F448485

General Info

Members Datasets Scaffolds Average Seq Length
460 380 281 600

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1002309|Ga0065165_10023097
Length 627
Sequence MGLSSALASAMSGLRANQAALSIVSSNVANSQTPGYVVQTPNQIEVTTGDFGSTVMTTGVSRELDTYVQNQLRTETGGSGYADQMASILKQLQNVYGTPGNSGTLETALNNFTTSLQALSTSAGASSAQRVALGAAQALATQLNVTTNGIQSLRSNVEQDLGTSGQQANAAMQKIADINTKLQGLSSNDPSAATLMDQRDQAINTLSKFVDVRVTTDGSNQANIYTTTGFQLVGAGLASQFSFASAGALKATSLYNSDPSKSGVGALNLKLPNGSQIDVVANNVVSSGQIAADLKLRDQTLVQAQTQIDQLAATMSSALSDKTTAGSTVSGPPAGFDIDLAGAQPGNTVNITYTDTATNTQRQVTLVNVTDPAALPLQNATNANPMQIGVNFGSGMGAIASALNTALPNAHLSFSGAPSPATVTTLRVTDDNSGLAKVNSASSTKTISSLISGNPQLPLFTDGGQALYTGAITASGSQMTGLAGRIAVNTQLVSDPTRLSVYNSSPVTPSGDTTRSDYLYSQLTNTVFSYSPQTGLGSASQPFTGSVSNYLQQFLSVQGNAATQATQLQQGQSVVVSTLQAKFNSTSSVNLDSEMSNLIQLQNAYAANAHVMSVVQSMMNTLIQAQV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
21 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
38 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
46 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
47 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
48 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
49 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
50 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
51 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
52 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
53 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
54 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
55 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
56 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
57 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
60 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
61 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
64 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
65 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
66 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
70 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
71 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
72 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
73 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
74 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
75 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
76 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
77 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
78 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
79 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
82 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
83 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
84 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
85 2922368715
86 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
87 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
88 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
89 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
90 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
91 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
92 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
93 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
94 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
95 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
96 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
97 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
98 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
99 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
100 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
101 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
102 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
103 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
104 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
105 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
106 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
107 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
108 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
109 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
110 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
111 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
112 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
113 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
114 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
115 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
116 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
117 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
118 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
119 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
120 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
121 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
122 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
123 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
124 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
125 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
135 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
138 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
139 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
140 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
141 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
142 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
143 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
144 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
145 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
146 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
147 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
148 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
149 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
150 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
151 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
152 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
153 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
155 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
156 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
157 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
158 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
