F448227
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 458 | 311 | 456 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10106486|Ga0316576_101064862 |
| Length | 169 |
| Sequence | MDDFDGPSHSRWECKYRVVFIPKCRRKVPYGQRRAHLGEVFHKLARHKESRIEEGHLMADHVHMLVAIPPKYAVSEVVGYIKGKSAIHVARVYAERQRNYRGQHFWACGYFVSTVGRDETMIQAYIQHREAEDQRLEQLNLWRCPAAFRRHKNRGAALATPCRFERLTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 2 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 94 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 172 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 173 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 176 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 177 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 178 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 212 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 213 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 218 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 221 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 222 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 223 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 224 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 230 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 1.53 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.62 |
| Nodule | 0 |
| Rhizoplane | 2.62 |
| Rhizosphere | 92.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1046128 | 3300002070 | Bacteria | 670 |
| 2 | Ga0055527_1000047 | 3300003760 | Bacteria | 109679 |
| 3 | Ga0055535_1000040 | 3300003761 | Bacteria | 157988 |
| 4 | Ga0055542_1000065 | 3300003762 | Bacteria | 157988 |
| 5 | Ga0055529_1000094 | 3300003763 | Bacteria | 134217 |
| 6 | Ga0065712_10635585 | 3300005290 | Bacteria | 574 |
| 7 | Ga0070683_101127471 | 3300005329 | Bacteria | 754 |
| 8 | Ga0070690_100453007 | 3300005330 | Bacteria | 952 |
| 9 | Ga0070682_100074719 | 3300005337 | Bacteria | 2177 |
| 10 | Ga0068868_100853897 | 3300005338 | Bacteria | 825 |
| 11 | Ga0068868_101054176 | 3300005338 | Bacteria | 746 |
| 12 | Ga0070660_100083418 | 3300005339 | Bacteria | 2510 |
| 13 | Ga0070692_10602326 | 3300005345 | Bacteria | 727 |
| 14 | Ga0070669_100536134 | 3300005353 | Bacteria | 974 |
| 15 | Ga0070669_100853915 | 3300005353 | Bacteria | 776 |
| 16 | Ga0070671_100860411 | 3300005355 | Bacteria | 791 |
| 17 | Ga0070673_100956958 | 3300005364 | Unclassified | 796 |
| 18 | Ga0070688_100703678 | 3300005365 | Bacteria | 783 |
| 19 | Ga0070667_101936594 | 3300005367 | Bacteria | 555 |
| 20 | Ga0070709_10429595 | 3300005434 | Bacteria | 991 |
| 21 | Ga0070709_10438805 | 3300005434 | Bacteria | 982 |
| 22 | Ga0070709_10491484 | 3300005434 | Bacteria | 931 |
| 23 | Ga0070714_100918763 | 3300005435 | Bacteria | 850 |
| 24 | Ga0070714_101186598 | 3300005435 | Bacteria | 744 |
| 25 | Ga0070713_101458311 | 3300005436 | Bacteria | 664 |
| 26 | Ga0070710_10372311 | 3300005437 | Bacteria | 951 |
| 27 | Ga0070711_100398430 | 3300005439 | Bacteria | 1117 |
| 28 | Ga0070705_101254996 | 3300005440 | Bacteria | 612 |
| 29 | Ga0070700_101479886 | 3300005441 | Bacteria | 576 |
| 30 | Ga0070694_100721234 | 3300005444 | Bacteria | 812 |
| 31 | Ga0070694_101397533 | 3300005444 | Bacteria | 590 |
| 32 | Ga0070663_100198277 | 3300005455 | Bacteria | 1565 |
| 33 | Ga0070663_100233439 | 3300005455 | Bacteria | 1449 |
| 34 | Ga0070662_101571732 | 3300005457 | Bacteria | 567 |
| 35 | Ga0070681_10026469 | 3300005458 | Bacteria | 5828 |
| 36 | Ga0070681_10239846 | 3300005458 | Bacteria | 1727 |
| 37 | Ga0070681_10378395 | 3300005458 | Bacteria | 1326 |
| 38 | Ga0070706_100277064 | 3300005467 | Bacteria | 1565 |
| 39 | Ga0070706_100596298 | 3300005467 | Bacteria | 1027 |
| 40 | Ga0070707_101051045 | 3300005468 | Bacteria | 780 |
| 41 | Ga0070698_100277609 | 3300005471 | Bacteria | 1607 |
| 42 | Ga0070698_101135637 | 3300005471 | Bacteria | 730 |
| 43 | Ga0070698_101251550 | 3300005471 | Bacteria | 692 |
| 44 | Ga0070699_100050827 | 3300005518 | Bacteria | 3589 |
| 45 | Ga0070699_100294429 | 3300005518 | Unclassified | 1455 |
| 46 | Ga0070699_100906135 | 3300005518 | Bacteria | 808 |
| 47 | Ga0070679_101300199 | 3300005530 | Unclassified | 673 |
| 48 | Ga0070684_100100902 | 3300005535 | Bacteria | 2578 |
| 49 | Ga0070697_100789459 | 3300005536 | Bacteria | 840 |
| 50 | Ga0068853_100685871 | 3300005539 | Bacteria | 977 |
| 51 | Ga0070672_100707494 | 3300005543 | Bacteria | 882 |
| 52 | Ga0070695_100045055 | 3300005545 | Bacteria | 2810 |
| 53 | Ga0070695_100658871 | 3300005545 | Bacteria | 827 |
| 54 | Ga0070695_101243824 | 3300005545 | Bacteria | 613 |
| 55 | Ga0070696_101428505 | 3300005546 | Bacteria | 590 |
| 56 | Ga0070693_100521570 | 3300005547 | Bacteria | 846 |
| 57 | Ga0070693_101109696 | 3300005547 | Bacteria | 603 |
| 58 | Ga0070704_100818511 | 3300005549 | Bacteria | 833 |
| 59 | Ga0070704_100867681 | 3300005549 | Bacteria | 810 |
| 60 | Ga0070704_101986318 | 3300005549 | Bacteria | 540 |
| 61 | Ga0068855_100479957 | 3300005563 | Bacteria | 1353 |
| 62 | Ga0068855_101941631 | 3300005563 | Bacteria | 595 |
| 63 | Ga0068857_100342390 | 3300005577 | Bacteria | 1383 |
| 64 | Ga0068854_100077806 | 3300005578 | Bacteria | 2442 |
| 65 | Ga0068856_100991469 | 3300005614 | Bacteria | 858 |
| 66 | Ga0070702_100721925 | 3300005615 | Bacteria | 762 |
| 67 | Ga0068859_102038478 | 3300005617 | Bacteria | 633 |
| 68 | Ga0068866_10649197 | 3300005718 | Bacteria | 718 |
| 69 | Ga0068861_100287902 | 3300005719 | Bacteria | 1417 |
| 70 | Ga0068858_100587046 | 3300005842 | Bacteria | 1080 |
| 71 | Ga0068860_101983935 | 3300005843 | Bacteria | 603 |
| 72 | Ga0068862_100106431 | 3300005844 | Bacteria | 2459 |
| 73 | Ga0070717_10632632 | 3300006028 | Bacteria | 971 |
| 74 | Ga0075363_100228104 | 3300006048 | Bacteria | 1069 |
| 75 | Ga0070715_10187417 | 3300006163 | Bacteria | 1042 |
