F448517

General Info

Members Datasets Scaffolds Average Seq Length
460 248 920 259

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10005277|Ga0075366_100052775
Length 290
Sequence MQGDLLDRVLPEGRDAQVNIGSGVNKELIDLDKVGMTYEAASGPVEALADITLKVGAGEFVSLVGPSGCGKSTLLRIVAGLRPATLGTVVVAGQAVTRPIPDIGMVFQAPVLLKWRTILDNVLLPAELAGREVLPLRARARQLLEMAGLSGFETKLPRELSGGMQQRAALCRALLLDPPLLLMDEPFGALDAMTRDDMALELLRIWGDATGGPDAVRKTVLFVTHSIPEAVFLSDRVVVMTPRPGRIAADLRIELPRPRTVEMRASETFGRLNLEIFRRLTGRTDASGLA

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
243 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.87
Nodule 0
Rhizoplane 1.74
Rhizosphere 92.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10005277 3300006195 Bacteria 7001
2 JGI26129J50193_1001896 3300003349 Bacteria 1454
3 Ga0065707_10008766 3300005295 Bacteria 2616
4 Ga0070658_10012423 3300005327 Bacteria 6832
5 Ga0070676_10000494 3300005328 Bacteria 18771
6 Ga0070676_10028380 3300005328 Bacteria 3178
7 Ga0070683_100020136 3300005329 Bacteria 5935
8 Ga0070690_100055992 3300005330 Bacteria 2527
9 Ga0070670_100003877 3300005331 Bacteria 12476
10 Ga0070677_10023568 3300005333 Bacteria 2280
11 Ga0068869_100000633 3300005334 Bacteria 19871
12 Ga0068869_100042258 3300005334 Bacteria 3268
13 Ga0070666_10083700 3300005335 Bacteria 2183
14 Ga0070680_100000096 3300005336 Bacteria 50255
15 Ga0070680_100002706 3300005336 Bacteria 13145
16 Ga0070680_100113813 3300005336 Bacteria 2254
17 Ga0070682_100000209 3300005337 Bacteria 42875
18 Ga0070689_100131156 3300005340 Bacteria 2010
19 Ga0070689_100183987 3300005340 Bacteria 1698
20 Ga0070691_10069329 3300005341 Bacteria 1709
21 Ga0070687_100002533 3300005343 Bacteria 6883
22 Ga0070661_100001130 3300005344 Bacteria 18750
23 Ga0070661_100037082 3300005344 Bacteria 3546
24 Ga0070692_10011911 3300005345 Bacteria 4010
25 Ga0070669_100006777 3300005353 Bacteria 8243
26 Ga0070669_100213356 3300005353 Bacteria 1524
27 Ga0070669_100264454 3300005353 Bacteria 1374
28 Ga0070675_100030317 3300005354 Bacteria 4366
29 Ga0070671_100083408 3300005355 Bacteria 2672
30 Ga0070674_100035233 3300005356 Bacteria 3351
31 Ga0070673_100012037 3300005364 Bacteria 5926
32 Ga0070673_100094975 3300005364 Bacteria 2445
33 Ga0070659_100001542 3300005366 Bacteria 16598
34 Ga0070667_100186857 3300005367 Bacteria 1834
35 Ga0070703_10004269 3300005406 Bacteria 4025
36 Ga0070709_10089607 3300005434 Bacteria 2026
37 Ga0070713_100035201 3300005436 Bacteria 4029
38 Ga0070705_100007991 3300005440 Bacteria 5228
39 Ga0070705_100055265 3300005440 Bacteria 2333
40 Ga0070694_100012207 3300005444 Bacteria 5338
41 Ga0070694_100016717 3300005444 Bacteria 4620
42 Ga0070694_100034305 3300005444 Bacteria 3346
43 Ga0070694_100173766 3300005444 Bacteria 1589
44 Ga0070694_100378630 3300005444 Bacteria 1103
45 Ga0070708_100003818 3300005445 Bacteria 11822
46 Ga0070708_100059482 3300005445 Bacteria 3406
47 Ga0070708_100078365 3300005445 Bacteria 2987
48 Ga0070708_100513952 3300005445 Bacteria 1130
49 Ga0070678_100012306 3300005456 Bacteria 5313
50 Ga0070662_100001288 3300005457 Bacteria 15415
51 Ga0070681_10009396 3300005458 Bacteria 9622
52 Ga0070681_10016376 3300005458 Bacteria 7401
53 Ga0068867_100004608 3300005459 Bacteria 9701
54 Ga0068867_100005185 3300005459 Bacteria 9193
55 Ga0068867_100005897 3300005459 Bacteria 8692
56 Ga0068867_100086463 3300005459 Bacteria 2372
57 Ga0068867_100168447 3300005459 Bacteria 1733
58 Ga0070706_100072981 3300005467 Bacteria 3176
59 Ga0070706_100074867 3300005467 Bacteria 3133
60 Ga0070707_100035272 3300005468 Bacteria 4772
61 Ga0070707_100056959 3300005468 Bacteria 3750
62 Ga0070707_100063081 3300005468 Bacteria 3556
63 Ga0070707_100063987 3300005468 Bacteria 3530
64 Ga0070698_100006487 3300005471 Bacteria 12691
65 Ga0070698_100015090 3300005471 Bacteria 8167
66 Ga0070698_100035068 3300005471 Bacteria 5188
67 Ga0070698_100559636 3300005471 Bacteria 1083
68 Ga0070699_100036365 3300005518 Bacteria 4260
69 Ga0070699_100036794 3300005518 Bacteria 4234
70 Ga0070699_100143471 3300005518 Bacteria 2110
71 Ga0070699_100152004 3300005518 Bacteria 2048
72 Ga0070699_100465928 3300005518 Bacteria 1146
73 Ga0070679_100007108 3300005530 Bacteria 10447
74 Ga0070679_100085092 3300005530 Bacteria 3149
75 Ga0070697_100013533 3300005536 Bacteria 6399
76 Ga0070697_100027058 3300005536 Bacteria 4586
77 Ga0070697_100102452 3300005536 Bacteria 2379