159 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
160 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
161 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
162 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
163 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
164 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
165 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
166 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
167 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
170 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
173 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
174 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
175 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
176 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
177 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
178 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
179 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
180 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
181 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
182 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
183 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
184 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
185 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
186 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
192 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
198 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
199 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
200 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
201 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
202 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
203 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
207 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
237 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
238 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
329 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
333 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
334 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
335 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
345 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
346 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
347 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
348 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
349 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
350 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
351 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
354 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
355 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
356 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
357 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
358 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
359 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
360 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
361 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
362 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
363 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
364 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
365 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
366 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
367 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
368 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
369 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
370 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
371 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
372 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
373 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
374 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
375 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
376 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
377 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
378 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
379 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
380 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.22
Metatranscriptomes 0
Isolates 38.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 30.87
Rhizoplane 2.61
Rhizosphere 40.22
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000062 3300003203 Bacteria 49646
2 JGI25153J46596_10002666 3300003215 Bacteria 10192
3 JGI25153J46596_10010378 3300003215 Bacteria 4217
4 JGI25153J46596_10010379 3300003215 Bacteria 4217
5 Ga0055531_10004564 3300003794 Bacteria 8372
6 Ga0065165_1002309 3300005262 Bacteria 16705
7 Ga0065165_1004193 3300005262 Bacteria 9184
8 Ga0070658_10007221 3300005327 Bacteria 8965
9 Ga0070670_100092491 3300005331 Bacteria 2601
10 Ga0070680_100020291 3300005336 Bacteria 5274
11 Ga0070660_100023198 3300005339 Bacteria 4596
12 Ga0070660_100093767 3300005339 Bacteria 2371
13 Ga0070671_100140081 3300005355 Bacteria 2041
14 Ga0070714_100015946 3300005435 Bacteria 6058
15 Ga0070714_100019945 3300005435 Bacteria 5470
16 Ga0070713_100026394 3300005436 Bacteria 4559
17 Ga0070713_100083118 3300005436 Bacteria 2736
18 Ga0070710_10021327 3300005437 Bacteria 3374
19 Ga0070711_100000706 3300005439 Bacteria 17526
20 Ga0070711_100014209 3300005439 Bacteria 5014
21 Ga0070711_100016653 3300005439 Bacteria 4669
22 Ga0070663_100070724 3300005455 Bacteria 2538
23 Ga0070678_100013026 3300005456 Bacteria 5196
24 Ga0070681_10014725 3300005458 Bacteria 7777
25 Ga0070681_10062035 3300005458 Bacteria 3712
26 Ga0068853_100005857 3300005539 Bacteria 9682
27 Ga0070665_100077649 3300005548 Bacteria 3327
28 Ga0068855_100079098 3300005563 Bacteria 3814
29 Ga0068857_100021905 3300005577 Bacteria 5624
30 Ga0068854_100002064 3300005578 Bacteria 12308
31 Ga0068856_100000363 3300005614 Bacteria 49777
32 Ga0068852_100037553 3300005616 Bacteria 4062
33 Ga0068852_100041246 3300005616 Bacteria 3899
34 Ga0068864_100059336 3300005618 Bacteria 3310
35 Ga0068851_10000943 3300005834 Bacteria 12591
36 Ga0068851_10003425 3300005834 Bacteria 7061
37 Ga0068860_100000562 3300005843 Bacteria 44958
38 Ga0081539_10000008 3300005985 Bacteria 525071
39 Ga0070717_10032188 3300006028 Bacteria 4224