| 76 | Ga0070715_10264044 | 3300006163 | Bacteria | 905 |
| 77 | Ga0070716_100498626 | 3300006173 | Bacteria | 898 |
| 78 | Ga0070716_101220228 | 3300006173 | Bacteria | 605 |
| 79 | Ga0070712_101128404 | 3300006175 | Bacteria | 681 |
| 80 | Ga0097621_100862039 | 3300006237 | Bacteria | 842 |
| 81 | Ga0068871_100693691 | 3300006358 | Bacteria | 932 |
| 82 | Ga0075428_100992920 | 3300006844 | Bacteria | 889 |
| 83 | Ga0075430_100771026 | 3300006846 | Bacteria | 793 |
| 84 | Ga0075431_100016443 | 3300006847 | Bacteria | 7509 |
| 85 | Ga0075431_100679146 | 3300006847 | Bacteria | 1009 |
| 86 | Ga0075431_101031841 | 3300006847 | Bacteria | 788 |
| 87 | Ga0075433_10388663 | 3300006852 | Bacteria | 1231 |
| 88 | Ga0075434_100217732 | 3300006871 | Bacteria | 1929 |
| 89 | Ga0075434_100865874 | 3300006871 | Bacteria | 919 |
| 90 | Ga0075434_100963393 | 3300006871 | Bacteria | 867 |
| 91 | Ga0068865_100231283 | 3300006881 | Bacteria | 1450 |
| 92 | Ga0075436_100230804 | 3300006914 | Bacteria | 1315 |
| 93 | Ga0097620_102038430 | 3300006931 | Bacteria | 633 |
| 94 | Ga0111539_10178683 | 3300009094 | Bacteria | 2479 |
| 95 | Ga0111539_11692686 | 3300009094 | Bacteria | 733 |
| 96 | Ga0105245_11433690 | 3300009098 | Bacteria | 741 |
| 97 | Ga0105247_10825677 | 3300009101 | Bacteria | 709 |
| 98 | Ga0114129_10058539 | 3300009147 | Bacteria | 5389 |
| 99 | Ga0114129_11376588 | 3300009147 | Bacteria | 871 |
| 100 | Ga0114129_12001204 | 3300009147 | Bacteria | 701 |
| 101 | Ga0105241_10563000 | 3300009174 | Bacteria | 1025 |
| 102 | Ga0105242_10228655 | 3300009176 | Bacteria | 1666 |
| 103 | Ga0105248_11220316 | 3300009177 | Bacteria | 850 |
| 104 | Ga0105248_11699531 | 3300009177 | Bacteria | 715 |
| 105 | Ga0105237_10988888 | 3300009545 | Bacteria | 848 |
| 106 | Ga0105237_11112163 | 3300009545 | Bacteria | 797 |
| 107 | Ga0105238_10476632 | 3300009551 | Bacteria | 1247 |
| 108 | Ga0105249_10538851 | 3300009553 | Bacteria | 1217 |
| 109 | Ga0105249_11304806 | 3300009553 | Bacteria | 797 |
| 110 | Ga0105239_10676847 | 3300010375 | Bacteria | 1179 |
| 111 | Ga0105239_10989810 | 3300010375 | Bacteria | 967 |
| 112 | Ga0105239_11057186 | 3300010375 | Bacteria | 934 |
| 113 | Ga0105246_11731199 | 3300011119 | Bacteria | 595 |
| 114 | Ga0157370_10382114 | 3300013104 | Bacteria | 1297 |
| 115 | Ga0157370_10496921 | 3300013104 | Bacteria | 1120 |
| 116 | Ga0157374_11480656 | 3300013296 | Bacteria | 702 |
| 117 | Ga0157378_13053917 | 3300013297 | Bacteria | 519 |
| 118 | Ga0163162_10066964 | 3300013306 | Bacteria | 3641 |
| 119 | Ga0163162_10779669 | 3300013306 | Bacteria | 1074 |
| 120 | Ga0157372_10396241 | 3300013307 | Bacteria | 1609 |
| 121 | Ga0157372_10799170 | 3300013307 | Bacteria | 1096 |
| 122 | Ga0163163_11819296 | 3300014325 | Bacteria | 669 |
| 123 | Ga0157377_10325929 | 3300014745 | Bacteria | 1022 |
| 124 | Ga0157379_10965502 | 3300014968 | Bacteria | 811 |
| 125 | Ga0157379_11012666 | 3300014968 | Bacteria | 792 |
| 126 | Ga0157376_11066557 | 3300014969 | Bacteria | 833 |
| 127 | Ga0213873_10053173 | 3300021358 | Bacteria | 1078 |
| 128 | Ga0213873_10137557 | 3300021358 | Unclassified | 727 |
| 129 | Ga0213873_10227690 | 3300021358 | Bacteria | 585 |
| 130 | Ga0213872_10138202 | 3300021361 | Bacteria | 1070 |
| 131 | Ga0213872_10192724 | 3300021361 | Bacteria | 876 |
| 132 | Ga0213871_10041915 | 3300021441 | Bacteria | 1231 |
| 133 | Ga0213871_10130916 | 3300021441 | Bacteria | 753 |
| 134 | Ga0213871_10142915 | 3300021441 | Bacteria | 724 |
| 135 | Ga0213871_10193799 | 3300021441 | Bacteria | 632 |
| 136 | Ga0209674_100553 | 3300025226 | Bacteria | 14873 |
| 137 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 138 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 139 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 140 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 141 | Ga0207692_10595538 | 3300025898 | Bacteria | 710 |
| 142 | Ga0207710_10612875 | 3300025900 | Bacteria | 569 |
| 143 | Ga0207688_10242653 | 3300025901 | Bacteria | 1090 |
| 144 | Ga0207647_10076536 | 3300025904 | Bacteria | 2013 |
| 145 | Ga0207685_10542285 | 3300025905 | Bacteria | 618 |
| 146 | Ga0207699_10656293 | 3300025906 | Bacteria | 766 |
| 147 | Ga0207645_10803453 | 3300025907 | Unclassified | 640 |
| 148 | Ga0207643_10279885 | 3300025908 | Bacteria | 1034 |
| 149 | Ga0207654_10342711 | 3300025911 | Bacteria | 1027 |
| 150 | Ga0207707_10024709 | 3300025912 | Bacteria | 5257 |
| 151 | Ga0207707_10969825 | 3300025912 | Bacteria | 699 |
| 152 | Ga0207671_10983403 | 3300025914 | Bacteria | 665 |
| 153 | Ga0207693_10414517 | 3300025915 | Bacteria | 1053 |
| 154 | Ga0207693_10540971 | 3300025915 | Bacteria | 909 |
| 155 | Ga0207663_10864259 | 3300025916 | Bacteria | 722 |
| 156 | Ga0207662_10280283 | 3300025918 | Bacteria | 1103 |
| 157 | Ga0207657_10573572 | 3300025919 | Bacteria | 881 |
| 158 | Ga0207652_11391526 | 3300025921 | Unclassified | 605 |
| 159 | Ga0207646_10370066 | 3300025922 | Bacteria | 1295 |
| 160 | Ga0207646_10837673 | 3300025922 | Bacteria | 818 |
| 161 | Ga0207681_10160577 | 3300025923 | Bacteria | 1694 |
| 162 | Ga0207687_10638361 | 3300025927 | Bacteria | 900 |
| 163 | Ga0207664_11438939 | 3300025929 | Bacteria | 610 |
| 164 | Ga0207690_10476352 | 3300025932 | Bacteria | 1007 |
| 165 | Ga0207690_11515198 | 3300025932 | Bacteria | 561 |
| 166 | Ga0207706_10603088 | 3300025933 | Bacteria | 943 |
| 167 | Ga0207706_11309970 | 3300025933 | Bacteria | 598 |
| 168 | Ga0207706_11424231 | 3300025933 | Bacteria | 568 |
| 169 | Ga0207686_10190337 | 3300025934 | Bacteria | 1462 |
| 170 | Ga0207670_11011685 | 3300025936 | Bacteria | 699 |
| 171 | Ga0207665_10233400 | 3300025939 | Bacteria | 1353 |
| 172 | Ga0207665_10380993 | 3300025939 | Bacteria | 1070 |
| 173 | Ga0207665_10578300 | 3300025939 | Bacteria | 875 |