78 Ga0070697_100129043 3300005536 Bacteria 2119
79 Ga0070697_100183790 3300005536 Bacteria 1773
80 Ga0070697_100189154 3300005536 Bacteria 1747
81 Ga0068853_100006624 3300005539 Bacteria 9224
82 Ga0068853_100766415 3300005539 Bacteria 923
83 Ga0070672_100002044 3300005543 Bacteria 12706
84 Ga0070672_100085949 3300005543 Bacteria 2529
85 Ga0070672_100441223 3300005543 Bacteria 1120
86 Ga0070695_100012165 3300005545 Bacteria 5160
87 Ga0070695_100063193 3300005545 Bacteria 2406
88 Ga0070695_100172041 3300005545 Bacteria 1529
89 Ga0070696_100001788 3300005546 Bacteria 14090
90 Ga0070696_100189057 3300005546 Bacteria 1532
91 Ga0070696_100369016 3300005546 Bacteria 1116
92 Ga0070693_100000276 3300005547 Bacteria 24146
93 Ga0070693_100188768 3300005547 Bacteria 1332
94 Ga0070704_100075161 3300005549 Bacteria 2467
95 Ga0068855_100006496 3300005563 Bacteria 14217
96 Ga0068855_100068883 3300005563 Bacteria 4118
97 Ga0070664_100001830 3300005564 Bacteria 17031
98 Ga0070664_100029985 3300005564 Bacteria 4536
99 Ga0068857_100066866 3300005577 Bacteria 3198
100 Ga0068857_100107372 3300005577 Bacteria 2507
101 Ga0068854_100000604 3300005578 Bacteria 21347
102 Ga0068854_100285757 3300005578 Bacteria 1330
103 Ga0068856_100000353 3300005614 Bacteria 50137
104 Ga0068856_100035468 3300005614 Bacteria 4888
105 Ga0068856_100036905 3300005614 Bacteria 4793
106 Ga0068852_100175091 3300005616 Bacteria 2014
107 Ga0068852_100253589 3300005616 Bacteria 1687
108 Ga0068852_100659013 3300005616 Bacteria 1055
109 Ga0068859_100007290 3300005617 Bacteria 11216
110 Ga0068864_100011107 3300005618 Bacteria 7442
111 Ga0068864_100034480 3300005618 Bacteria 4306
112 Ga0068861_100015430 3300005719 Bacteria 5383
113 Ga0068870_10000325 3300005840 Bacteria 17741
114 Ga0068863_100009507 3300005841 Bacteria 9482
115 Ga0068860_100838669 3300005843 Bacteria 934
116 Ga0068862_100001824 3300005844 Bacteria 19303
117 Ga0068862_100885570 3300005844 Bacteria 877
118 Ga0081455_10008361 3300005937 Bacteria 10770
119 Ga0081455_10015239 3300005937 Bacteria 7477
120 Ga0081455_10022438 3300005937 Bacteria 5898
121 Ga0075368_10032682 3300006042 Bacteria 2022
122 Ga0075368_10048760 3300006042 Bacteria 1679
123 Ga0075362_10011902 3300006177 Bacteria 3438
124 Ga0075367_10024697 3300006178 Bacteria 3390
125 Ga0075367_10112459 3300006178 Bacteria 1672
126 Ga0075367_10328201 3300006178 Bacteria 965
127 Ga0075369_10000065 3300006186 Bacteria 27633
128 Ga0075366_10018694 3300006195 Bacteria 4003
129 Ga0075366_10149409 3300006195 Bacteria 1414
130 Ga0097621_100048171 3300006237 Bacteria 3456
131 Ga0068871_100043454 3300006358 Bacteria 3609
132 Ga0075428_100000979 3300006844 Bacteria 30251
133 Ga0075428_100056015 3300006844 Bacteria 4319
134 Ga0075430_100000013 3300006846 Bacteria 93627
135 Ga0075431_100001575 3300006847 Bacteria 21211
136 Ga0075431_100078916 3300006847 Bacteria 3399
137 Ga0075433_10007085 3300006852 Bacteria 8876
138 Ga0075433_10012430 3300006852 Bacteria 6880
139 Ga0075433_10014440 3300006852 Bacteria 6452
140 Ga0075433_10058539 3300006852 Bacteria 3370
141 Ga0075433_10072688 3300006852 Bacteria 3024
142 Ga0075434_100001968 3300006871 Bacteria 17819
143 Ga0075434_100012395 3300006871 Bacteria 8080
144 Ga0075434_100040431 3300006871 Bacteria 4617
145 Ga0075434_100088680 3300006871 Bacteria 3094
146 Ga0075434_100284106 3300006871 Bacteria 1674
147 Ga0075429_100000234 3300006880 Bacteria 38034
148 Ga0075429_100054871 3300006880 Bacteria 3466
149 Ga0075429_100104645 3300006880 Bacteria 2472
150 Ga0075436_100006427 3300006914 Bacteria 8053
151 Ga0075436_100188085 3300006914 Bacteria 1460
152 Ga0097620_100007290 3300006931 Bacteria 11216
153 Ga0075435_100005776 3300007076 Bacteria 8689
154 Ga0075435_100016605 3300007076 Bacteria 5552
155 Ga0075435_100017092 3300007076 Bacteria 5481
156 Ga0075435_100048970 3300007076 Bacteria 3396
157 Ga0075435_100353434 3300007076 Bacteria 1260
158 Ga0105240_10057854 3300009093 Bacteria 4840
159 Ga0111539_10011539 3300009094 Bacteria 11087
160 Ga0111539_10477946 3300009094 Bacteria 1451
161 Ga0105245_10119307 3300009098 Bacteria 2462
162 Ga0114129_10006909 3300009147 Bacteria 16146
163 Ga0114129_10012006 3300009147 Bacteria 12319
164 Ga0114129_10027871 3300009147 Bacteria 7999
165 Ga0114129_10067061 3300009147 Bacteria 5005
166 Ga0114129_10749725 3300009147 Bacteria 1250
167 Ga0105243_10161733 3300009148 Bacteria 1931