40 Ga0070717_10042180 3300006028 Bacteria 3721
41 Ga0070716_100013392 3300006173 Bacteria 4178
42 Ga0070712_100021885 3300006175 Bacteria 4204
43 Ga0099824_1011927 3300006942 Bacteria 9651
44 Ga0099823_1045581 3300006944 Bacteria 2916
45 Ga0099794_10005803 3300007265 Bacteria 4976
46 Ga0099795_10012326 3300007788 Bacteria 2589
47 Ga0105240_10007748 3300009093 Bacteria 15534
48 Ga0105240_10016020 3300009093 Bacteria 10163
49 Ga0105240_10017998 3300009093 Bacteria 9503
50 Ga0105240_10021957 3300009093 Bacteria 8478
51 Ga0105240_10095606 3300009093 Bacteria 3622
52 Ga0105241_10010595 3300009174 Bacteria 6763
53 Ga0105241_10025013 3300009174 Bacteria 4436
54 Ga0105237_10011809 3300009545 Bacteria 9237
55 Ga0105237_10012257 3300009545 Bacteria 9037
56 Ga0105237_10017363 3300009545 Bacteria 7461
57 Ga0105238_10002692 3300009551 Bacteria 17671
58 Ga0105249_10075422 3300009553 Bacteria 3123
59 Ga0099796_10010318 3300010159 Bacteria 2565
60 Ga0105239_10029450 3300010375 Bacteria 6036
61 Ga0105239_10031668 3300010375 Bacteria 5813
62 Ga0157371_10030577 3300013102 Bacteria 3884
63 Ga0157370_10013875 3300013104 Bacteria 8274
64 Ga0157369_10004292 3300013105 Bacteria 16858
65 Ga0157369_10077427 3300013105 Bacteria 3564
66 Ga0163163_10148807 3300014325 Bacteria 2386
67 Ga0214544_1000467 3300021320 Bacteria 73360
68 Ga0214542_1000185 3300021321 Bacteria 96676
69 Ga0214545_1000102 3300021324 Bacteria 96676
70 Ga0214543_1000211 3300021327 Bacteria 87600
71 Ga0213876_10001592 3300021384 Bacteria 13951
72 Ga0209563_101556 3300025230 Bacteria 5969
73 Ga0209677_100138 3300025253 Bacteria 67992
74 Ga0209677_102870 3300025253 Bacteria 6061
75 Ga0209148_1001001 3300025254 Bacteria 18024
76 Ga0209233_1000919 3300025261 Bacteria 12853
77 Ga0209233_1007720 3300025261 Bacteria 3384
78 Ga0209455_1004492 3300025272 Bacteria 4539
79 Ga0209455_1010896 3300025272 Bacteria 2276
80 Ga0209758_1000171 3300025297 Bacteria 148854
81 Ga0209758_1000985 3300025297 Bacteria 38269
82 Ga0209758_1001458 3300025297 Bacteria 27774
83 Ga0209758_1003767 3300025297 Bacteria 13399
84 Ga0209256_1002311 3300025299 Bacteria 15976
85 Ga0207426_1000848 3300025302 Bacteria 32201
86 Ga0207426_1001401 3300025302 Bacteria 20312
87 Ga0207426_1008252 3300025302 Bacteria 4233
88 Ga0209051_1014332 3300025303 Bacteria 3706
89 Ga0209257_1003765 3300025304 Bacteria 12523
90 Ga0207692_10015643 3300025898 Bacteria 3343
91 Ga0207710_10007658 3300025900 Bacteria 4569
92 Ga0207647_10020095 3300025904 Bacteria 4483
93 Ga0207699_10005030 3300025906 Bacteria 6320
94 Ga0207699_10024397 3300025906 Bacteria 3307
95 Ga0207654_10002255 3300025911 Bacteria 9889
96 Ga0207707_10003450 3300025912 Bacteria 14016
97 Ga0207695_10000029 3300025913 Bacteria 548364
98 Ga0207695_10021731 3300025913 Bacteria 7313
99 Ga0207671_10004429 3300025914 Bacteria 13452
100 Ga0207693_10013077 3300025915 Bacteria 6696
101 Ga0207693_10023861 3300025915 Bacteria 4855
102 Ga0207663_10005321 3300025916 Bacteria 6476
103 Ga0207657_10015346 3300025919 Bacteria 7424
104 Ga0207657_10037293 3300025919 Bacteria 4342
105 Ga0207694_10000275 3300025924 Bacteria 48774
106 Ga0207694_10020626 3300025924 Bacteria 4989
107 Ga0207700_10100281 3300025928 Bacteria 2308
108 Ga0207664_10012533 3300025929 Bacteria 6068
109 Ga0207706_10024323 3300025933 Bacteria 5430
110 Ga0207661_10001312 3300025944 Bacteria 16630
111 Ga0207667_10054440 3300025949 Bacteria 4208
112 Ga0207678_10089707 3300026067 Bacteria 2628
113 Ga0207702_10000261 3300026078 Bacteria 61023
114 Ga0207702_10001387 3300026078 Bacteria 24152
115 Ga0207674_10012745 3300026116 Bacteria 9391
116 Ga0207674_10046408 3300026116 Bacteria 4460
117 Ga0207674_10067872 3300026116 Bacteria 3589
118 Ga0207683_10008230 3300026121 Bacteria 8921
119 Ga0207698_10037784 3300026142 Bacteria 3560
120 Ga0209389_1000011 3300027296 Bacteria 223265
121 Ga0209389_1003633 3300027296 Bacteria 12519
122 Ga0209589_1011417 3300027357 Bacteria 12519
123 Ga0209489_100017 3300027361 Bacteria 223265
124 Ga0209489_100144 3300027361 Bacteria 106729
125 Ga0209700_100027 3300027363 Bacteria 223462
126 Ga0268266_10085249 3300028379 Bacteria 2760
127 Ga0268264_10000096 3300028381 Bacteria 230188
128 Ga0265319_1006844 3300028563 Bacteria 5213
129 Ga0265334_10006865 3300028573 Bacteria 4889
130 Ga0265323_10001086 3300028653 Bacteria 14078
131 Ga0265336_10002079 3300028666 Bacteria 8520
132 Ga0265338_10000746 3300028800 Bacteria 55415
133 Ga0265324_10005079 3300029957 Bacteria 5757
134 Ga0265339_10003672 3300031249 Bacteria 10711
135 Ga0307509_10108230 3300031507 Bacteria 2793
136 Ga0307508_10001617 3300031616 Bacteria 25159
137 Ga0265314_10009092 3300031711 Bacteria 8440
138 Ga0265342_10021082 3300031712 Bacteria 4168
139 Ga0307516_10092223 3300031730 Bacteria 2856
140 Ga0307510_10051848 3300033180 Bacteria 4334
141 Ga0373933_0000159 3300035724 Bacteria 43953
142 Ga0395899_0052730 3300037312 Bacteria 3014
143 Ga0395900_0001592 3300037418 Bacteria 26786
144 Ga0395898_0014444 3300037466 Bacteria 8110
145 Ga0395905_0069164 3300037471 Bacteria 3307
146 Ga0436365_0514738 3300039437 Bacteria 22852
147 Ga0436361_0725474 3300039447 Bacteria 14455
148 Ga0466972_0001076 3300044658 Bacteria 13077
149 Ga0466966_0002410 3300044684 Bacteria 12211
150 Ga0466961_0000240 3300044693 Bacteria 36762
151 Ga0466963_0029459 3300044694 Bacteria 3534
152 Ga0466964_0009651 3300044706 Bacteria 3636
153 Ga0466959_0004716 3300045049 Bacteria 9184
154 Ga0466959_0100788 3300045049 Bacteria 2067
155 Ga0495638_0001809 3300046460 Bacteria 18600
156 Ga0495653_0049990 3300046463 Bacteria 3217
157 Ga0495664_0069945 3300046477 Bacteria 2095
158 Ga0495606_0000992 3300046507 Bacteria 41375
159 Ga0495608_0033422 3300046511 Bacteria 3476
160 Ga0495643_0014376 3300046522 Bacteria 4711
161 Ga0495648_0005659 3300046524 Bacteria 10341
162 Ga0495648_0055556 3300046524 Bacteria 2386
163 Ga0495652_0013878 3300046529 Bacteria 7247
164 Ga0495587_0034198 3300046536 Bacteria 3066
165 Ga0495597_0033085 3300046542 Bacteria 2343
166 Ga0495645_0016600 3300046543 Bacteria 5261
167 Ga0495645_0031473 3300046543 Bacteria 3866
168 Ga0495667_0026034 3300046559 Bacteria 3940
169 Ga0495635_0019497 3300046663 Bacteria 4727