| 174 | Ga0207665_10660967 | 3300025939 | Bacteria | 820 |
| 175 | Ga0207665_11146266 | 3300025939 | Bacteria | 620 |
| 176 | Ga0207661_10004684 | 3300025944 | Bacteria | 9580 |
| 177 | Ga0207661_11648697 | 3300025944 | Bacteria | 586 |
| 178 | Ga0207667_10180919 | 3300025949 | Bacteria | 2165 |
| 179 | Ga0207651_10810261 | 3300025960 | Unclassified | 830 |
| 180 | Ga0207712_10013165 | 3300025961 | Bacteria | 5302 |
| 181 | Ga0207712_11612294 | 3300025961 | Bacteria | 582 |
| 182 | Ga0207640_10603904 | 3300025981 | Bacteria | 929 |
| 183 | Ga0207677_11060385 | 3300026023 | Bacteria | 737 |
| 184 | Ga0207703_11333272 | 3300026035 | Bacteria | 690 |
| 185 | Ga0207639_10492281 | 3300026041 | Bacteria | 1119 |
| 186 | Ga0207708_11737985 | 3300026075 | Bacteria | 548 |
| 187 | Ga0207702_10775436 | 3300026078 | Bacteria | 947 |
| 188 | Ga0207641_11790587 | 3300026088 | Bacteria | 616 |
| 189 | Ga0207674_10207119 | 3300026116 | Bacteria | 1910 |
| 190 | Ga0207674_10372444 | 3300026116 | Bacteria | 1380 |
| 191 | Ga0207675_100993000 | 3300026118 | Bacteria | 858 |
| 192 | Ga0207683_11206855 | 3300026121 | Bacteria | 701 |
| 193 | Ga0209973_1031648 | 3300027252 | Bacteria | 748 |
| 194 | Ga0209969_1046010 | 3300027360 | Bacteria | 681 |
| 195 | Ga0209981_1025772 | 3300027378 | Bacteria | 852 |
| 196 | Ga0209968_1024579 | 3300027526 | Bacteria | 989 |
| 197 | Ga0209999_1035880 | 3300027543 | Bacteria | 925 |
| 198 | Ga0209982_1065821 | 3300027552 | Bacteria | 592 |
| 199 | Ga0209970_1026303 | 3300027614 | Bacteria | 999 |
| 200 | Ga0210002_1007086 | 3300027617 | Bacteria | 1699 |
| 201 | Ga0209983_1015788 | 3300027665 | Bacteria | 1557 |
| 202 | Ga0209971_1038646 | 3300027682 | Bacteria | 1149 |
| 203 | Ga0209998_10030986 | 3300027717 | Bacteria | 1184 |
| 204 | Ga0209974_10004695 | 3300027876 | Bacteria | 4851 |
| 205 | Ga0207428_10211156 | 3300027907 | Bacteria | 1458 |
| 206 | Ga0268265_10973561 | 3300028380 | Bacteria | 837 |
| 207 | Ga0268264_10016914 | 3300028381 | Bacteria | 5969 |
| 208 | Ga0268264_10973953 | 3300028381 | Bacteria | 854 |
| 209 | Ga0265338_10700458 | 3300028800 | Bacteria | 699 |
| 210 | Ga0265338_10940559 | 3300028800 | Bacteria | 587 |
| 211 | Ga0265324_10200163 | 3300029957 | Bacteria | 678 |
| 212 | Ga0265324_10215765 | 3300029957 | Bacteria | 651 |
| 213 | Ga0265760_10076855 | 3300031090 | Bacteria | 1030 |
| 214 | Ga0265760_10128797 | 3300031090 | Bacteria | 817 |
| 215 | Ga0265330_10268696 | 3300031235 | Bacteria | 718 |
| 216 | Ga0265332_10173865 | 3300031238 | Bacteria | 898 |
| 217 | Ga0265325_10223980 | 3300031241 | Bacteria | 859 |
| 218 | Ga0265329_10199866 | 3300031242 | Bacteria | 657 |
| 219 | Ga0265340_10247740 | 3300031247 | Bacteria | 794 |
| 220 | Ga0265339_10313557 | 3300031249 | Bacteria | 745 |
| 221 | Ga0265331_10201880 | 3300031250 | Bacteria | 895 |
| 222 | Ga0265331_10314363 | 3300031250 | Bacteria | 701 |
| 223 | Ga0265327_10197494 | 3300031251 | Bacteria | 912 |
| 224 | Ga0265327_10259601 | 3300031251 | Bacteria | 772 |
| 225 | Ga0265316_10253339 | 3300031344 | Bacteria | 1292 |
| 226 | Ga0265316_10454703 | 3300031344 | Bacteria | 918 |
| 227 | Ga0265316_10626558 | 3300031344 | Bacteria | 761 |
| 228 | Ga0265316_10642822 | 3300031344 | Bacteria | 750 |
| 229 | Ga0265316_10971228 | 3300031344 | Bacteria | 592 |
| 230 | Ga0307513_10193864 | 3300031456 | Bacteria | 1880 |
| 231 | Ga0307509_10566042 | 3300031507 | Bacteria | 812 |
| 232 | Ga0307509_10646745 | 3300031507 | Bacteria | 726 |
| 233 | Ga0265313_10219450 | 3300031595 | Bacteria | 784 |
| 234 | Ga0316579_10077185 | 3300031691 | Bacteria | 1583 |
| 235 | Ga0316579_10142428 | 3300031691 | Bacteria | 1156 |
| 236 | Ga0316579_10412035 | 3300031691 | Bacteria | 653 |
| 237 | Ga0265314_10398822 | 3300031711 | Bacteria | 744 |
| 238 | Ga0265342_10304014 | 3300031712 | Bacteria | 839 |
| 239 | Ga0265342_10509273 | 3300031712 | Bacteria | 613 |
| 240 | Ga0316576_10006116 | 3300031727 | Bacteria | 7452 |
| 241 | Ga0316576_10106486 | 3300031727 | Bacteria | 2099 |
| 242 | Ga0316576_10502649 | 3300031727 | Bacteria | 891 |
| 243 | Ga0316578_10019991 | 3300031728 | Bacteria | 3694 |
| 244 | Ga0316578_10026309 | 3300031728 | Bacteria | 3280 |
| 245 | Ga0316578_10072887 | 3300031728 | Bacteria | 2034 |
| 246 | Ga0316578_10311851 | 3300031728 | Bacteria | 940 |
| 247 | Ga0316578_10337165 | 3300031728 | Bacteria | 898 |
| 248 | Ga0316578_10665384 | 3300031728 | Unclassified | 607 |
| 249 | Ga0316577_10022896 | 3300031733 | Bacteria | 3469 |
| 250 | Ga0316577_10237518 | 3300031733 | Bacteria | 1030 |
| 251 | Ga0316577_10241282 | 3300031733 | Bacteria | 1022 |
| 252 | Ga0316577_10441313 | 3300031733 | Bacteria | 739 |
| 253 | Ga0307416_102067138 | 3300032002 | Bacteria | 672 |
| 254 | Ga0316583_10009252 | 3300032133 | Bacteria | 3551 |
| 255 | Ga0316583_10035173 | 3300032133 | Bacteria | 1778 |
| 256 | Ga0316583_10047298 | 3300032133 | Bacteria | 1517 |
| 257 | Ga0316583_10060460 | 3300032133 | Bacteria | 1329 |
| 258 | Ga0316583_10187099 | 3300032133 | Bacteria | 719 |
| 259 | Ga0316583_10188431 | 3300032133 | Bacteria | 717 |
| 260 | Ga0316585_10002548 | 3300032137 | Bacteria | 4926 |
| 261 | Ga0316585_10012063 | 3300032137 | Bacteria | 2555 |
| 262 | Ga0316585_10112941 | 3300032137 | Bacteria | 893 |
| 263 | Ga0316585_10260000 | 3300032137 | Bacteria | 575 |
| 264 | Ga0316580_10001639 | 3300032139 | Bacteria | 5927 |
| 265 | Ga0316580_10168399 | 3300032139 | Bacteria | 673 |
| 266 | Ga0316592_1070459 | 3300033524 | Bacteria | 790 |
| 267 | Ga0316586_1008087 | 3300033527 | Bacteria | 1550 |
| 268 | Ga0316588_1037895 | 3300033528 | Bacteria | 1147 |
| 269 | Ga0316587_1001281 | 3300033529 | Bacteria | 3041 |
| 270 | Ga0316587_1027284 | 3300033529 | Bacteria | 998 |
| 271 | Ga0373958_0135454 | 3300034819 | Bacteria | 606 |
| 272 | Ga0373958_0214945 | 3300034819 | Bacteria | 509 |