168 Ga0105243_10472771 3300009148 Bacteria 1181
169 Ga0105241_10000214 3300009174 Bacteria 43488
170 Ga0105237_10479276 3300009545 Bacteria 1250
171 Ga0105035_101448 3300009988 Bacteria 1648
172 Ga0157373_10001118 3300013100 Bacteria 20587
173 Ga0157373_10359801 3300013100 Bacteria 1039
174 Ga0157371_10058354 3300013102 Bacteria 2737
175 Ga0157370_10037345 3300013104 Bacteria 4709
176 Ga0157369_10002595 3300013105 Bacteria 21616
177 Ga0157369_10102415 3300013105 Bacteria 3051
178 Ga0157374_10512659 3300013296 Bacteria 1205
179 Ga0163162_10264578 3300013306 Bacteria 1851
180 Ga0163162_10617138 3300013306 Bacteria 1210
181 Ga0157372_10000063 3300013307 Bacteria 119595
182 Ga0157375_10115378 3300013308 Bacteria 2788
183 Ga0157375_10123223 3300013308 Bacteria 2704
184 Ga0157380_10165203 3300014326 Bacteria 1928
185 Ga0157377_10136410 3300014745 Bacteria 1504
186 Ga0157376_10191099 3300014969 Bacteria 1878
187 Ga0163161_10004707 3300017792 Bacteria 9491
188 Ga0206354_10165694 3300020081 Bacteria 887
189 Ga0207656_10070014 3300025321 Bacteria 1557
190 Ga0207653_10005571 3300025885 Bacteria 3929
191 Ga0207682_10000706 3300025893 Bacteria 15485
192 Ga0207682_10089328 3300025893 Bacteria 1334
193 Ga0207642_10085495 3300025899 Bacteria 1544
194 Ga0207645_10011837 3300025907 Bacteria 5938
195 Ga0207643_10000347 3300025908 Bacteria 31237
196 Ga0207684_10004663 3300025910 Bacteria 12873
197 Ga0207684_10013868 3300025910 Bacteria 6960
198 Ga0207654_10001289 3300025911 Bacteria 13337
199 Ga0207707_10000429 3300025912 Bacteria 43692
200 Ga0207707_10113737 3300025912 Bacteria 2365
201 Ga0207695_10084205 3300025913 Bacteria 3211
202 Ga0207660_10000191 3300025917 Bacteria 38989
203 Ga0207660_10036731 3300025917 Bacteria 3407
204 Ga0207660_10269071 3300025917 Bacteria 1350
205 Ga0207657_10000075 3300025919 Bacteria 93163
206 Ga0207649_10080892 3300025920 Bacteria 2102
207 Ga0207652_10000511 3300025921 Bacteria 39295
208 Ga0207652_10125560 3300025921 Bacteria 2285
209 Ga0207646_10006342 3300025922 Bacteria 12248
210 Ga0207646_10015013 3300025922 Bacteria 7331
211 Ga0207646_10073781 3300025922 Bacteria 3048
212 Ga0207646_10093388 3300025922 Bacteria 2694
213 Ga0207646_10197208 3300025922 Bacteria 1818
214 Ga0207681_10196021 3300025923 Bacteria 1548
215 Ga0207694_10238717 3300025924 Bacteria 1485
216 Ga0207650_10002189 3300025925 Bacteria 13657
217 Ga0207650_10445902 3300025925 Bacteria 1077
218 Ga0207659_10005319 3300025926 Bacteria 7802
219 Ga0207687_10182802 3300025927 Bacteria 1626
220 Ga0207700_10033878 3300025928 Bacteria 3659
221 Ga0207644_10010452 3300025931 Bacteria 6117
222 Ga0207690_10003235 3300025932 Bacteria 9776
223 Ga0207706_10001002 3300025933 Bacteria 28767
224 Ga0207706_10072461 3300025933 Bacteria 3030
225 Ga0207670_10010942 3300025936 Bacteria 5242
226 Ga0207670_10039001 3300025936 Bacteria 3107
227 Ga0207669_10229413 3300025937 Bacteria 1369
228 Ga0207704_10007702 3300025938 Bacteria 5104
229 Ga0207704_10023656 3300025938 Bacteria 3315
230 Ga0207665_10119469 3300025939 Bacteria 1860
231 Ga0207691_10000318 3300025940 Bacteria 47853
232 Ga0207691_10018576 3300025940 Bacteria 6589
233 Ga0207691_10108856 3300025940 Bacteria 2466
234 Ga0207691_10249772 3300025940 Bacteria 1531
235 Ga0207711_10153593 3300025941 Bacteria 2079
236 Ga0207689_10000750 3300025942 Bacteria 31126
237 Ga0207689_10040435 3300025942 Bacteria 3859
238 Ga0207661_10007843 3300025944 Bacteria 7603
239 Ga0207661_10087173 3300025944 Bacteria 2592
240 Ga0207679_10008593 3300025945 Bacteria 6510
241 Ga0207679_10630194 3300025945 Bacteria 968
242 Ga0207667_10004119 3300025949 Bacteria 17860
243 Ga0207667_10075569 3300025949 Bacteria 3498
244 Ga0207667_10092089 3300025949 Bacteria 3131
245 Ga0207651_10042331 3300025960 Bacteria 3030
246 Ga0207668_10025966 3300025972 Bacteria 3798
247 Ga0207658_10235214 3300025986 Bacteria 1549
248 Ga0207677_10482460 3300026023 Bacteria 1068
249 Ga0207703_10061553 3300026035 Bacteria 3073
250 Ga0207639_10000841 3300026041 Bacteria 20841
251 Ga0207702_10001971 3300026078 Bacteria 19966
252 Ga0207702_10016032 3300026078 Bacteria 6204
253 Ga0207702_10038331 3300026078 Bacteria 4013
254 Ga0207641_10137057 3300026088 Bacteria 2204
255 Ga0207648_10001603 3300026089 Bacteria 24764
256 Ga0207648_10014392 3300026089 Bacteria 7311
257 Ga0207648_10031423 3300026089 Bacteria 4695
258 Ga0207648_10171301 3300026089 Bacteria 1919