170 Ga0495657_0020526 3300046675 Bacteria 4748
171 Ga0495600_0007951 3300046809 Bacteria 6499
172 Ga0495604_0004903 3300047317 Bacteria 10607
173 Ga0495604_0008790 3300047317 Bacteria 7983
174 Ga0495604_0031204 3300047317 Bacteria 4228
175 Ga0495674_0022925 3300047319 Bacteria 5752
176 Ga0495680_0021647 3300047322 Bacteria 5378
177 Ga0495686_0045889 3300047472 Bacteria 2764
178 Ga0496104_0035503 3300048907 Bacteria 4654
179 Ga0496107_0076589 3300048910 Bacteria 2436
180 Ga0496108_0002640 3300048911 Bacteria 14365
181 Ga0496108_0011825 3300048911 Bacteria 7102
182 Ga0496109_0008858 3300048912 Bacteria 8564
183 Ga0496109_0068595 3300048912 Bacteria 3250
184 Ga0496110_0076609 3300048913 Bacteria 2974
185 Ga0496112_0000059 3300048915 Bacteria 74946
186 Ga0496112_0022095 3300048915 Bacteria 6059
187 Ga0496112_0046077 3300048915 Bacteria 4275
188 Ga0496112_0171367 3300048915 Bacteria 2135
189 Ga0496114_0100459 3300048917 Bacteria 2469
190 Ga0496117_0034136 3300048920 Bacteria 3839
191 Ga0496118_0007939 3300048921 Bacteria 11103
192 Ga0496118_0035029 3300048921 Bacteria 4084
193 Ga0496119_0008382 3300048922 Bacteria 9090
194 Ga0496121_0017487 3300048924 Bacteria 7321
195 Ga0496121_0027368 3300048924 Bacteria 5337
196 Ga0496124_0018716 3300048927 Bacteria 6476
197 Ga0496124_0077111 3300048927 Bacteria 2749
198 Ga0496125_0066611 3300048928 Bacteria 2844
199 Ga0496126_0011870 3300048929 Bacteria 8959
200 Ga0496126_0049252 3300048929 Bacteria 3847
201 Ga0496126_0055272 3300048929 Bacteria 3593
202 Ga0496126_0059979 3300048929 Bacteria 3424
203 Ga0501031_0000973 3300049568 Bacteria 17407
204 Ga0501031_0001209 3300049568 Bacteria 15773
205 Ga0501032_0000038 3300049569 Bacteria 115810
206 Ga0501033_0000222 3300049570 Bacteria 54685
207 Ga0501033_0000894 3300049570 Bacteria 27248
208 Ga0501034_0002947 3300049571 Bacteria 19726
209 Ga0501034_0025637 3300049571 Bacteria 6004
210 Ga0501034_0067530 3300049571 Bacteria 3588
211 Ga0501036_0000757 3300049572 Bacteria 23921
212 Ga0501036_0023338 3300049572 Bacteria 5210
213 Ga0501037_0000139 3300049573 Bacteria 67890
214 Ga0501037_0000808 3300049573 Bacteria 23439
215 Ga0501038_0000659 3300049574 Bacteria 30648
216 Ga0501038_0000782 3300049574 Bacteria 28176
217 Ga0501039_0001851 3300049575 Bacteria 15631
218 Ga0501039_0025021 3300049575 Bacteria 4584
219 Ga0501040_0006042 3300049576 Bacteria 7841
220 Ga0501041_0068531 3300049577 Bacteria 2175
221 Ga0501042_0016294 3300049578 Bacteria 5101
222 Ga0501043_0000021 3300049579 Bacteria 155025
223 Ga0501043_0002224 3300049579 Bacteria 16541
224 Ga0501043_0020717 3300049579 Bacteria 5158
225 Ga0501043_0126851 3300049579 Bacteria 2001
226 Ga0501046_0000905 3300049580 Bacteria 28947
227 Ga0501047_0000041 3300049581 Bacteria 184355
228 Ga0501047_0074049 3300049581 Bacteria 3278
229 Ga0501048_0000077 3300049582 Bacteria 51021
230 Ga0501067_0003179 3300049583 Bacteria 9065
231 Ga0501067_0007112 3300049583 Bacteria 6215
232 Ga0501068_0002050 3300049584 Bacteria 10754
233 Ga0501068_0006884 3300049584 Bacteria 6284
234 Ga0501069_0004636 3300049585 Bacteria 7107
235 Ga0501069_0030110 3300049585 Bacteria 2980
236 Ga0501070_0001900 3300049586 Bacteria 18472
237 Ga0501072_0002932 3300049588 Bacteria 12837
238 Ga0501073_0000056 3300049589 Bacteria 70854
239 Ga0501073_0043761 3300049589 Bacteria 3157
240 Ga0501074_0000771 3300049590 Bacteria 20189
241 Ga0501080_0001496 3300049742 Bacteria 19723
242 Ga0501083_0000634 3300049744 Bacteria 22732
243 Ga0501035_0000090 3300049822 Bacteria 112445
244 Ga0501035_0001734 3300049822 Bacteria 22041
245 Ga0501035_0014672 3300049822 Bacteria 7234
246 Ga0501044_0000054 3300049823 Bacteria 141399
247 Ga0501044_0005756 3300049823 Bacteria 13714
248 Ga0501044_0018849 3300049823 Bacteria 7389
249 Ga0501045_0025119 3300049824 Bacteria 4279
250 Ga0495601_0027170 3300053077 Bacteria 3538
251 Ga0500635_0003411 3300053080 Bacteria 3997
252 Ga0500643_000019 3300053087 Bacteria 294301
253 Ga0500566_0000268 3300053094 Bacteria 27976
254 Ga0500566_0001603 3300053094 Bacteria 13315
255 Ga0500566_0003044 3300053094 Bacteria 10034
256 Ga0500566_0038795 3300053094 Bacteria 2755
257 Ga0500554_002976 3300053102 Bacteria 3403
258 Ga0500555_000838 3300053103 Bacteria 10999
259 Ga0500557_000170 3300053105 Bacteria 13774
260 Ga0500562_001110 3300053108 Bacteria 6613
261 Ga0500572_000807 3300053111 Bacteria 9955
262 Ga0500595_000641 3300053119 Bacteria 20993
263 Ga0500642_0000421 3300053130 Bacteria 13793
264 Ga0500559_0000438 3300053136 Bacteria 29552
265 Ga0500568_0011003 3300053139 Bacteria 4213
266 Ga0500603_000154 3300053150 Bacteria 16931
267 Ga0500604_0011785 3300053151 Bacteria 2355
268 Ga0500619_002353 3300053154 Bacteria 3621
269 Ga0500622_0006609 3300053156 Bacteria 6688
270 Ga0500630_021010 3300053159 Bacteria 3225
271 Ga0500633_0003943 3300053160 Bacteria 3328
272 Ga0500638_033810 3300053162 Bacteria 2473
273 Ga0500639_016114 3300053163 Bacteria 3939
274 Ga0500636_0000779 3300053177 Bacteria 17162
275 Ga0500637_0000107 3300053178 Bacteria 29902
276 Ga0500637_0000127 3300053178 Bacteria 27567
277 Ga0500596_000562 3300053735 Bacteria 7058
278 Ga0500596_001340 3300053735 Bacteria 4968
279 Ga0500601_000158 3300053737 Bacteria 14124
280 Ga0501084_0003143 3300054114 Bacteria 13353
281 Ga0500661_000620 3300055283 Bacteria 6626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0059979 Ga0496126_0059979_681_2558 474
2 3300031711 Ga0265314_10009092 Ga0265314_100090921 482
3 3300045049 Ga0466959_0100788 Ga0466959_0100788_31_1863 488
4 3300048913 Ga0496110_0076609 Ga0496110_0076609_1240_2949 492
5 iso_pu_bacteria 8019586578 8019588301 496
6 3300048924 Ga0496121_0027368 Ga0496121_0027368_3034_4869 500
7 3300046543 Ga0495645_0031473 Ga0495645_0031473_577_2403 501
8 3300005456 Ga0070678_100013026 Ga0070678_1000130262 505
9 3300014325 Ga0163163_10148807 Ga0163163_101488071 505
10 3300026121 Ga0207683_10008230 Ga0207683_100082303 505
11 3300048917 Ga0496114_0100459 Ga0496114_0100459_331_2208 505
12 3300005458 Ga0070681_10014725 Ga0070681_100147252 507
13 3300031712 Ga0265342_10021082 Ga0265342_100210822 510
14 3300025906 Ga0207699_10005030 Ga0207699_100050303 511
15 3300046477 Ga0495664_0069945 Ga0495664_0069945_220_2076 511