| 273 | Ga0373959_0056629 | 3300034820 | Bacteria | 859 |
| 274 | Ga0373928_0196360 | 3300035084 | Bacteria | 580 |
| 275 | Ga0373934_0153642 | 3300035086 | Bacteria | 943 |
| 276 | Ga0373940_0106804 | 3300035088 | Bacteria | 855 |
| 277 | Ga0373940_0215988 | 3300035088 | Bacteria | 635 |
| 278 | Ga0373923_0473208 | 3300035111 | Bacteria | 609 |
| 279 | Ga0373932_0196234 | 3300035112 | Bacteria | 715 |
| 280 | Ga0373932_0283180 | 3300035112 | Bacteria | 614 |
| 281 | Ga0373939_0292347 | 3300035114 | Bacteria | 647 |
| 282 | Ga0373941_0422068 | 3300035115 | Bacteria | 555 |
| 283 | Ga0373953_0032090 | 3300035117 | Bacteria | 2046 |
| 284 | Ga0373954_0251964 | 3300035118 | Bacteria | 869 |
| 285 | Ga0373954_0345609 | 3300035118 | Bacteria | 734 |
| 286 | Ga0373956_0009228 | 3300035119 | Bacteria | 4004 |
| 287 | Ga0373957_0007945 | 3300035120 | Bacteria | 3416 |
| 288 | Ga0373957_0228484 | 3300035120 | Bacteria | 780 |
| 289 | Ga0373960_0228640 | 3300035121 | Bacteria | 668 |
| 290 | Ga0373955_0067013 | 3300035172 | Bacteria | 1997 |
| 291 | Ga0373955_0744022 | 3300035172 | Bacteria | 602 |
| 292 | Ga0373961_0229985 | 3300035241 | Bacteria | 664 |
| 293 | Ga0373962_0170633 | 3300035242 | Bacteria | 722 |
| 294 | Ga0316574_0001361 | 3300035398 | Bacteria | 11506 |
| 295 | Ga0316574_0130340 | 3300035398 | Bacteria | 1618 |
| 296 | Ga0316574_0434028 | 3300035398 | Bacteria | 824 |
| 297 | Ga0316574_0913764 | 3300035398 | Bacteria | 531 |
| 298 | Ga0373924_0100156 | 3300035410 | Bacteria | 1246 |
| 299 | Ga0373924_0201094 | 3300035410 | Bacteria | 879 |
| 300 | Ga0373931_0383824 | 3300035691 | Bacteria | 886 |
| 301 | Ga0373935_1065550 | 3300035692 | Bacteria | 601 |
| 302 | Ga0373935_1148527 | 3300035692 | Bacteria | 578 |
| 303 | Ga0373927_0557884 | 3300035695 | Bacteria | 757 |
| 304 | Ga0373933_0068163 | 3300035724 | Bacteria | 2160 |
| 305 | Ga0373933_0171011 | 3300035724 | Bacteria | 1383 |
| 306 | Ga0373933_0435896 | 3300035724 | Bacteria | 856 |
| 307 | Ga0373947_0170145 | 3300035725 | Bacteria | 1413 |
| 308 | Ga0373947_0796822 | 3300035725 | Bacteria | 645 |
| 309 | Ga0373947_1193402 | 3300035725 | Bacteria | 518 |
| 310 | Ga0373937_0055138 | 3300036401 | Bacteria | 3648 |
| 311 | Ga0373937_0362310 | 3300036401 | Bacteria | 1374 |
| 312 | Ga0373937_0772338 | 3300036401 | Bacteria | 908 |
| 313 | Ga0373937_0803726 | 3300036401 | Bacteria | 888 |
| 314 | Ga0316582_0574279 | 3300036647 | Bacteria | 776 |
| 315 | Ga0316582_0879531 | 3300036647 | Bacteria | 613 |
| 316 | Ga0316584_0425482 | 3300036712 | Bacteria | 942 |
| 317 | Ga0316584_0700651 | 3300036712 | Bacteria | 694 |
| 318 | Ga0395900_1548816 | 3300037418 | Bacteria | 575 |
| 319 | Ga0395905_0965788 | 3300037471 | Bacteria | 755 |
| 320 | Ga0400486_25273 | 3300038742 | Bacteria | 2231 |
| 321 | Ga0242420_002770 | 3300038996 | Bacteria | 2535 |
| 322 | Ga0400487_36462 | 3300039110 | Bacteria | 2368 |
| 323 | Ga0436360_0369323 | 3300039438 | Bacteria | 948 |
| 324 | Ga0436360_0468036 | 3300039438 | Bacteria | 2049 |
| 325 | Ga0436360_0628886 | 3300039438 | Bacteria | 973 |
| 326 | Ga0436360_0979164 | 3300039438 | Bacteria | 1052 |
| 327 | Ga0436360_1195181 | 3300039438 | Bacteria | 703 |
| 328 | Ga0436360_1211632 | 3300039438 | Bacteria | 1147 |
| 329 | Ga0436361_0129794 | 3300039447 | Unclassified | 587 |
| 330 | Ga0436361_0239872 | 3300039447 | Bacteria | 6735 |
| 331 | Ga0436361_0320695 | 3300039447 | Bacteria | 697 |
| 332 | Ga0436361_0480685 | 3300039447 | Bacteria | 629 |
| 333 | Ga0436361_0836684 | 3300039447 | Bacteria | 957 |
| 334 | Ga0436361_0966661 | 3300039447 | Bacteria | 837 |
| 335 | Ga0436361_0985887 | 3300039447 | Unclassified | 992 |
| 336 | Ga0436362_0182241 | 3300039453 | Bacteria | 718 |
| 337 | Ga0436362_0721132 | 3300039453 | Bacteria | 693 |
| 338 | Ga0436362_1033962 | 3300039453 | Bacteria | 804 |
| 339 | Ga0439447_113318 | 3300041407 | Unclassified | 622 |
| 340 | Ga0439461_0085568 | 3300041410 | Bacteria | 749 |
| 341 | Ga0439431_0160406 | 3300041997 | Bacteria | 642 |
| 342 | Ga0439441_028965 | 3300042001 | Bacteria | 1064 |
| 343 | Ga0450913_035135 | 3300042117 | Bacteria | 507 |
| 344 | Ga0450890_017308 | 3300042127 | Bacteria | 959 |
| 345 | Ga0450900_029368 | 3300042136 | Bacteria | 794 |
| 346 | Ga0450905_030072 | 3300042142 | Bacteria | 834 |
| 347 | Ga0439446_0131708 | 3300042156 | Bacteria | 811 |
| 348 | Ga0439434_0126258 | 3300042435 | Unclassified | 837 |
| 349 | Ga0439459_0039360 | 3300042438 | Bacteria | 998 |
| 350 | Ga0439459_0088486 | 3300042438 | Bacteria | 741 |
| 351 | Ga0439464_0223451 | 3300042439 | Bacteria | 604 |
| 352 | Ga0439460_0013328 | 3300042461 | Bacteria | 2149 |
| 353 | Ga0450916_048173 | 3300042530 | Bacteria | 665 |
| 354 | Ga0451577_0939715 | 3300042876 | Bacteria | 778 |
| 355 | Ga0453683_0866911 | 3300044673 | Bacteria | 596 |
| 356 | Ga0466965_0504898 | 3300044683 | Bacteria | 678 |
| 357 | Ga0466966_0400186 | 3300044684 | Bacteria | 825 |
| 358 | Ga0466961_0407135 | 3300044693 | Bacteria | 825 |
| 359 | Ga0466961_0588293 | 3300044693 | Bacteria | 669 |
| 360 | Ga0466963_0490874 | 3300044694 | Bacteria | 867 |
| 361 | Ga0466963_1088997 | 3300044694 | Bacteria | 562 |
| 362 | Ga0466964_0322562 | 3300044706 | Bacteria | 785 |
| 363 | Ga0453684_1031707 | 3300044712 | Bacteria | 873 |
| 364 | Ga0453684_1345869 | 3300044712 | Bacteria | 743 |
| 365 | Ga0453684_1913342 | 3300044712 | Bacteria | 600 |
| 366 | Ga0466971_0225173 | 3300044719 | Unclassified | 889 |
| 367 | Ga0466960_0425184 | 3300044901 | Bacteria | 768 |
| 368 | Ga0466959_0198019 | 3300045049 | Bacteria | 1400 |
| 369 | Ga0466958_0315242 | 3300045836 | Bacteria | 1005 |
| 370 | Ga0466958_0471690 | 3300045836 | Bacteria | 813 |
| 371 | Ga0495592_0623424 | 3300046454 | Bacteria | 656 |
| 372 | Ga0495592_0714649 | 3300046454 | Bacteria | 601 |