259 Ga0207674_10001396 3300026116 Bacteria 31130
260 Ga0207674_10101008 3300026116 Bacteria 2865
261 Ga0207674_10162761 3300026116 Bacteria 2185
262 Ga0207675_100002867 3300026118 Bacteria 16965
263 Ga0207683_10010653 3300026121 Bacteria 7837
264 Ga0207698_10012898 3300026142 Bacteria 5491
265 Ga0207698_10149069 3300026142 Bacteria 2027
266 Ga0207698_10163897 3300026142 Bacteria 1948
267 Ga0209968_1001719 3300027526 Bacteria 3311
268 Ga0209970_1002836 3300027614 Bacteria 2932
269 Ga0209983_1000640 3300027665 Bacteria 7465
270 Ga0209971_1000041 3300027682 Bacteria 41543
271 Ga0209966_1000241 3300027695 Bacteria 20361
272 Ga0209998_10000028 3300027717 Bacteria 60458
273 Ga0209813_10071187 3300027866 Bacteria 1131
274 Ga0207428_10402013 3300027907 Bacteria 1003
275 Ga0268266_10343257 3300028379 Bacteria 1402
276 Ga0268265_10073694 3300028380 Bacteria 2667
277 Ga0268265_10784422 3300028380 Bacteria 927
278 Ga0268264_10313133 3300028381 Bacteria 1482
279 Ga0265334_10024087 3300028573 Bacteria 2471
280 Ga0307408_100411575 3300031548 Bacteria 1164
281 Ga0307413_10030585 3300031824 Bacteria 3026
282 Ga0307406_10045203 3300031901 Bacteria 2763
283 Ga0307412_10003825 3300031911 Bacteria 8370
284 Ga0307416_100021144 3300032002 Bacteria 4664
285 Ga0307414_10027743 3300032004 Bacteria 3663
286 Ga0307411_10035223 3300032005 Bacteria 3123
287 Ga0373928_0016829 3300035084 Bacteria 1499
288 Ga0373929_0040699 3300035085 Bacteria 1031
289 Ga0373939_0082850 3300035114 Bacteria 1069
290 Ga0373931_0024383 3300035691 Bacteria 3064
291 Ga0373931_0133568 3300035691 Bacteria 1431
292 Ga0373947_0171793 3300035725 Bacteria 1407
293 Ga0373937_0244531 3300036401 Bacteria 1691
294 Ga0373925_0235593 3300037068 Bacteria 1465
295 Ga0395899_0028253 3300037312 Bacteria 4224
296 Ga0395900_0000302 3300037418 Bacteria 73622
297 Ga0395900_0008760 3300037418 Bacteria 10394
298 Ga0395900_0012494 3300037418 Bacteria 8684
299 Ga0395900_0031304 3300037418 Bacteria 5465
300 Ga0395898_0000518 3300037466 Bacteria 73622
301 Ga0395898_0014546 3300037466 Bacteria 8082
302 Ga0395898_0025524 3300037466 Bacteria 5953
303 Ga0395898_0106051 3300037466 Bacteria 2695
304 Ga0395905_0000285 3300037471 Bacteria 73934
305 Ga0395901_0000210 3300038443 Bacteria 73622
306 Ga0395901_0002195 3300038443 Bacteria 19921
307 Ga0395901_0019148 3300038443 Bacteria 6998
308 Ga0395901_0025875 3300038443 Bacteria 6026
309 Ga0436365_0114128 3300039437 Bacteria 8402
310 Ga0436360_0381469 3300039438 Bacteria 12708
311 Ga0436361_0338592 3300039447 Bacteria 2385
312 Ga0439448_0085804 3300042005 Bacteria 1061
313 Ga0439458_0025528 3300042157 Bacteria 1387
314 Ga0439459_0000841 3300042438 Bacteria 4285
315 Ga0439464_0010207 3300042439 Bacteria 2480
316 Ga0439460_0000765 3300042461 Bacteria 7233
317 Ga0439460_0038960 3300042461 Bacteria 1387
318 Ga0451577_0032496 3300042876 Bacteria 4701
319 Ga0451577_0090086 3300042876 Bacteria 2737
320 Ga0451577_0139870 3300042876 Bacteria 2175
321 Ga0453683_0010743 3300044673 Bacteria 6063
322 Ga0453683_0018164 3300044673 Bacteria 4516
323 Ga0466963_0168228 3300044694 Bacteria 1527
324 Ga0453684_0105552 3300044712 Bacteria 3435
325 Ga0453684_0195789 3300044712 Bacteria 2360
326 Ga0451576_0032424 3300045051 Bacteria 5562
327 Ga0451576_0040638 3300045051 Bacteria 4920
328 Ga0451576_0044344 3300045051 Bacteria 4688
329 Ga0451576_0131719 3300045051 Bacteria 2606
330 Ga0451576_0371829 3300045051 Bacteria 1498
331 Ga0466967_0048859 3300045976 Bacteria 3697
332 Ga0495580_0005829 3300046472 Bacteria 10105
333 Ga0495594_0275420 3300046499 Bacteria 959
334 Ga0495658_0321548 3300046683 Bacteria 981
335 Ga0495593_0268782 3300047673 Bacteria 853
336 Ga0496100_0070151 3300048903 Bacteria 2336
337 Ga0496101_0076291 3300048904 Bacteria 2469
338 Ga0496102_0073254 3300048905 Bacteria 3148
339 Ga0496104_0043107 3300048907 Bacteria 4237
340 Ga0496107_0265862 3300048910 Bacteria 1276
341 Ga0496109_0081837 3300048912 Bacteria 2975
342 Ga0496114_0104995 3300048917 Bacteria 2416
343 Ga0496115_0109680 3300048918 Bacteria 2266
344 Ga0501031_0234043 3300049568 Bacteria 1195
345 Ga0501034_0001568 3300049571 Bacteria 29868
346 Ga0501034_0240138 3300049571 Bacteria 1758
347 Ga0501036_0493778 3300049572 Bacteria 1019
348 Ga0501036_0646796 3300049572 Bacteria 875
349 Ga0501037_0103525 3300049573 Bacteria 2053
350 Ga0501038_0235892 3300049574 Bacteria 1454