16 3300053077 Ga0495601_0027170 Ga0495601_0027170_830_2686 511
17 3300006028 Ga0070717_10042180 Ga0070717_100421802 512
18 3300039447 Ga0436361_0725474 Ga0436361_0725474_2446_4302 513
19 3300009093 Ga0105240_10007748 Ga0105240_100077486 514
20 3300005436 Ga0070713_100083118 Ga0070713_1000831182 515
21 3300025928 Ga0207700_10100281 Ga0207700_101002812 515
22 3300007788 Ga0099795_10012326 Ga0099795_100123262 516
23 3300031730 Ga0307516_10092223 Ga0307516_100922232 516
24 3300048912 Ga0496109_0008858 Ga0496109_0008858_2085_3956 516
25 3300005614 Ga0068856_100000363 Ga0068856_10000036311 517
26 3300025261 Ga0209233_1000919 Ga0209233_10009196 517
27 3300025272 Ga0209455_1010896 Ga0209455_10108961 517
28 3300026078 Ga0207702_10000261 Ga0207702_1000026155 517
29 3300010159 Ga0099796_10010318 Ga0099796_100103182 518
30 3300005439 Ga0070711_100016653 Ga0070711_1000166532 519
31 3300025898 Ga0207692_10015643 Ga0207692_100156432 519
32 3300053111 Ga0500572_000807 Ga0500572_000807_6336_8201 520
33 3300053136 Ga0500559_0000438 Ga0500559_0000438_7372_9237 520
34 3300053735 Ga0500596_000562 Ga0500596_000562_3662_5527 520
35 3300005435 Ga0070714_100015946 Ga0070714_1000159462 523
36 3300005435 Ga0070714_100019945 Ga0070714_1000199452 523
37 3300005436 Ga0070713_100026394 Ga0070713_1000263942 523
38 3300005439 Ga0070711_100000706 Ga0070711_1000007066 523
39 3300025253 Ga0209677_100138 Ga0209677_1001388 523
40 3300025916 Ga0207663_10005321 Ga0207663_100053213 523
41 3300025929 Ga0207664_10012533 Ga0207664_100125333 523
42 3300048929 Ga0496126_0055272 Ga0496126_0055272_1556_3418 523
43 3300053080 Ga0500635_0003411 Ga0500635_0003411_2126_3970 523
44 3300053150 Ga0500603_000154 Ga0500603_000154_2941_4785 523
45 3300053178 Ga0500637_0000127 Ga0500637_0000127_19185_21029 523
46 3300006173 Ga0070716_100013392 Ga0070716_1000133922 524
47 3300009545 Ga0105237_10011809 Ga0105237_100118098 524
48 3300026116 Ga0207674_10012745 Ga0207674_100127457 524
49 3300035724 Ga0373933_0000159 Ga0373933_0000159_33979_35835 524
50 3300009093 Ga0105240_10095606 Ga0105240_100956062 525
51 3300013104 Ga0157370_10013875 Ga0157370_100138752 526
52 3300005355 Ga0070671_100140081 Ga0070671_1001400811 527
53 3300005455 Ga0070663_100070724 Ga0070663_1000707241 527
54 3300005618 Ga0068864_100059336 Ga0068864_1000593362 527
55 3300048912 Ga0496109_0068595 Ga0496109_0068595_193_2064 527
56 3300048929 Ga0496126_0011870 Ga0496126_0011870_6755_8602 527
57 3300025900 Ga0207710_10007658 Ga0207710_100076582 528
58 3300025944 Ga0207661_10001312 Ga0207661_100013128 529
59 3300031616 Ga0307508_10001617 Ga0307508_100016178 529
60 3300013105 Ga0157369_10077427 Ga0157369_100774272 530
61 3300053094 Ga0500566_0001603 Ga0500566_0001603_8623_10467 530
62 3300053102 Ga0500554_002976 Ga0500554_002976_250_2094 530
63 3300053119 Ga0500595_000641 Ga0500595_000641_11313_13157 530
64 3300053178 Ga0500637_0000107 Ga0500637_0000107_4087_5931 530
65 3300055283 Ga0500661_000620 Ga0500661_000620_3711_5555 530
66 3300009093 Ga0105240_10016020 Ga0105240_100160208 531
67 3300013105 Ga0157369_10004292 Ga0157369_100042928 531
68 3300037312 Ga0395899_0052730 Ga0395899_0052730_1109_2959 531
69 3300025272 Ga0209455_1004492 Ga0209455_10044922 532
70 3300039437 Ga0436365_0514738 Ga0436365_0514738_419_2248 532
71 3300006028 Ga0070717_10032188 Ga0070717_100321882 533
72 3300025253 Ga0209677_102870 Ga0209677_1028702 533
73 3300053735 Ga0500596_001340 Ga0500596_001340_25_1890 535
74 3300005327 Ga0070658_10007221 Ga0070658_100072212 536
75 3300005336 Ga0070680_100020291 Ga0070680_1000202912 536
76 3300005539 Ga0068853_100005857 Ga0068853_1000058578 536
77 3300005616 Ga0068852_100037553 Ga0068852_1000375532 536
78 3300005834 Ga0068851_10003425 Ga0068851_100034254 536
79 3300025912 Ga0207707_10003450 Ga0207707_100034509 536
80 3300025913 Ga0207695_10021731 Ga0207695_100217316 536
81 3300025919 Ga0207657_10015346 Ga0207657_100153461 536
82 3300025924 Ga0207694_10020626 Ga0207694_100206262 536
83 3300048927 Ga0496124_0077111 Ga0496124_0077111_174_2036 538
84 3300053094 Ga0500566_0000268 Ga0500566_0000268_9166_11040 538
85 3300053159 Ga0500630_021010 Ga0500630_021010_1057_2931 538
86 3300053162 Ga0500638_033810 Ga0500638_033810_564_2438 538
87 3300053163 Ga0500639_016114 Ga0500639_016114_105_1979 538
88 3300031249 Ga0265339_10003672 Ga0265339_100036723 540
89 3300053094 Ga0500566_0038795 Ga0500566_0038795_158_2032 540
90 3300005843 Ga0068860_100000562 Ga0068860_10000056235 541
91 3300028381 Ga0268264_10000096 Ga0268264_10000096102 541
92 3300048920 Ga0496117_0034136 Ga0496117_0034136_423_2297 541
93 3300048921 Ga0496118_0007939 Ga0496118_0007939_2603_4477 541
94 3300048924 Ga0496121_0017487 Ga0496121_0017487_1795_3669 541
95 3300048927 Ga0496124_0018716 Ga0496124_0018716_1716_3590 541
96 3300048929 Ga0496126_0049252 Ga0496126_0049252_129_2003 541
97 3300005437 Ga0070710_10021327 Ga0070710_100213272 542
98 3300005439 Ga0070711_100014209 Ga0070711_1000142093 542
99 3300005458 Ga0070681_10062035 Ga0070681_100620352 542
100 3300005548 Ga0070665_100077649 Ga0070665_1000776492 542
101 3300005563 Ga0068855_100079098 Ga0068855_1000790982 542
102 3300006175 Ga0070712_100021885 Ga0070712_1000218853 542
103 3300009551 Ga0105238_10002692 Ga0105238_100026927 542
104 3300010375 Ga0105239_10031668 Ga0105239_100316682 542
105 3300021384 Ga0213876_10001592 Ga0213876_100015926 542
106 3300025254 Ga0209148_1001001 Ga0209148_10010018 542
107 3300025906 Ga0207699_10024397 Ga0207699_100243972 542
108 3300025915 Ga0207693_10023861 Ga0207693_100238613 542
109 3300028563 Ga0265319_1006844 Ga0265319_10068443 542
110 3300028573 Ga0265334_10006865 Ga0265334_100068652 542
111 3300028653 Ga0265323_10001086 Ga0265323_100010864 542
112 3300028666 Ga0265336_10002079 Ga0265336_100020794 542
113 3300028800 Ga0265338_10000746 Ga0265338_1000074617 542
114 3300029957 Ga0265324_10005079 Ga0265324_100050792 542
115 3300048915 Ga0496112_0022095 Ga0496112_0022095_1709_3580 542
116 3300037418 Ga0395900_0001592 Ga0395900_0001592_7566_9419 543
117 3300037466 Ga0395898_0014444 Ga0395898_0014444_4026_5879 543
118 3300028379 Ga0268266_10085249 Ga0268266_100852492 544
119 3300005339 Ga0070660_100093767 Ga0070660_1000937672 545
120 3300005577 Ga0068857_100021905 Ga0068857_1000219053 545