| 373 | Ga0495651_0559534 | 3300046462 | Bacteria | 725 |
| 374 | Ga0495653_0436967 | 3300046463 | Bacteria | 825 |
| 375 | Ga0495580_0648195 | 3300046472 | Bacteria | 695 |
| 376 | Ga0495664_0520244 | 3300046477 | Bacteria | 710 |
| 377 | Ga0495608_0778787 | 3300046511 | Bacteria | 565 |
| 378 | Ga0495618_0488513 | 3300046514 | Bacteria | 743 |
| 379 | Ga0495628_0094602 | 3300046516 | Bacteria | 2309 |
| 380 | Ga0495652_0597031 | 3300046529 | Bacteria | 753 |
| 381 | Ga0495640_0625660 | 3300046533 | Bacteria | 649 |
| 382 | Ga0495587_0460103 | 3300046536 | Bacteria | 704 |
| 383 | Ga0495645_0053090 | 3300046543 | Bacteria | 2947 |
| 384 | Ga0495667_0498995 | 3300046559 | Bacteria | 762 |
| 385 | Ga0495634_0502004 | 3300046642 | Bacteria | 711 |
| 386 | Ga0495635_0478256 | 3300046663 | Bacteria | 821 |
| 387 | Ga0495657_0161239 | 3300046675 | Bacteria | 1387 |
| 388 | Ga0495599_0440427 | 3300046678 | Bacteria | 772 |
| 389 | Ga0495646_0509439 | 3300046680 | Bacteria | 617 |
| 390 | Ga0495647_0430069 | 3300046681 | Bacteria | 609 |
| 391 | Ga0495670_0827547 | 3300046691 | Unclassified | 505 |
| 392 | Ga0495604_0273142 | 3300047317 | Bacteria | 1144 |
| 393 | Ga0495604_0326571 | 3300047317 | Bacteria | 1024 |
| 394 | Ga0495636_0020045 | 3300047318 | Bacteria | 2693 |
| 395 | Ga0495674_0592149 | 3300047319 | Bacteria | 879 |
| 396 | Ga0495674_1240728 | 3300047319 | Unclassified | 562 |
| 397 | Ga0495680_0307725 | 3300047322 | Bacteria | 1111 |
| 398 | Ga0495680_0963743 | 3300047322 | Bacteria | 547 |
| 399 | Ga0495675_0552511 | 3300047444 | Bacteria | 656 |
| 400 | Ga0495684_0316777 | 3300047471 | Bacteria | 1116 |
| 401 | Ga0495684_0646863 | 3300047471 | Bacteria | 707 |
| 402 | Ga0495602_0138328 | 3300048088 | Bacteria | 1931 |
| 403 | Ga0495602_0483319 | 3300048088 | Bacteria | 868 |
| 404 | Ga0496100_0536831 | 3300048903 | Bacteria | 904 |
| 405 | Ga0496102_0014212 | 3300048905 | Bacteria | 6917 |
| 406 | Ga0496104_0636884 | 3300048907 | Bacteria | 975 |
| 407 | Ga0496104_0875443 | 3300048907 | Bacteria | 803 |
| 408 | Ga0496105_0080853 | 3300048908 | Bacteria | 2684 |
| 409 | Ga0496106_0002447 | 3300048909 | Bacteria | 13835 |
| 410 | Ga0496107_0026376 | 3300048910 | Bacteria | 4118 |
| 411 | Ga0496107_0614262 | 3300048910 | Bacteria | 803 |
| 412 | Ga0496107_0690500 | 3300048910 | Bacteria | 751 |
| 413 | Ga0496108_1213415 | 3300048911 | Bacteria | 637 |
| 414 | Ga0496113_1040369 | 3300048916 | Bacteria | 644 |
| 415 | Ga0496113_1056771 | 3300048916 | Bacteria | 638 |
| 416 | Ga0496126_0578384 | 3300048929 | Bacteria | 888 |
| 417 | Ga0466983_0399903 | 3300048986 | Bacteria | 993 |
| 418 | Ga0501031_0196781 | 3300049568 | Bacteria | 1315 |
| 419 | Ga0501033_0022991 | 3300049570 | Bacteria | 4699 |
| 420 | Ga0501036_0723926 | 3300049572 | Bacteria | 821 |
| 421 | Ga0501037_0215813 | 3300049573 | Bacteria | 1351 |
| 422 | Ga0501039_0200821 | 3300049575 | Bacteria | 1567 |
| 423 | Ga0501039_0632950 | 3300049575 | Bacteria | 838 |
| 424 | Ga0501040_1116500 | 3300049576 | Bacteria | 572 |
| 425 | Ga0501042_0178443 | 3300049578 | Bacteria | 1532 |
| 426 | Ga0501043_0312737 | 3300049579 | Bacteria | 1198 |
| 427 | Ga0501046_0178048 | 3300049580 | Bacteria | 1592 |
| 428 | Ga0501046_1087331 | 3300049580 | Bacteria | 553 |
| 429 | Ga0501048_0065956 | 3300049582 | Bacteria | 2559 |
| 430 | Ga0501068_0385093 | 3300049584 | Bacteria | 903 |
| 431 | Ga0501070_0179084 | 3300049586 | Bacteria | 1745 |
| 432 | Ga0501073_0564209 | 3300049589 | Bacteria | 786 |
| 433 | Ga0501074_0496179 | 3300049590 | Bacteria | 865 |
| 434 | Ga0501076_1374119 | 3300049592 | Bacteria | 580 |
| 435 | Ga0501035_0467799 | 3300049822 | Bacteria | 1041 |
| 436 | Ga0501044_0872715 | 3300049823 | Bacteria | 775 |
| 437 | Ga0501044_0877719 | 3300049823 | Bacteria | 773 |
| 438 | nmdc:mga00v17_243571_c1 | 3300050491 | Bacteria | 1166 |
| 439 | nmdc:mga0yw44_540307_c1 | 3300050492 | Bacteria | 791 |
| 440 | nmdc:mga05p37_1251570_c1 | 3300050507 | Bacteria | 761 |
| 441 | nmdc:mga05p37_692491_c1 | 3300050507 | Bacteria | 1134 |
| 442 | nmdc:mga0qj67_818773_c1 | 3300050509 | Bacteria | 736 |
| 443 | nmdc:mga06r32_46101_c1 | 3300050510 | Bacteria | 4159 |
| 444 | nmdc:mga06r32_5471_c1 | 3300050510 | Bacteria | 11435 |
| 445 | nmdc:mga08y16_250347_c1 | 3300050511 | Bacteria | 1831 |
| 446 | nmdc:mga0n895_128292_c1 | 3300050512 | Bacteria | 2561 |
| 447 | nmdc:mga0n895_989245_c1 | 3300050512 | Bacteria | 823 |
| 448 | nmdc:mga0a205_157231_c1 | 3300050515 | Bacteria | 2171 |
| 449 | Ga0495601_0630508 | 3300053077 | Bacteria | 686 |
| 450 | Ga0495612_0180253 | 3300053078 | Bacteria | 927 |
| 451 | Ga0495595_0169998 | 3300053084 | Bacteria | 1079 |
| 452 | Ga0495619_0617587 | 3300053085 | Bacteria | 741 |
| 453 | Ga0495619_0728237 | 3300053085 | Bacteria | 673 |
| 454 | Ga0590075_090971 | 3300059424 | Bacteria | 792 |
| 455 | Ga0501082_0153402 | 3300060353 | Bacteria | 2001 |
| 456 | Ga0466962_0154943 | 3300061719 | Bacteria | 1112 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100536134 | Ga0070669_1005361341 | 134 |
| 2 | 3300005471 | Ga0070698_100277609 | Ga0070698_1002776092 | 134 |
| 3 | 3300006881 | Ga0068865_100231283 | Ga0068865_1002312833 | 134 |
| 4 | 3300005518 | Ga0070699_100294429 | Ga0070699_1002944292 | 135 |
| 5 | 3300031691 | Ga0316579_10142428 | Ga0316579_101424282 | 135 |
| 6 | 3300035398 | Ga0316574_0001361 | Ga0316574_0001361_10391_10804 | 135 |
| 7 | 3300005338 | Ga0068868_100853897 | Ga0068868_1008538971 | 138 |
| 8 | 3300005539 | Ga0068853_100685871 | Ga0068853_1006858711 | 138 |
| 9 | 3300009098 | Ga0105245_11433690 | Ga0105245_114336901 | 138 |
| 10 | 3300025927 | Ga0207687_10638361 | Ga0207687_106383612 | 138 |
| 11 | 3300025936 | Ga0207670_11011685 | Ga0207670_110116851 | 138 |
| 12 | 3300026023 | Ga0207677_11060385 | Ga0207677_110603851 | 138 |