351 Ga0501039_0030185 3300049575 Bacteria 4179
352 Ga0501039_0254462 3300049575 Bacteria 1381
353 Ga0501040_0000980 3300049576 Bacteria 18069
354 Ga0501040_0120060 3300049576 Bacteria 1844
355 Ga0501040_0163921 3300049576 Bacteria 1572
356 Ga0501040_0334341 3300049576 Bacteria 1084
357 Ga0501042_0011205 3300049578 Bacteria 6042
358 Ga0501042_0298246 3300049578 Bacteria 1164
359 Ga0501042_0537790 3300049578 Bacteria 849
360 Ga0501043_0110915 3300049579 Bacteria 2154
361 Ga0501046_0000953 3300049580 Bacteria 28407
362 Ga0501046_0104376 3300049580 Bacteria 2172
363 Ga0501046_0281471 3300049580 Bacteria 1218
364 Ga0501048_0026482 3300049582 Bacteria 4222
365 Ga0501068_0173290 3300049584 Bacteria 1362
366 Ga0501071_0040895 3300049587 Bacteria 3319
367 Ga0501071_0078296 3300049587 Bacteria 2416
368 Ga0501072_0104116 3300049588 Bacteria 2256
369 Ga0501072_0149833 3300049588 Bacteria 1860
370 Ga0501072_0302581 3300049588 Bacteria 1271
371 Ga0501073_0184112 3300049589 Bacteria 1446
372 Ga0501074_0034458 3300049590 Bacteria 3670
373 Ga0501074_0080094 3300049590 Bacteria 2344
374 Ga0501074_0232257 3300049590 Bacteria 1313
375 Ga0501075_0028923 3300049591 Bacteria 4095
376 Ga0501075_0123066 3300049591 Bacteria 1974
377 Ga0501075_0166096 3300049591 Bacteria 1684
378 Ga0501075_0275770 3300049591 Bacteria 1281
379 Ga0501076_0020685 3300049592 Bacteria 5039
380 Ga0501076_0044803 3300049592 Bacteria 3490
381 Ga0501076_0136496 3300049592 Bacteria 1991
382 Ga0501076_0215579 3300049592 Bacteria 1569
383 Ga0501076_0233329 3300049592 Bacteria 1504
384 Ga0501077_0030422 3300049593 Bacteria 3435
385 Ga0501077_0272754 3300049593 Bacteria 1076
386 Ga0501079_0004802 3300049741 Bacteria 10019
387 Ga0501079_0024039 3300049741 Bacteria 4674
388 Ga0501080_0166186 3300049742 Bacteria 2036
389 Ga0501080_0199546 3300049742 Bacteria 1837
390 Ga0501080_0271872 3300049742 Bacteria 1542
391 Ga0501081_0028568 3300049743 Bacteria 3764
392 Ga0501081_0205899 3300049743 Bacteria 1428
393 Ga0501083_0058171 3300049744 Bacteria 2587
394 Ga0501083_0091851 3300049744 Bacteria 2004
395 Ga0501045_0002865 3300049824 Bacteria 11783
396 Ga0501045_0222065 3300049824 Bacteria 1407
397 nmdc:mga03683_12639_c1 3300050489 Bacteria 3090
398 nmdc:mga03683_181439_c1 3300050489 Bacteria 960
399 nmdc:mga03n38_73790_c1 3300050490 Bacteria 1585
400 nmdc:mga0yw44_290026_c1 3300050492 Bacteria 1095
401 nmdc:mga0yw44_59510_c1 3300050492 Bacteria 2338
402 nmdc:mga0k408_180521_c1 3300050493 Bacteria 1259
403 nmdc:mga0k408_2555_c1 3300050493 Bacteria 9667
404 nmdc:mga0k408_310106_c1 3300050493 Bacteria 942
405 nmdc:mga06z11_120117_c1 3300050494 Bacteria 1465
406 nmdc:mga06z11_279308_c1 3300050494 Bacteria 989
407 nmdc:mga07m45_158571_c1 3300050496 Bacteria 1313
408 nmdc:mga05p37_100599_c1 3300050507 Bacteria 3561
409 nmdc:mga05p37_192714_c1 3300050507 Bacteria 2473
410 nmdc:mga05p37_310411_c1 3300050507 Bacteria 1870
411 nmdc:mga05p37_340498_c1 3300050507 Bacteria 1769
412 nmdc:mga05p37_53501_c2 3300050507 Bacteria 3479
413 nmdc:mga05p37_6668_c1 3300050507 Bacteria 13617
414 nmdc:mga05p37_74580_c1 3300050507 Bacteria 4176
415 nmdc:mga09592_122_c1 3300050508 Bacteria 49514
416 nmdc:mga09592_161324_c1 3300050508 Bacteria 1937
417 nmdc:mga09592_319645_c1 3300050508 Bacteria 1345
418 nmdc:mga09592_338131_c1 3300050508 Bacteria 1303
419 nmdc:mga0qj67_8752_c1 3300050509 Bacteria 7511
420 nmdc:mga06r32_1168_c1 3300050510 Bacteria 23647
421 nmdc:mga06r32_119472_c1 3300050510 Bacteria 2599
422 nmdc:mga06r32_145635_c1 3300050510 Bacteria 2346
423 nmdc:mga06r32_258965_c1 3300050510 Bacteria 1727
424 nmdc:mga08y16_15865_c1 3300050511 Bacteria 7917
425 nmdc:mga08y16_308030_c1 3300050511 Bacteria 1631
426 nmdc:mga0n895_114658_c1 3300050512 Bacteria 2713
427 nmdc:mga0n895_143304_c1 3300050512 Bacteria 2419
428 nmdc:mga0n895_33332_c1 3300050512 Bacteria 4950
429 nmdc:mga0n895_41698_c1 3300050512 Bacteria 4463
430 nmdc:mga0n895_601744_c1 3300050512 Bacteria 1102
431 nmdc:mga0n895_680878_c1 3300050512 Bacteria 1025
432 nmdc:mga0n895_75326_c1 3300050512 Bacteria 3354
433 nmdc:mga0n895_86726_c1 3300050512 Bacteria 3127
434 nmdc:mga0rr50_19854_c1 3300050513 Bacteria 4547
435 nmdc:mga0rr50_72898_c1 3300050513 Bacteria 2624
436 nmdc:mga0rr50_81168_c1 3300050513 Bacteria 2502
437 nmdc:mga0rr50_96517_c1 3300050513 Bacteria 2313
438 nmdc:mga08x19_149172_c1 3300050514 Bacteria 1582