121 3300007265 Ga0099794_10005803 Ga0099794_100058032 545
122 3300013102 Ga0157371_10030577 Ga0157371_100305772 545
123 3300025933 Ga0207706_10024323 Ga0207706_100243232 545
124 3300026116 Ga0207674_10046408 Ga0207674_100464083 545
125 3300048921 Ga0496118_0035029 Ga0496118_0035029_1047_2930 545
126 3300049568 Ga0501031_0001209 Ga0501031_0001209_7124_8986 545
127 3300049569 Ga0501032_0000038 Ga0501032_0000038_102078_103940 545
128 3300049570 Ga0501033_0000222 Ga0501033_0000222_12990_14852 545
129 3300049571 Ga0501034_0002947 Ga0501034_0002947_6967_8829 545
130 3300049572 Ga0501036_0000757 Ga0501036_0000757_12862_14724 545
131 3300049573 Ga0501037_0000139 Ga0501037_0000139_6986_8848 545
132 3300049574 Ga0501038_0000659 Ga0501038_0000659_6964_8826 545
133 3300049575 Ga0501039_0001851 Ga0501039_0001851_7994_9856 545
134 3300049579 Ga0501043_0000021 Ga0501043_0000021_100512_102374 545
135 3300049580 Ga0501046_0000905 Ga0501046_0000905_474_2336 545
136 3300049581 Ga0501047_0000041 Ga0501047_0000041_51098_52960 545
137 3300049582 Ga0501048_0000077 Ga0501048_0000077_42152_44014 545
138 3300049583 Ga0501067_0003179 Ga0501067_0003179_296_2158 545
139 3300049584 Ga0501068_0002050 Ga0501068_0002050_6054_7916 545
140 3300049585 Ga0501069_0030110 Ga0501069_0030110_517_2379 545
141 3300049586 Ga0501070_0001900 Ga0501070_0001900_9209_11071 545
142 3300049588 Ga0501072_0002932 Ga0501072_0002932_3974_5836 545
143 3300049589 Ga0501073_0000056 Ga0501073_0000056_52781_54643 545
144 3300049590 Ga0501074_0000771 Ga0501074_0000771_11317_13179 545
145 3300049742 Ga0501080_0001496 Ga0501080_0001496_10898_12760 545
146 3300049744 Ga0501083_0000634 Ga0501083_0000634_13860_15722 545
147 3300049822 Ga0501035_0000090 Ga0501035_0000090_52781_54643 545
148 3300049823 Ga0501044_0000054 Ga0501044_0000054_88440_90302 545
149 3300049824 Ga0501045_0025119 Ga0501045_0025119_17_1879 545
150 3300054114 Ga0501084_0003143 Ga0501084_0003143_5009_6871 545
151 3300044658 Ga0466972_0001076 Ga0466972_0001076_11021_12874 546
152 3300048910 Ga0496107_0076589 Ga0496107_0076589_546_2417 546
153 3300048911 Ga0496108_0002640 Ga0496108_0002640_9797_11668 546
154 3300048915 Ga0496112_0171367 Ga0496112_0171367_187_2058 546
155 3300049579 Ga0501043_0126851 Ga0501043_0126851_111_1979 546
156 3300025915 Ga0207693_10013077 Ga0207693_100130774 548
157 3300049585 Ga0501069_0004636 Ga0501069_0004636_4077_5945 548
158 3300005331 Ga0070670_100092491 Ga0070670_1000924912 549
159 3300031507 Ga0307509_10108230 Ga0307509_101082302 549
160 3300049576 Ga0501040_0006042 Ga0501040_0006042_4517_6385 549
161 3300049578 Ga0501042_0016294 Ga0501042_0016294_2368_4236 549
162 3300049583 Ga0501067_0007112 Ga0501067_0007112_2273_4141 549
163 3300049568 Ga0501031_0000973 Ga0501031_0000973_9269_11131 551
164 3300049570 Ga0501033_0000894 Ga0501033_0000894_10248_12110 551
165 3300049573 Ga0501037_0000808 Ga0501037_0000808_8109_9971 551
166 3300049575 Ga0501039_0025021 Ga0501039_0025021_1176_3038 551
167 3300049579 Ga0501043_0002224 Ga0501043_0002224_13111_14973 551
168 3300049822 Ga0501035_0001734 Ga0501035_0001734_2569_4431 551
169 3300049823 Ga0501044_0018849 Ga0501044_0018849_3905_5767 551
170 3300003215 JGI25153J46596_10010378 JGI25153J46596_100103783 552
171 3300003794 Ga0055531_10004564 Ga0055531_100045646 552
172 3300025297 Ga0209758_1001458 Ga0209758_10014582 552
173 3300025299 Ga0209256_1002311 Ga0209256_100231113 552
174 3300025303 Ga0209051_1014332 Ga0209051_10143322 552
175 3300025304 Ga0209257_1003765 Ga0209257_10037658 552
176 3300049577 Ga0501041_0068531 Ga0501041_0068531_157_2019 552
177 3300005616 Ga0068852_100041246 Ga0068852_1000412462 553
178 3300026067 Ga0207678_10089707 Ga0207678_100897072 553
179 iso_pu_bacteria 2874645413 2874652815 553
180 iso_pu_bacteria 2879127579 2879135771 553
181 iso_pu_bacteria 2879142872 2879150961 553
182 3300003215 JGI25153J46596_10010379 JGI25153J46596_100103793 555
183 3300025297 Ga0209758_1000171 Ga0209758_1000171117 555
184 3300046524 Ga0495648_0005659 Ga0495648_0005659_5846_7723 555
185 3300053737 Ga0500601_000158 Ga0500601_000158_7169_9052 555
186 3300046663 Ga0495635_0019497 Ga0495635_0019497_1495_3345 556
187 3300047317 Ga0495604_0031204 Ga0495604_0031204_2324_4174 556
188 3300053087 Ga0500643_000019 Ga0500643_000019_285923_287806 556
189 3300053103 Ga0500555_000838 Ga0500555_000838_4203_6086 556
190 3300053139 Ga0500568_0011003 Ga0500568_0011003_1095_2978 556
191 3300049584 Ga0501068_0006884 Ga0501068_0006884_1434_3302 557
192 3300053154 Ga0500619_002353 Ga0500619_002353_1452_3305 557
193 iso_pu_bacteria 2513237141 2513891896 557
194 3300044694 Ga0466963_0029459 Ga0466963_0029459_773_2653 559
195 3300047472 Ga0495686_0045889 Ga0495686_0045889_182_2062 559
196 3300049571 Ga0501034_0025637 Ga0501034_0025637_675_2543 559
197 3300049572 Ga0501036_0023338 Ga0501036_0023338_1859_3727 559
198 3300049574 Ga0501038_0000782 Ga0501038_0000782_19457_21325 559
199 3300049579 Ga0501043_0020717 Ga0501043_0020717_2756_4624 559
200 3300049581 Ga0501047_0074049 Ga0501047_0074049_1234_3102 559
201 3300049589 Ga0501073_0043761 Ga0501073_0043761_1015_2883 559
202 3300049822 Ga0501035_0014672 Ga0501035_0014672_951_2819 559
203 3300049823 Ga0501044_0005756 Ga0501044_0005756_6932_8800 559
204 3300046507 Ga0495606_0000992 Ga0495606_0000992_34558_36435 560
205 3300009093 Ga0105240_10017998 Ga0105240_100179986 561
206 3300009174 Ga0105241_10025013 Ga0105241_100250132 561
207 3300009545 Ga0105237_10012257 Ga0105237_100122574 561
208 3300025913 Ga0207695_10000029 Ga0207695_10000029260 561
209 3300025914 Ga0207671_10004429 Ga0207671_100044292 561
210 3300026142 Ga0207698_10037784 Ga0207698_100377842 561
211 3300047317 Ga0495604_0004903 Ga0495604_0004903_79_1959 561
212 3300048922 Ga0496119_0008382 Ga0496119_0008382_2356_4236 561
213 iso_pu_bacteria 2824661429 2824665028 561
214 iso_pu_bacteria 2824732956 2824739918 561
215 iso_pu_bacteria 2824746037 2824753303 561
216 iso_pu_bacteria 2874612657 2874619606 561
217 iso_pu_bacteria 2879083081 2879085643 561
218 iso_pu_bacteria 2881665667 2881669884 561
219 iso_pu_bacteria 2906643746 2906651640 561
220 iso_pu_bacteria 2908775508 2908778525 561
221 iso_pu_bacteria 2922393267 2922399087 561