| 13 | 3300031090 | Ga0265760_10128797 | Ga0265760_101287972 | 138 |
| 14 | iso_pu_bacteria | 2643221562 | 2643828907 | 139 |
| 15 | iso_pu_bacteria | 3003665799 | 3003667183 | 139 |
| 16 | 3300009147 | Ga0114129_12001204 | Ga0114129_120012041 | 140 |
| 17 | 3300032133 | Ga0316583_10060460 | Ga0316583_100604601 | 140 |
| 18 | 3300005353 | Ga0070669_100853915 | Ga0070669_1008539152 | 141 |
| 19 | 3300005468 | Ga0070707_101051045 | Ga0070707_1010510451 | 141 |
| 20 | 3300005471 | Ga0070698_101251550 | Ga0070698_1012515501 | 141 |
| 21 | 3300005549 | Ga0070704_100818511 | Ga0070704_1008185111 | 141 |
| 22 | 3300006852 | Ga0075433_10388663 | Ga0075433_103886632 | 141 |
| 23 | 3300009101 | Ga0105247_10825677 | Ga0105247_108256771 | 141 |
| 24 | 3300025922 | Ga0207646_10837673 | Ga0207646_108376731 | 141 |
| 25 | 3300035398 | Ga0316574_0130340 | Ga0316574_0130340_842_1270 | 141 |
| 26 | 3300035398 | Ga0316574_0913764 | Ga0316574_0913764_47_472 | 141 |
| 27 | 3300036712 | Ga0316584_0700651 | Ga0316584_0700651_111_539 | 141 |
| 28 | 3300038742 | Ga0400486_25273 | Ga0400486_25273_1426_1857 | 141 |
| 29 | 3300039447 | Ga0436361_0985887 | Ga0436361_0985887_294_725 | 141 |
| 30 | 3300042438 | Ga0439459_0088486 | Ga0439459_0088486_170_607 | 141 |
| 31 | 3300044673 | Ga0453683_0866911 | Ga0453683_0866911_150_578 | 141 |
| 32 | 3300044712 | Ga0453684_1031707 | Ga0453684_1031707_288_728 | 141 |
| 33 | 3300046691 | Ga0495670_0827547 | Ga0495670_0827547_58_495 | 141 |
| 34 | 3300047319 | Ga0495674_1240728 | Ga0495674_1240728_22_456 | 141 |
| 35 | 3300029957 | Ga0265324_10215765 | Ga0265324_102157651 | 142 |
| 36 | 3300031250 | Ga0265331_10201880 | Ga0265331_102018801 | 142 |
| 37 | 3300031691 | Ga0316579_10077185 | Ga0316579_100771853 | 142 |
| 38 | 3300031728 | Ga0316578_10026309 | Ga0316578_100263091 | 142 |
| 39 | 3300031728 | Ga0316578_10311851 | Ga0316578_103118512 | 142 |
| 40 | 3300031733 | Ga0316577_10441313 | Ga0316577_104413131 | 142 |
| 41 | 3300032133 | Ga0316583_10035173 | Ga0316583_100351732 | 142 |
| 42 | 3300032133 | Ga0316583_10047298 | Ga0316583_100472982 | 142 |
| 43 | 3300032133 | Ga0316583_10188431 | Ga0316583_101884311 | 142 |
| 44 | 3300032137 | Ga0316585_10012063 | Ga0316585_100120632 | 142 |
| 45 | 3300032137 | Ga0316585_10112941 | Ga0316585_101129411 | 142 |
| 46 | 3300033529 | Ga0316587_1027284 | Ga0316587_10272842 | 142 |
| 47 | 3300036647 | Ga0316582_0879531 | Ga0316582_0879531_126_554 | 142 |
| 48 | 3300046454 | Ga0495592_0623424 | Ga0495592_0623424_185_613 | 142 |
| 49 | 3300060353 | Ga0501082_0153402 | Ga0501082_0153402_1389_1817 | 142 |
| 50 | 3300002070 | JGI24750J21931_1046128 | JGI24750J21931_10461281 | 143 |
| 51 | 3300003760 | Ga0055527_1000047 | Ga0055527_100004737 | 143 |
| 52 | 3300003761 | Ga0055535_1000040 | Ga0055535_100004080 | 143 |
| 53 | 3300003762 | Ga0055542_1000065 | Ga0055542_100006537 | 143 |
| 54 | 3300003763 | Ga0055529_1000094 | Ga0055529_100009461 | 143 |
| 55 | 3300005290 | Ga0065712_10635585 | Ga0065712_106355851 | 143 |
| 56 | 3300005329 | Ga0070683_101127471 | Ga0070683_1011274711 | 143 |
| 57 | 3300005330 | Ga0070690_100453007 | Ga0070690_1004530072 | 143 |
| 58 | 3300005337 | Ga0070682_100074719 | Ga0070682_1000747191 | 143 |
| 59 | 3300005338 | Ga0068868_101054176 | Ga0068868_1010541761 | 143 |
| 60 | 3300005339 | Ga0070660_100083418 | Ga0070660_1000834183 | 143 |
| 61 | 3300005345 | Ga0070692_10602326 | Ga0070692_106023261 | 143 |
| 62 | 3300005355 | Ga0070671_100860411 | Ga0070671_1008604111 | 143 |
| 63 | 3300005364 | Ga0070673_100956958 | Ga0070673_1009569581 | 143 |
| 64 | 3300005365 | Ga0070688_100703678 | Ga0070688_1007036782 | 143 |
| 65 | 3300005367 | Ga0070667_101936594 | Ga0070667_1019365941 | 143 |
| 66 | 3300005434 | Ga0070709_10429595 | Ga0070709_104295952 | 143 |
| 67 | 3300005434 | Ga0070709_10438805 | Ga0070709_104388052 | 143 |
| 68 | 3300005434 | Ga0070709_10491484 | Ga0070709_104914841 | 143 |
| 69 | 3300005435 | Ga0070714_100918763 | Ga0070714_1009187631 | 143 |
| 70 | 3300005435 | Ga0070714_101186598 | Ga0070714_1011865981 | 143 |
| 71 | 3300005436 | Ga0070713_101458311 | Ga0070713_1014583111 | 143 |
| 72 | 3300005437 | Ga0070710_10372311 | Ga0070710_103723112 | 143 |
| 73 | 3300005439 | Ga0070711_100398430 | Ga0070711_1003984302 | 143 |
| 74 | 3300005440 | Ga0070705_101254996 | Ga0070705_1012549961 | 143 |
| 75 | 3300005441 | Ga0070700_101479886 | Ga0070700_1014798861 | 143 |
| 76 | 3300005444 | Ga0070694_100721234 | Ga0070694_1007212341 | 143 |
| 77 | 3300005444 | Ga0070694_101397533 | Ga0070694_1013975331 | 143 |
| 78 | 3300005455 | Ga0070663_100198277 | Ga0070663_1001982771 | 143 |
| 79 | 3300005455 | Ga0070663_100233439 | Ga0070663_1002334391 | 143 |
| 80 | 3300005457 | Ga0070662_101571732 | Ga0070662_1015717321 | 143 |
| 81 | 3300005458 | Ga0070681_10026469 | Ga0070681_100264696 | 143 |
| 82 | 3300005458 | Ga0070681_10239846 | Ga0070681_102398461 | 143 |
| 83 | 3300005458 | Ga0070681_10378395 | Ga0070681_103783952 | 143 |
| 84 | 3300005467 | Ga0070706_100277064 | Ga0070706_1002770641 | 143 |
| 85 | 3300005467 | Ga0070706_100596298 | Ga0070706_1005962981 | 143 |
| 86 | 3300005471 | Ga0070698_101135637 | Ga0070698_1011356371 | 143 |
| 87 | 3300005518 | Ga0070699_100050827 | Ga0070699_1000508271 | 143 |
| 88 | 3300005518 | Ga0070699_100906135 | Ga0070699_1009061351 | 143 |
| 89 | 3300005530 | Ga0070679_101300199 | Ga0070679_1013001991 | 143 |
| 90 | 3300005535 | Ga0070684_100100902 | Ga0070684_1001009021 | 143 |
| 91 | 3300005536 | Ga0070697_100789459 | Ga0070697_1007894591 | 143 |
| 92 | 3300005543 | Ga0070672_100707494 | Ga0070672_1007074942 | 143 |
| 93 | 3300005545 | Ga0070695_100045055 | Ga0070695_1000450551 | 143 |
| 94 | 3300005545 | Ga0070695_100658871 | Ga0070695_1006588711 | 143 |
| 95 | 3300005545 | Ga0070695_101243824 | Ga0070695_1012438241 | 143 |
| 96 | 3300005546 | Ga0070696_101428505 | Ga0070696_1014285051 | 143 |