439 nmdc:mga08x19_168371_c1 3300050514 Bacteria 1491
440 nmdc:mga08x19_83036_c1 3300050514 Bacteria 2106
441 nmdc:mga0a205_13509_c1 3300050515 Bacteria 7606
442 nmdc:mga0a205_171380_c1 3300050515 Bacteria 2066
443 nmdc:mga0a205_205875_c1 3300050515 Bacteria 1857
444 nmdc:mga0a205_23241_c1 3300050515 Bacteria 5880
445 nmdc:mga0a205_50286_c1 3300050515 Bacteria 4024
446 nmdc:mga0a205_522141_c1 3300050515 Bacteria 1044
447 nmdc:mga0sz30_212_c1 3300050516 Bacteria 21940
448 Ga0500644_0153875 3300053088 Bacteria 924
449 Ga0500557_033570 3300053105 Bacteria 1571
450 Ga0500616_0002226 3300053153 Bacteria 16578
451 Ga0500552_000227 3300053733 Bacteria 5100
452 Ga0501084_0012502 3300054114 Bacteria 7031
453 Ga0501084_0057667 3300054114 Bacteria 3249
454 Ga0501084_0113677 3300054114 Bacteria 2276
455 Ga0501084_0487935 3300054114 Bacteria 1041
456 Ga0501082_0004432 3300060353 Bacteria 12258
457 Ga0501082_0059765 3300060353 Bacteria 3285
458 Ga0501082_0293547 3300060353 Bacteria 1415
459 Ga0530510_0077547 3300061734 Bacteria 2415
460 Ga0530510_0167516 3300061734 Bacteria 1627
461 Ga0075366_10005277
462 JGI26129J50193_1001896
463 Ga0065707_10008766
464 Ga0070658_10012423
465 Ga0070676_10000494
466 Ga0070676_10028380
467 Ga0070683_100020136
468 Ga0070690_100055992
469 Ga0070670_100003877
470 Ga0070677_10023568
471 Ga0068869_100000633
472 Ga0068869_100042258
473 Ga0070666_10083700
474 Ga0070680_100000096
475 Ga0070680_100002706
476 Ga0070680_100113813
477 Ga0070682_100000209
478 Ga0070689_100131156
479 Ga0070689_100183987
480 Ga0070691_10069329
481 Ga0070687_100002533
482 Ga0070661_100001130
483 Ga0070661_100037082
484 Ga0070692_10011911
485 Ga0070669_100006777
486 Ga0070669_100213356
487 Ga0070669_100264454
488 Ga0070675_100030317
489 Ga0070671_100083408
490 Ga0070674_100035233
491 Ga0070673_100012037
492 Ga0070673_100094975
493 Ga0070659_100001542
494 Ga0070667_100186857
495 Ga0070703_10004269
496 Ga0070709_10089607
497 Ga0070713_100035201
498 Ga0070705_100007991
499 Ga0070705_100055265
500 Ga0070694_100012207
501 Ga0070694_100016717
502 Ga0070694_100034305
503 Ga0070694_100173766
504 Ga0070694_100378630
505 Ga0070708_100003818
506 Ga0070708_100059482
507 Ga0070708_100078365
508 Ga0070708_100513952
509 Ga0070678_100012306
510 Ga0070662_100001288
511 Ga0070681_10009396
512 Ga0070681_10016376
513 Ga0068867_100004608
514 Ga0068867_100005185
515 Ga0068867_100005897
516 Ga0068867_100086463
517 Ga0068867_100168447
518 Ga0070706_100072981
519 Ga0070706_100074867
520 Ga0070707_100035272
521 Ga0070707_100056959
522 Ga0070707_100063081
523 Ga0070707_100063987
524 Ga0070698_100006487
525 Ga0070698_100015090
526 Ga0070698_100035068
527 Ga0070698_100559636
528 Ga0070699_100036365
529 Ga0070699_100036794
530 Ga0070699_100143471
531 Ga0070699_100152004
532 Ga0070699_100465928
533 Ga0070679_100007108
534 Ga0070679_100085092
535 Ga0070697_100013533
536 Ga0070697_100027058
537 Ga0070697_100102452
538 Ga0070697_100129043
539 Ga0070697_100183790
540 Ga0070697_100189154
541 Ga0068853_100006624
542 Ga0068853_100766415
543 Ga0070672_100002044
544 Ga0070672_100085949
545 Ga0070672_100441223
546 Ga0070695_100012165
547 Ga0070695_100063193
548 Ga0070695_100172041
549 Ga0070696_100001788
550 Ga0070696_100189057
551 Ga0070696_100369016
552 Ga0070693_100000276
553 Ga0070693_100188768
554 Ga0070704_100075161
555 Ga0068855_100006496
556 Ga0068855_100068883
557 Ga0070664_100001830
558 Ga0070664_100029985
559 Ga0068857_100066866
560 Ga0068857_100107372
561 Ga0068854_100000604
562 Ga0068854_100285757
563 Ga0068856_100000353
564 Ga0068856_100035468
565 Ga0068856_100036905
566 Ga0068852_100175091
567 Ga0068852_100253589
568 Ga0068852_100659013
569 Ga0068859_100007290
570 Ga0068864_100011107
571 Ga0068864_100034480
572 Ga0068861_100015430
573 Ga0068870_10000325
574 Ga0068863_100009507
575 Ga0068860_100838669
576 Ga0068862_100001824
577 Ga0068862_100885570
578 Ga0081455_10008361
579 Ga0081455_10015239
580 Ga0081455_10022438
581 Ga0075368_10032682
582 Ga0075368_10048760
583 Ga0075362_10011902
584 Ga0075367_10024697
585 Ga0075367_10112459
586 Ga0075367_10328201
587 Ga0075369_10000065
588 Ga0075366_10018694
589 Ga0075366_10149409
590 Ga0097621_100048171
591 Ga0068871_100043454
592 Ga0075428_100000979
593 Ga0075428_100056015
594 Ga0075430_100000013
595 Ga0075431_100001575
596 Ga0075431_100078916
597 Ga0075433_10007085
598 Ga0075433_10012430
599 Ga0075433_10014440