222 iso_pu_bacteria 2929615660 2929616469 561
223 iso_pu_bacteria 2929624759 2929625213 561
224 3300046463 Ga0495653_0049990 Ga0495653_0049990_1241_3124 562
225 3300046511 Ga0495608_0033422 Ga0495608_0033422_136_2019 562
226 3300046529 Ga0495652_0013878 Ga0495652_0013878_1623_3506 562
227 3300046536 Ga0495587_0034198 Ga0495587_0034198_1065_2948 562
228 3300046543 Ga0495645_0016600 Ga0495645_0016600_1973_3856 562
229 3300046559 Ga0495667_0026034 Ga0495667_0026034_1518_3401 562
230 3300046675 Ga0495657_0020526 Ga0495657_0020526_351_2234 562
231 3300046809 Ga0495600_0007951 Ga0495600_0007951_1419_3302 562
232 3300047317 Ga0495604_0008790 Ga0495604_0008790_2538_4421 562
233 3300047319 Ga0495674_0022925 Ga0495674_0022925_2354_4237 562
234 3300047322 Ga0495680_0021647 Ga0495680_0021647_2045_3928 562
235 3300053105 Ga0500557_000170 Ga0500557_000170_8597_10480 562
236 3300053130 Ga0500642_0000421 Ga0500642_0000421_3294_5177 562
237 iso_pu_bacteria 2513237094 2513643921 562
238 iso_pu_bacteria 2844315083 2844317546 562
239 iso_pu_bacteria 2903727486 2903733064 562
240 iso_pu_bacteria 2906602504 2906608857 562
241 iso_pu_bacteria 2935959822 2935966149 562
242 iso_pu_bacteria 2941531003 2941537847 562
243 iso_pu_bacteria 3005710791 3005713308 562
244 iso_pu_bacteria 3005718088 3005720667 562
245 iso_pu_bacteria 8019648815 8019656298 562
246 iso_pu_bacteria 8056967851 8056968924 562
247 3300049571 Ga0501034_0067530 Ga0501034_0067530_1645_3513 563
248 iso_pu_bacteria 2507262055 2507510201 563
249 iso_pu_bacteria 2508501009 2508544213 563
250 iso_pu_bacteria 2508501042 2508697848 563
251 iso_pu_bacteria 2508501128 2509151122 563
252 iso_pu_bacteria 2511231028 2511398764 563
253 iso_pu_bacteria 2513237092 2513628998 563
254 iso_pu_bacteria 2513237095 2513648806 563
255 iso_pu_bacteria 2513237102 2513700350 563
256 iso_pu_bacteria 2513237104 2513716089 563
257 iso_pu_bacteria 2513237139 2513880116 563
258 iso_pu_bacteria 2513237161 2514013376 563
259 iso_pu_bacteria 2515154112 2515631844 563
260 iso_pu_bacteria 2517093001 2517105267 563
261 iso_pu_bacteria 2524023205 2524439231 563
262 iso_pu_bacteria 2528768022 2528850919 563
263 iso_pu_bacteria 2617270735 2617349778 563
264 iso_pu_bacteria 2617270741 2617379136 563
265 iso_pu_bacteria 2744054633 2745076720 563
266 iso_pu_bacteria 2791355196 2793064994 563
267 iso_pu_bacteria 2802429603 2805922633 563
268 iso_pu_bacteria 2816332527 2818244087 563
269 iso_pu_bacteria 2824600985 2824608791 563
270 iso_pu_bacteria 2824609381 2824616981 563
271 iso_pu_bacteria 2824617872 2824624118 563
272 iso_pu_bacteria 2824626560 2824634735 563
273 iso_pu_bacteria 2824635225 2824642713 563
274 iso_pu_bacteria 2824644064 2824650641 563
275 iso_pu_bacteria 2824653114 2824660736 563
276 iso_pu_bacteria 2824671348 2824678525 563
277 iso_pu_bacteria 2824679649 2824687109 563
278 iso_pu_bacteria 2824687955 2824695451 563
279 iso_pu_bacteria 2824696289 2824703857 563
280 iso_pu_bacteria 2824704595 2824708328 563
281 iso_pu_bacteria 2824714736 2824722520 563
282 iso_pu_bacteria 2824723954 2824731680 563
283 iso_pu_bacteria 2824753945 2824761059 563
284 iso_pu_bacteria 2824763712 2824771772 563
285 iso_pu_bacteria 2824773399 2824781137 563
286 iso_pu_bacteria 2838122688 2838125627 563
287 iso_pu_bacteria 2841941048 2841941712 563
288 iso_pu_bacteria 2841949485 2841951140 563
289 iso_pu_bacteria 2841957949 2841959288 563
290 iso_pu_bacteria 2841966195 2841968866 563
291 iso_pu_bacteria 2841974524 2841975940 563
292 iso_pu_bacteria 2841983080 2841989207 563
293 iso_pu_bacteria 2842038055 2842045330 563
294 iso_pu_bacteria 2842045827 2842049008 563
295 iso_pu_bacteria 2847930680 2847934338 563
296 iso_pu_bacteria 2847939898 2847944924 563
297 iso_pu_bacteria 2849076700 2849080876 563
298 iso_pu_bacteria 2857509624 2857509768 563
299 iso_pu_bacteria 2874590934 2874591250 563
300 iso_pu_bacteria 2874620515 2874623899 563
301 iso_pu_bacteria 2874628541 2874635376 563
302 iso_pu_bacteria 2876761206 2876762831 563
303 iso_pu_bacteria 2876771140 2876771250 563
304 iso_pu_bacteria 2876818435 2876818565 563
305 iso_pu_bacteria 2879074833 2879075090 563
306 iso_pu_bacteria 2879099564 2879109996 563
307 iso_pu_bacteria 2881364244 2881369214 563
308 iso_pu_bacteria 2885366525 2885371692 563
309 iso_pu_bacteria 2885409591 2885411466 563
310 iso_pu_bacteria 2888378607 2888382252 563
311 iso_pu_bacteria 2888388044 2888388434 563
312 iso_pu_bacteria 2888419890 2888422850 563
313 iso_pu_bacteria 2904666416 2904666961 563
314 iso_pu_bacteria 2904711408 2904718662 563
315 iso_pu_bacteria 2906626472 2906628068 563
316 iso_pu_bacteria 2922368715 2922375764 563
317 iso_pu_bacteria 2932784394 2932786863 563
318 iso_pu_bacteria 2932794094 2932801494 563
319 iso_pu_bacteria 2932801729 2932804960 563
320 iso_pu_bacteria 2932809354 2932811065 563
321 iso_pu_bacteria 2932818245 2932825943 563
322 iso_pu_bacteria 2932828146 2932832545 563
323 iso_pu_bacteria 2933577622 2933578248 563
324 iso_pu_bacteria 2935608549 2935610881 563
325 iso_pu_bacteria 2935616580 2935619250 563
326 iso_pu_bacteria 2935638405 2935645365 563
327 iso_pu_bacteria 2935648319 2935655451 563
328 iso_pu_bacteria 2935656913 2935664379 563
329 iso_pu_bacteria 2935665750 2935671462 563
330 iso_pu_bacteria 2935675223 2935677300 563
331 iso_pu_bacteria 2935684952 2935691874 563
332 iso_pu_bacteria 2935694250 2935695173 563
333 iso_pu_bacteria 2935703347 2935708100 563
334 iso_pu_bacteria 2935713505 2935719942 563
335 iso_pu_bacteria 2935722832 2935729291 563
336 iso_pu_bacteria 2935732158 2935738849 563
337 iso_pu_bacteria 2935741537 2935747966 563
338 iso_pu_bacteria 2935750917 2935756550 563
339 iso_pu_bacteria 2935760218 2935761471 563
340 iso_pu_bacteria 2935769743 2935776841 563
341 iso_pu_bacteria 2935777560 2935783364 563
342 iso_pu_bacteria 2935785616 2935792718 563
343 iso_pu_bacteria 2935793552 2935800745 563
344 iso_pu_bacteria 2935801545 2935805143 563
345 iso_pu_bacteria 2935810662 2935812212 563
346 iso_pu_bacteria 2935819856 2935820365 563
347 iso_pu_bacteria 2935827899 2935834792 563
348 iso_pu_bacteria 2935837841 2935838995 563
349 iso_pu_bacteria 2935847175 2935849625 563
350 iso_pu_bacteria 2935855204 2935857615 563
