855
830 Ga0496126_0204468
831 Ga0501034_0055553
832 Ga0501034_0173301
833 Ga0501034_0196269
834 Ga0501042_0067242
835 Ga0501043_0257896
836 Ga0501047_0062693
837 Ga0501047_0123997
838 Ga0501069_0145749
839 Ga0501070_0034299
840 Ga0501076_0160544
841 Ga0501227_002272
842 Ga0501079_0113600
843 Ga0501079_0198199
844 Ga0501080_0101934
845 Ga0501081_0141151
846 Ga0501035_0124142
847 Ga0501044_0117690
848 Ga0501044_0401466
849 nmdc:mga03683_17879_c1
850 nmdc:mga03683_29561_c1
851 nmdc:mga03683_3042_c1
852 nmdc:mga03683_37496_c1
853 nmdc:mga03683_527_c1
854 nmdc:mga03n38_3972_c1
855 nmdc:mga03n38_70670_c1
856 nmdc:mga00v17_109328_c1
857 nmdc:mga0yw44_124008_c1
858 nmdc:mga0yw44_17336_c1
859 nmdc:mga0yw44_73799_c1
860 nmdc:mga0k408_106478_c1
861 nmdc:mga0k408_6009_c1
862 nmdc:mga06z11_25226_c1
863 nmdc:mga06z11_38981_c1
864 nmdc:mga07m45_13011_c1
865 nmdc:mga07m45_1679_c1
866 nmdc:mga07m45_38797_c1
867 nmdc:mga0n895_42435_c1
868 nmdc:mga0rr50_310594_c1
869 nmdc:mga0rr50_55503_c1
870 nmdc:mga08x19_113807_c1
871 nmdc:mga08x19_76962_c1
872 nmdc:mga0sz30_5232_c1
873 nmdc:mga0sz30_5712_c1
874 Ga0495612_0012909
875 Ga0500651_0007299
876 Ga0500641_0000784
877 Ga0500650_0003830
878 Ga0500556_0000019
879 Ga0500569_001241
880 Ga0500592_005263
881 Ga0500593_031073
882 Ga0500595_038774
883 Ga0500568_0000242
884 Ga0500568_0001422
885 Ga0500586_007700
886 Ga0500616_0000059
887 Ga0500616_0003033
888 Ga0500636_0011421
889 Ga0500552_000601
890 Ga0501084_0318752
891 Ga0590071_004689
892 Ga0501082_0026259
893 2524538020
894 2643859024
895 2643934795
896 2644220635
897 2644259572
898 2644290683
899 2644316282
900 2739053822
901 2793071734
902 2819721459
903 2831864739
904 2842694733
905 2857580318
906 2885380970
907 2886851840
908 2891636793
909 2897808538
910 2904701626
911 2906610394
912 2908743915
913 2922428967
914 2939634396
915 2939634397
916 8019557962
917 8019567324
918 8057533927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

76

421

0.97

PF13433

Peripla_BP_5

Periplasmic binding protein domain

200

421

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9859 23 388
3i09-assembly2.cif.gz_B crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution 0.9598 23 388
4eyk-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid 0.9183 23 383
4maa-assembly1.cif.gz_A the crystal structure of amino acid abc transporter substrate-binding protein from pseudomonas fluorescens pf-5 0.9122 22 389
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.9056 22 379
ID Description Score Start End Superfamily
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9873 145 274 3.40.50.2300
3i09B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9721 145 274 3.40.50.2300
3i09A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9558 23 351 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9359 70 128 3.40.50.2300
3n0wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9248 23 351 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2U3I2U5-F1-model_v4 Branched-chain amino acid ABC transporter periplasmic branched-chain amino acid-binding protein 0.9717 158 384 GO:0016020
AF-A0A0M2DJM8-F1-model_v4 ABC transporter permease 0.9684 10 388
AF-A0A6G8TYN6-F1-model_v4 ABC transporter substrate-binding protein 0.9664 14 393 GO:0006865
AF-A0A0E4FT91-F1-model_v4 Substrate-binding protein 0.9611 16 355 GO:0006865
AF-A0A645D239-F1-model_v4 Leucine-binding protein domain-containing protein 0.9554 192 393

Map