600 Ga0075433_10058539
601 Ga0075433_10072688
602 Ga0075434_100001968
603 Ga0075434_100012395
604 Ga0075434_100040431
605 Ga0075434_100088680
606 Ga0075434_100284106
607 Ga0075429_100000234
608 Ga0075429_100054871
609 Ga0075429_100104645
610 Ga0075436_100006427
611 Ga0075436_100188085
612 Ga0097620_100007290
613 Ga0075435_100005776
614 Ga0075435_100016605
615 Ga0075435_100017092
616 Ga0075435_100048970
617 Ga0075435_100353434
618 Ga0105240_10057854
619 Ga0111539_10011539
620 Ga0111539_10477946
621 Ga0105245_10119307
622 Ga0114129_10006909
623 Ga0114129_10012006
624 Ga0114129_10027871
625 Ga0114129_10067061
626 Ga0114129_10749725
627 Ga0105243_10161733
628 Ga0105243_10472771
629 Ga0105241_10000214
630 Ga0105237_10479276
631 Ga0105035_101448
632 Ga0157373_10001118
633 Ga0157373_10359801
634 Ga0157371_10058354
635 Ga0157370_10037345
636 Ga0157369_10002595
637 Ga0157369_10102415
638 Ga0157374_10512659
639 Ga0163162_10264578
640 Ga0163162_10617138
641 Ga0157372_10000063
642 Ga0157375_10115378
643 Ga0157375_10123223
644 Ga0157380_10165203
645 Ga0157377_10136410
646 Ga0157376_10191099
647 Ga0163161_10004707
648 Ga0206354_10165694
649 Ga0207656_10070014
650 Ga0207653_10005571
651 Ga0207682_10000706
652 Ga0207682_10089328
653 Ga0207642_10085495
654 Ga0207645_10011837
655 Ga0207643_10000347
656 Ga0207684_10004663
657 Ga0207684_10013868
658 Ga0207654_10001289
659 Ga0207707_10000429
660 Ga0207707_10113737
661 Ga0207695_10084205
662 Ga0207660_10000191
663 Ga0207660_10036731
664 Ga0207660_10269071
665 Ga0207657_10000075
666 Ga0207649_10080892
667 Ga0207652_10000511
668 Ga0207652_10125560
669 Ga0207646_10006342
670 Ga0207646_10015013
671 Ga0207646_10073781
672 Ga0207646_10093388
673 Ga0207646_10197208
674 Ga0207681_10196021
675 Ga0207694_10238717
676 Ga0207650_10002189
677 Ga0207650_10445902
678 Ga0207659_10005319
679 Ga0207687_10182802
680 Ga0207700_10033878
681 Ga0207644_10010452
682 Ga0207690_10003235
683 Ga0207706_10001002
684 Ga0207706_10072461
685 Ga0207670_10010942
686 Ga0207670_10039001
687 Ga0207669_10229413
688 Ga0207704_10007702
689 Ga0207704_10023656
690 Ga0207665_10119469
691 Ga0207691_10000318
692 Ga0207691_10018576
693 Ga0207691_10108856
694 Ga0207691_10249772
695 Ga0207711_10153593
696 Ga0207689_10000750
697 Ga0207689_10040435
698 Ga0207661_10007843
699 Ga0207661_10087173
700 Ga0207679_10008593
701 Ga0207679_10630194
702 Ga0207667_10004119
703 Ga0207667_10075569
704 Ga0207667_10092089
705 Ga0207651_10042331
706 Ga0207668_10025966
707 Ga0207658_10235214
708 Ga0207677_10482460
709 Ga0207703_10061553
710 Ga0207639_10000841
711 Ga0207702_10001971
712 Ga0207702_10016032
713 Ga0207702_10038331
714 Ga0207641_10137057
715 Ga0207648_10001603
716 Ga0207648_10014392
717 Ga0207648_10031423
718 Ga0207648_10171301
719 Ga0207674_10001396
720 Ga0207674_10101008
721 Ga0207674_10162761
722 Ga0207675_100002867
723 Ga0207683_10010653
724 Ga0207698_10012898
725 Ga0207698_10149069
726 Ga0207698_10163897
727 Ga0209968_1001719
728 Ga0209970_1002836
729 Ga0209983_1000640
730 Ga0209971_1000041
731 Ga0209966_1000241
732 Ga0209998_10000028
733 Ga0209813_10071187
734 Ga0207428_10402013
735 Ga0268266_10343257
736 Ga0268265_10073694
737 Ga0268265_10784422
738 Ga0268264_10313133
739 Ga0265334_10024087
740 Ga0307408_100411575
741 Ga0307413_10030585
742 Ga0307406_10045203
743 Ga0307412_10003825
744 Ga0307416_100021144
745 Ga0307414_10027743
746 Ga0307411_10035223
747 Ga0373928_0016829
748 Ga0373929_0040699
749 Ga0373939_0082850
750 Ga0373931_0024383
751 Ga0373931_0133568
752 Ga0373947_0171793
753 Ga0373937_0244531
754 Ga0373925_0235593
755 Ga0395899_0028253
756 Ga0395900_0000302
757 Ga0395900_0008760
758 Ga0395900_0012494
759 Ga0395900_0031304
760 Ga0395898_0000518
761 Ga0395898_0014546
762 Ga0395898_0025524
763 Ga0395898_0106051
764 Ga0395905_0000285
765 Ga0395901_0000210
766 Ga0395901_0002195
767 Ga0395901_0019148
768 Ga0395901_0025875
769 Ga0436365_0114128
770 Ga0436360_0381469
771 Ga0436361_0338592
772 Ga0439448_0085804
773 Ga0439458_0025528
774 Ga0439459_0000841
775 Ga0439464_0010207
776 Ga0439460_0000765
777 Ga0439460_0038960
778 Ga0451577_0032496
779 Ga0451577_0090086
780 Ga0451577_0139870
781 Ga0453683_0010743
782 Ga0453683_0018164
783 Ga0466963_0168228
784 Ga0453684_0105552
785 Ga0453684_0195789
786 Ga0451576_0032424
787 Ga0451576_0040638
788 Ga0451576_0044344
789 Ga0451576_0131719
790 Ga0451576_0371829