| 97 | 3300005547 | Ga0070693_100521570 | Ga0070693_1005215701 | 143 |
| 98 | 3300005547 | Ga0070693_101109696 | Ga0070693_1011096961 | 143 |
| 99 | 3300005549 | Ga0070704_100867681 | Ga0070704_1008676812 | 143 |
| 100 | 3300005549 | Ga0070704_101986318 | Ga0070704_1019863181 | 143 |
| 101 | 3300005563 | Ga0068855_100479957 | Ga0068855_1004799572 | 143 |
| 102 | 3300005563 | Ga0068855_101941631 | Ga0068855_1019416311 | 143 |
| 103 | 3300005577 | Ga0068857_100342390 | Ga0068857_1003423902 | 143 |
| 104 | 3300005578 | Ga0068854_100077806 | Ga0068854_1000778063 | 143 |
| 105 | 3300005614 | Ga0068856_100991469 | Ga0068856_1009914691 | 143 |
| 106 | 3300005615 | Ga0070702_100721925 | Ga0070702_1007219251 | 143 |
| 107 | 3300005617 | Ga0068859_102038478 | Ga0068859_1020384782 | 143 |
| 108 | 3300005718 | Ga0068866_10649197 | Ga0068866_106491971 | 143 |
| 109 | 3300005719 | Ga0068861_100287902 | Ga0068861_1002879021 | 143 |
| 110 | 3300005842 | Ga0068858_100587046 | Ga0068858_1005870461 | 143 |
| 111 | 3300005843 | Ga0068860_101983935 | Ga0068860_1019839351 | 143 |
| 112 | 3300005844 | Ga0068862_100106431 | Ga0068862_1001064313 | 143 |
| 113 | 3300006028 | Ga0070717_10632632 | Ga0070717_106326322 | 143 |
| 114 | 3300006048 | Ga0075363_100228104 | Ga0075363_1002281042 | 143 |
| 115 | 3300006163 | Ga0070715_10187417 | Ga0070715_101874173 | 143 |
| 116 | 3300006163 | Ga0070715_10264044 | Ga0070715_102640443 | 143 |
| 117 | 3300006173 | Ga0070716_100498626 | Ga0070716_1004986261 | 143 |
| 118 | 3300006173 | Ga0070716_101220228 | Ga0070716_1012202281 | 143 |
| 119 | 3300006175 | Ga0070712_101128404 | Ga0070712_1011284041 | 143 |
| 120 | 3300006237 | Ga0097621_100862039 | Ga0097621_1008620391 | 143 |
| 121 | 3300006358 | Ga0068871_100693691 | Ga0068871_1006936912 | 143 |
| 122 | 3300006844 | Ga0075428_100992920 | Ga0075428_1009929202 | 143 |
| 123 | 3300006846 | Ga0075430_100771026 | Ga0075430_1007710262 | 143 |
| 124 | 3300006847 | Ga0075431_100016443 | Ga0075431_1000164433 | 143 |
| 125 | 3300006847 | Ga0075431_100679146 | Ga0075431_1006791461 | 143 |
| 126 | 3300006847 | Ga0075431_101031841 | Ga0075431_1010318411 | 143 |
| 127 | 3300006871 | Ga0075434_100217732 | Ga0075434_1002177323 | 143 |
| 128 | 3300006871 | Ga0075434_100865874 | Ga0075434_1008658742 | 143 |
| 129 | 3300006871 | Ga0075434_100963393 | Ga0075434_1009633932 | 143 |
| 130 | 3300006914 | Ga0075436_100230804 | Ga0075436_1002308041 | 143 |
| 131 | 3300006931 | Ga0097620_102038430 | Ga0097620_1020384301 | 143 |
| 132 | 3300009094 | Ga0111539_10178683 | Ga0111539_101786831 | 143 |
| 133 | 3300009094 | Ga0111539_11692686 | Ga0111539_116926862 | 143 |
| 134 | 3300009147 | Ga0114129_10058539 | Ga0114129_100585392 | 143 |
| 135 | 3300009147 | Ga0114129_11376588 | Ga0114129_113765881 | 143 |
| 136 | 3300009174 | Ga0105241_10563000 | Ga0105241_105630001 | 143 |
| 137 | 3300009176 | Ga0105242_10228655 | Ga0105242_102286551 | 143 |
| 138 | 3300009177 | Ga0105248_11220316 | Ga0105248_112203161 | 143 |
| 139 | 3300009177 | Ga0105248_11699531 | Ga0105248_116995311 | 143 |
| 140 | 3300009545 | Ga0105237_10988888 | Ga0105237_109888881 | 143 |
| 141 | 3300009545 | Ga0105237_11112163 | Ga0105237_111121631 | 143 |
| 142 | 3300009551 | Ga0105238_10476632 | Ga0105238_104766322 | 143 |
| 143 | 3300009553 | Ga0105249_10538851 | Ga0105249_105388512 | 143 |
| 144 | 3300009553 | Ga0105249_11304806 | Ga0105249_113048061 | 143 |
| 145 | 3300010375 | Ga0105239_10676847 | Ga0105239_106768472 | 143 |
| 146 | 3300010375 | Ga0105239_10989810 | Ga0105239_109898102 | 143 |
| 147 | 3300010375 | Ga0105239_11057186 | Ga0105239_110571862 | 143 |
| 148 | 3300011119 | Ga0105246_11731199 | Ga0105246_117311991 | 143 |
| 149 | 3300013104 | Ga0157370_10382114 | Ga0157370_103821142 | 143 |
| 150 | 3300013104 | Ga0157370_10496921 | Ga0157370_104969212 | 143 |
| 151 | 3300013296 | Ga0157374_11480656 | Ga0157374_114806561 | 143 |
| 152 | 3300013297 | Ga0157378_13053917 | Ga0157378_130539171 | 143 |
| 153 | 3300013306 | Ga0163162_10066964 | Ga0163162_100669642 | 143 |
| 154 | 3300013306 | Ga0163162_10779669 | Ga0163162_107796691 | 143 |
| 155 | 3300013307 | Ga0157372_10396241 | Ga0157372_103962413 | 143 |
| 156 | 3300013307 | Ga0157372_10799170 | Ga0157372_107991702 | 143 |
| 157 | 3300014325 | Ga0163163_11819296 | Ga0163163_118192961 | 143 |
| 158 | 3300014745 | Ga0157377_10325929 | Ga0157377_103259291 | 143 |
| 159 | 3300014968 | Ga0157379_10965502 | Ga0157379_109655021 | 143 |
| 160 | 3300014968 | Ga0157379_11012666 | Ga0157379_110126661 | 143 |
| 161 | 3300014969 | Ga0157376_11066557 | Ga0157376_110665571 | 143 |
| 162 | 3300021358 | Ga0213873_10053173 | Ga0213873_100531731 | 143 |
| 163 | 3300021358 | Ga0213873_10137557 | Ga0213873_101375571 | 143 |
| 164 | 3300021358 | Ga0213873_10227690 | Ga0213873_102276901 | 143 |
| 165 | 3300021361 | Ga0213872_10138202 | Ga0213872_101382022 | 143 |
| 166 | 3300021361 | Ga0213872_10192724 | Ga0213872_101927241 | 143 |
| 167 | 3300021441 | Ga0213871_10041915 | Ga0213871_100419152 | 143 |
| 168 | 3300021441 | Ga0213871_10130916 | Ga0213871_101309161 | 143 |
| 169 | 3300021441 | Ga0213871_10142915 | Ga0213871_101429151 | 143 |
| 170 | 3300021441 | Ga0213871_10193799 | Ga0213871_101937991 | 143 |
| 171 | 3300025226 | Ga0209674_100553 | Ga0209674_10055319 | 143 |
| 172 | 3300025228 | Ga0209672_100017 | Ga0209672_10001735 | 143 |
| 173 | 3300025242 | Ga0209258_100038 | Ga0209258_100038277 | 143 |
| 174 | 3300025254 | Ga0209148_1000009 | Ga0209148_10000091177 | 143 |
| 175 | 3300025272 | Ga0209455_1000032 | Ga0209455_100003235 | 143 |
| 176 | 3300025898 | Ga0207692_10595538 | Ga0207692_105955381 | 143 |
| 177 | 3300025900 | Ga0207710_10612875 | Ga0207710_106128751 | 143 |
| 178 | 3300025901 | Ga0207688_10242653 | Ga0207688_102426531 | 143 |
| 179 | 3300025904 | Ga0207647_10076536 | Ga0207647_100765361 | 143 |