351 iso_pu_bacteria 2935864058 2935865169 563
352 iso_pu_bacteria 2935873716 2935881595 563
353 iso_pu_bacteria 2935883170 2935884802 563
354 iso_pu_bacteria 2935908558 2935911580 563
355 iso_pu_bacteria 2935916978 2935919234 563
356 iso_pu_bacteria 2935926038 2935928609 563
357 iso_pu_bacteria 2935934488 2935938254 563
358 iso_pu_bacteria 2935942939 2935945854 563
359 iso_pu_bacteria 2935951376 2935954539 563
360 iso_pu_bacteria 2935967501 2935970426 563
361 iso_pu_bacteria 2935975950 2935979915 563
362 iso_pu_bacteria 2935984226 2935987674 563
363 iso_pu_bacteria 2935992306 2935997379 563
364 iso_pu_bacteria 2936002035 2936005162 563
365 iso_pu_bacteria 2936011229 2936018448 563
366 iso_pu_bacteria 2936019824 2936026919 563
367 iso_pu_bacteria 2936028420 2936035800 563
368 iso_pu_bacteria 2936037263 2936038806 563
369 iso_pu_bacteria 2936046547 2936053879 563
370 iso_pu_bacteria 2936055302 2936061995 563
371 iso_pu_bacteria 2940556831 2940562464 563
372 iso_pu_bacteria 2941538514 2941539685 563
373 iso_pu_bacteria 3005483717 3005486487 563
374 iso_pu_bacteria 3005506211 3005512365 563
375 iso_pu_bacteria 3005587118 3005593480 563
376 iso_pu_bacteria 3005594810 3005597286 563
377 iso_pu_bacteria 8006926726 8006931804 563
378 iso_pu_bacteria 8016511872 8016515363 563
379 iso_pu_bacteria 8016530956 8016536555 563
380 iso_pu_bacteria 8016539877 8016540837 563
381 iso_pu_bacteria 8016548790 8016552413 563
382 iso_pu_bacteria 8016557553 8016560794 563
383 iso_pu_bacteria 8016575299 8016578984 563
384 iso_pu_bacteria 8016583857 8016590642 563
385 iso_pu_bacteria 8016595262 8016598671 563
386 iso_pu_bacteria 8016603502 8016612423 563
387 iso_pu_bacteria 8016613128 8016621389 563
388 iso_pu_bacteria 8016622563 8016628642 563
389 iso_pu_bacteria 8017057580 8017061108 563
390 iso_pu_bacteria 8019530166 8019536266 563
391 iso_pu_bacteria 8019538911 8019543201 563
392 iso_pu_bacteria 8019547302 8019555732 563
393 iso_pu_bacteria 8019576017 8019580582 563
394 iso_pu_bacteria 8019597564 8019603036 563
395 iso_pu_bacteria 8019619141 8019626313 563
396 iso_pu_bacteria 8019638758 8019643491 563
397 iso_pu_bacteria 8019659431 8019663941 563
398 iso_pu_bacteria 8019678201 8019682559 563
399 iso_pu_bacteria 8019687851 8019688217 563
400 iso_pu_bacteria 8055742211 8055748115 563
401 3300005339 Ga0070660_100023198 Ga0070660_1000231982 564
402 3300005578 Ga0068854_100002064 Ga0068854_1000020643 565
403 3300005834 Ga0068851_10000943 Ga0068851_100009438 565
404 3300009093 Ga0105240_10021957 Ga0105240_100219577 565
405 3300009174 Ga0105241_10010595 Ga0105241_100105954 565
406 3300025302 Ga0207426_1008252 Ga0207426_10082522 565
407 3300025911 Ga0207654_10002255 Ga0207654_100022555 565
408 3300025924 Ga0207694_10000275 Ga0207694_1000027513 565
409 3300025949 Ga0207667_10054440 Ga0207667_100544402 565
410 3300026078 Ga0207702_10001387 Ga0207702_1000138717 565
411 3300026116 Ga0207674_10067872 Ga0207674_100678722 565
412 3300010375 Ga0105239_10029450 Ga0105239_100294504 566
413 3300025261 Ga0209233_1007720 Ga0209233_10077202 566
414 3300025297 Ga0209758_1000985 Ga0209758_100098528 566
415 3300044684 Ga0466966_0002410 Ga0466966_0002410_8738_10618 566
416 3300044693 Ga0466961_0000240 Ga0466961_0000240_26151_28031 566
417 3300044706 Ga0466964_0009651 Ga0466964_0009651_168_2042 566
418 3300045049 Ga0466959_0004716 Ga0466959_0004716_91_1971 566
419 3300048915 Ga0496112_0046077 Ga0496112_0046077_1667_3544 566
420 3300003215 JGI25153J46596_10002666 JGI25153J46596_100026662 567
421 3300005262 Ga0065165_1002309 Ga0065165_10023097 567
422 3300005262 Ga0065165_1004193 Ga0065165_10041936 567
423 3300006942 Ga0099824_1011927 Ga0099824_10119276 567
424 3300006944 Ga0099823_1045581 Ga0099823_10455812 567
425 3300009545 Ga0105237_10017363 Ga0105237_100173634 567
426 3300009553 Ga0105249_10075422 Ga0105249_100754222 567
427 3300021320 Ga0214544_1000467 Ga0214544_10004678 567
428 3300021321 Ga0214542_1000185 Ga0214542_100018576 567
429 3300021324 Ga0214545_1000102 Ga0214545_10001028 567
430 3300021327 Ga0214543_1000211 Ga0214543_10002116 567
431 3300025230 Ga0209563_101556 Ga0209563_1015564 567
432 3300025297 Ga0209758_1003767 Ga0209758_10037672 567
433 3300025302 Ga0207426_1000848 Ga0207426_10008488 567
434 3300025302 Ga0207426_1001401 Ga0207426_10014018 567
435 3300025904 Ga0207647_10020095 Ga0207647_100200952 567
436 3300025919 Ga0207657_10037293 Ga0207657_100372932 567
437 3300027296 Ga0209389_1000011 Ga0209389_1000011228 567
438 3300027296 Ga0209389_1003633 Ga0209389_10036335 567
439 3300027357 Ga0209589_1011417 Ga0209589_10114175 567
440 3300027361 Ga0209489_100017 Ga0209489_1000176 567
441 3300027361 Ga0209489_100144 Ga0209489_1001447 567
442 3300027363 Ga0209700_100027 Ga0209700_100027229 567
443 3300033180 Ga0307510_10051848 Ga0307510_100518482 567
444 3300037471 Ga0395905_0069164 Ga0395905_0069164_432_2315 567
445 3300046460 Ga0495638_0001809 Ga0495638_0001809_8302_10185 567
446 3300046522 Ga0495643_0014376 Ga0495643_0014376_860_2743 567
447 3300046524 Ga0495648_0055556 Ga0495648_0055556_426_2309 567
448 3300046542 Ga0495597_0033085 Ga0495597_0033085_30_1913 567
449 3300048907 Ga0496104_0035503 Ga0496104_0035503_1767_3650 567
450 3300048911 Ga0496108_0011825 Ga0496108_0011825_479_2362 567
451 3300048928 Ga0496125_0066611 Ga0496125_0066611_120_2003 567
452 3300053094 Ga0500566_0003044 Ga0500566_0003044_3235_5118 567
453 3300053108 Ga0500562_001110 Ga0500562_001110_945_2828 567
454 3300053151 Ga0500604_0011785 Ga0500604_0011785_95_1978 567
455 3300053156 Ga0500622_0006609 Ga0500622_0006609_3171_5054 567
456 3300053160 Ga0500633_0003943 Ga0500633_0003943_517_2400 567
457 3300053177 Ga0500636_0000779 Ga0500636_0000779_6917_8800 567
458 3300003203 JGI25406J46586_10000062 JGI25406J46586_1000006240 571
459 3300005985 Ga0081539_10000008 Ga0081539_10000008299 571
460 3300048915 Ga0496112_0000059 Ga0496112_0000059_69533_71413 571

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

7

36

0.95

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

580

625

0.94

PF22638

FlgK_D1

Flagellar hook-associated protein FlgK helical domain

89

339

0.9

Feature Viewer

pLDDT pTM Quality
64.41 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map