791 Ga0466967_0048859
792 Ga0495580_0005829
793 Ga0495594_0275420
794 Ga0495658_0321548
795 Ga0495593_0268782
796 Ga0496100_0070151
797 Ga0496101_0076291
798 Ga0496102_0073254
799 Ga0496104_0043107
800 Ga0496107_0265862
801 Ga0496109_0081837
802 Ga0496114_0104995
803 Ga0496115_0109680
804 Ga0501031_0234043
805 Ga0501034_0001568
806 Ga0501034_0240138
807 Ga0501036_0493778
808 Ga0501036_0646796
809 Ga0501037_0103525
810 Ga0501038_0235892
811 Ga0501039_0030185
812 Ga0501039_0254462
813 Ga0501040_0000980
814 Ga0501040_0120060
815 Ga0501040_0163921
816 Ga0501040_0334341
817 Ga0501042_0011205
818 Ga0501042_0298246
819 Ga0501042_0537790
820 Ga0501043_0110915
821 Ga0501046_0000953
822 Ga0501046_0104376
823 Ga0501046_0281471
824 Ga0501048_0026482
825 Ga0501068_0173290
826 Ga0501071_0040895
827 Ga0501071_0078296
828 Ga0501072_0104116
829 Ga0501072_0149833
830 Ga0501072_0302581
831 Ga0501073_0184112
832 Ga0501074_0034458
833 Ga0501074_0080094
834 Ga0501074_0232257
835 Ga0501075_0028923
836 Ga0501075_0123066
837 Ga0501075_0166096
838 Ga0501075_0275770
839 Ga0501076_0020685
840 Ga0501076_0044803
841 Ga0501076_0136496
842 Ga0501076_0215579
843 Ga0501076_0233329
844 Ga0501077_0030422
845 Ga0501077_0272754
846 Ga0501079_0004802
847 Ga0501079_0024039
848 Ga0501080_0166186
849 Ga0501080_0199546
850 Ga0501080_0271872
851 Ga0501081_0028568
852 Ga0501081_0205899
853 Ga0501083_0058171
854 Ga0501083_0091851
855 Ga0501045_0002865
856 Ga0501045_0222065
857 nmdc:mga03683_12639_c1
858 nmdc:mga03683_181439_c1
859 nmdc:mga03n38_73790_c1
860 nmdc:mga0yw44_290026_c1
861 nmdc:mga0yw44_59510_c1
862 nmdc:mga0k408_180521_c1
863 nmdc:mga0k408_2555_c1
864 nmdc:mga0k408_310106_c1
865 nmdc:mga06z11_120117_c1
866 nmdc:mga06z11_279308_c1
867 nmdc:mga07m45_158571_c1
868 nmdc:mga05p37_100599_c1
869 nmdc:mga05p37_192714_c1
870 nmdc:mga05p37_310411_c1
871 nmdc:mga05p37_340498_c1
872 nmdc:mga05p37_53501_c2
873 nmdc:mga05p37_6668_c1
874 nmdc:mga05p37_74580_c1
875 nmdc:mga09592_122_c1
876 nmdc:mga09592_161324_c1
877 nmdc:mga09592_319645_c1
878 nmdc:mga09592_338131_c1
879 nmdc:mga0qj67_8752_c1
880 nmdc:mga06r32_1168_c1
881 nmdc:mga06r32_119472_c1
882 nmdc:mga06r32_145635_c1
883 nmdc:mga06r32_258965_c1
884 nmdc:mga08y16_15865_c1
885 nmdc:mga08y16_308030_c1
886 nmdc:mga0n895_114658_c1
887 nmdc:mga0n895_143304_c1
888 nmdc:mga0n895_33332_c1
889 nmdc:mga0n895_41698_c1
890 nmdc:mga0n895_601744_c1
891 nmdc:mga0n895_680878_c1
892 nmdc:mga0n895_75326_c1
893 nmdc:mga0n895_86726_c1
894 nmdc:mga0rr50_19854_c1
895 nmdc:mga0rr50_72898_c1
896 nmdc:mga0rr50_81168_c1
897 nmdc:mga0rr50_96517_c1
898 nmdc:mga08x19_149172_c1
899 nmdc:mga08x19_168371_c1
900 nmdc:mga08x19_83036_c1
901 nmdc:mga0a205_13509_c1
902 nmdc:mga0a205_171380_c1
903 nmdc:mga0a205_205875_c1
904 nmdc:mga0a205_23241_c1
905 nmdc:mga0a205_50286_c1
906 nmdc:mga0a205_522141_c1
907 nmdc:mga0sz30_212_c1
908 Ga0500644_0153875
909 Ga0500557_033570
910 Ga0500616_0002226
911 Ga0500552_000227
912 Ga0501084_0012502
913 Ga0501084_0057667
914 Ga0501084_0113677
915 Ga0501084_0487935
916 Ga0501082_0004432
917 Ga0501082_0059765
918 Ga0501082_0293547
919 Ga0530510_0077547
920 Ga0530510_0167516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

188

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9181 5 223
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9108 5 223
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9102 4 210
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.908 5 223
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9039 5 223
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 4 248 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9445 4 248 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 3 224 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.931 5 240 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9235 2 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1QL54-F1-model_v4 ABC transporter ATP-binding protein 0.9777 6 254 GO:0005524
GO:0016887
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9672 1 181 GO:0005524
GO:0016887
AF-A0A1W9VND7-F1-model_v4 ABC transporter domain-containing protein 0.9647 2 76 GO:0005524
GO:0016887
AF-A0A377XA79-F1-model_v4 Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter (EC 3.6.3.-) 0.9637 5 140 GO:0005524
GO:0016887
AF-A0A534UJK3-F1-model_v4 ABC transporter ATP-binding protein 0.9623 5 254 GO:0005524
GO:0016887

Map