| 180 | 3300025905 | Ga0207685_10542285 | Ga0207685_105422851 | 143 |
| 181 | 3300025906 | Ga0207699_10656293 | Ga0207699_106562931 | 143 |
| 182 | 3300025907 | Ga0207645_10803453 | Ga0207645_108034531 | 143 |
| 183 | 3300025908 | Ga0207643_10279885 | Ga0207643_102798852 | 143 |
| 184 | 3300025911 | Ga0207654_10342711 | Ga0207654_103427112 | 143 |
| 185 | 3300025912 | Ga0207707_10024709 | Ga0207707_100247091 | 143 |
| 186 | 3300025912 | Ga0207707_10969825 | Ga0207707_109698251 | 143 |
| 187 | 3300025914 | Ga0207671_10983403 | Ga0207671_109834031 | 143 |
| 188 | 3300025915 | Ga0207693_10414517 | Ga0207693_104145171 | 143 |
| 189 | 3300025915 | Ga0207693_10540971 | Ga0207693_105409712 | 143 |
| 190 | 3300025916 | Ga0207663_10864259 | Ga0207663_108642591 | 143 |
| 191 | 3300025918 | Ga0207662_10280283 | Ga0207662_102802831 | 143 |
| 192 | 3300025919 | Ga0207657_10573572 | Ga0207657_105735721 | 143 |
| 193 | 3300025921 | Ga0207652_11391526 | Ga0207652_113915261 | 143 |
| 194 | 3300025922 | Ga0207646_10370066 | Ga0207646_103700662 | 143 |
| 195 | 3300025923 | Ga0207681_10160577 | Ga0207681_101605773 | 143 |
| 196 | 3300025929 | Ga0207664_11438939 | Ga0207664_114389391 | 143 |
| 197 | 3300025932 | Ga0207690_10476352 | Ga0207690_104763522 | 143 |
| 198 | 3300025932 | Ga0207690_11515198 | Ga0207690_115151981 | 143 |
| 199 | 3300025933 | Ga0207706_10603088 | Ga0207706_106030881 | 143 |
| 200 | 3300025933 | Ga0207706_11309970 | Ga0207706_113099701 | 143 |
| 201 | 3300025933 | Ga0207706_11424231 | Ga0207706_114242311 | 143 |
| 202 | 3300025934 | Ga0207686_10190337 | Ga0207686_101903372 | 143 |
| 203 | 3300025939 | Ga0207665_10233400 | Ga0207665_102334003 | 143 |
| 204 | 3300025939 | Ga0207665_10380993 | Ga0207665_103809931 | 143 |
| 205 | 3300025939 | Ga0207665_10578300 | Ga0207665_105783002 | 143 |
| 206 | 3300025939 | Ga0207665_10660967 | Ga0207665_106609672 | 143 |
| 207 | 3300025939 | Ga0207665_11146266 | Ga0207665_111462661 | 143 |
| 208 | 3300025944 | Ga0207661_10004684 | Ga0207661_100046847 | 143 |
| 209 | 3300025944 | Ga0207661_11648697 | Ga0207661_116486971 | 143 |
| 210 | 3300025949 | Ga0207667_10180919 | Ga0207667_101809192 | 143 |
| 211 | 3300025960 | Ga0207651_10810261 | Ga0207651_108102611 | 143 |
| 212 | 3300025961 | Ga0207712_10013165 | Ga0207712_100131655 | 143 |
| 213 | 3300025961 | Ga0207712_11612294 | Ga0207712_116122941 | 143 |
| 214 | 3300025981 | Ga0207640_10603904 | Ga0207640_106039041 | 143 |
| 215 | 3300026035 | Ga0207703_11333272 | Ga0207703_113332721 | 143 |
| 216 | 3300026041 | Ga0207639_10492281 | Ga0207639_104922811 | 143 |
| 217 | 3300026075 | Ga0207708_11737985 | Ga0207708_117379851 | 143 |
| 218 | 3300026078 | Ga0207702_10775436 | Ga0207702_107754361 | 143 |
| 219 | 3300026088 | Ga0207641_11790587 | Ga0207641_117905871 | 143 |
| 220 | 3300026116 | Ga0207674_10207119 | Ga0207674_102071193 | 143 |
| 221 | 3300026116 | Ga0207674_10372444 | Ga0207674_103724442 | 143 |
| 222 | 3300026118 | Ga0207675_100993000 | Ga0207675_1009930002 | 143 |
| 223 | 3300026121 | Ga0207683_11206855 | Ga0207683_112068551 | 143 |
| 224 | 3300027252 | Ga0209973_1031648 | Ga0209973_10316481 | 143 |
| 225 | 3300027360 | Ga0209969_1046010 | Ga0209969_10460101 | 143 |
| 226 | 3300027378 | Ga0209981_1025772 | Ga0209981_10257721 | 143 |
| 227 | 3300027526 | Ga0209968_1024579 | Ga0209968_10245792 | 143 |
| 228 | 3300027543 | Ga0209999_1035880 | Ga0209999_10358801 | 143 |
| 229 | 3300027552 | Ga0209982_1065821 | Ga0209982_10658211 | 143 |
| 230 | 3300027614 | Ga0209970_1026303 | Ga0209970_10263031 | 143 |
| 231 | 3300027617 | Ga0210002_1007086 | Ga0210002_10070862 | 143 |
| 232 | 3300027665 | Ga0209983_1015788 | Ga0209983_10157881 | 143 |
| 233 | 3300027682 | Ga0209971_1038646 | Ga0209971_10386461 | 143 |
| 234 | 3300027717 | Ga0209998_10030986 | Ga0209998_100309862 | 143 |
| 235 | 3300027876 | Ga0209974_10004695 | Ga0209974_100046956 | 143 |
| 236 | 3300027907 | Ga0207428_10211156 | Ga0207428_102111561 | 143 |
| 237 | 3300028380 | Ga0268265_10973561 | Ga0268265_109735611 | 143 |
| 238 | 3300028381 | Ga0268264_10016914 | Ga0268264_100169148 | 143 |
| 239 | 3300028381 | Ga0268264_10973953 | Ga0268264_109739532 | 143 |
| 240 | 3300028800 | Ga0265338_10700458 | Ga0265338_107004582 | 143 |
| 241 | 3300028800 | Ga0265338_10940559 | Ga0265338_109405591 | 143 |
| 242 | 3300029957 | Ga0265324_10200163 | Ga0265324_102001631 | 143 |
| 243 | 3300031090 | Ga0265760_10076855 | Ga0265760_100768552 | 143 |
| 244 | 3300031235 | Ga0265330_10268696 | Ga0265330_102686961 | 143 |
| 245 | 3300031238 | Ga0265332_10173865 | Ga0265332_101738652 | 143 |
| 246 | 3300031241 | Ga0265325_10223980 | Ga0265325_102239801 | 143 |
| 247 | 3300031242 | Ga0265329_10199866 | Ga0265329_101998661 | 143 |
| 248 | 3300031247 | Ga0265340_10247740 | Ga0265340_102477401 | 143 |
| 249 | 3300031249 | Ga0265339_10313557 | Ga0265339_103135571 | 143 |
| 250 | 3300031250 | Ga0265331_10314363 | Ga0265331_103143631 | 143 |
| 251 | 3300031251 | Ga0265327_10197494 | Ga0265327_101974942 | 143 |
| 252 | 3300031251 | Ga0265327_10259601 | Ga0265327_102596012 | 143 |
| 253 | 3300031344 | Ga0265316_10253339 | Ga0265316_102533392 | 143 |
| 254 | 3300031344 | Ga0265316_10454703 | Ga0265316_104547031 | 143 |
| 255 | 3300031344 | Ga0265316_10626558 | Ga0265316_106265581 | 143 |
| 256 | 3300031344 | Ga0265316_10642822 | Ga0265316_106428222 | 143 |
| 257 | 3300031344 | Ga0265316_10971228 | Ga0265316_109712281 | 143 |
| 258 | 3300031456 | Ga0307513_10193864 | Ga0307513_101938641 | 143 |
| 259 | 3300031507 | Ga0307509_10566042 | Ga0307509_105660421 | 143 |
| 260 | 3300031507 | Ga0307509_10646745 | Ga0307509_106467452 | 143 |
| 261 | 3300031595 | Ga0265313_10219450 | Ga0265313_102194502 | 143 |
| 262 | 3300031691 | Ga0316579_10412035 | Ga0316579_104120351 | 143 |
| 263 | 3300031711 | Ga0265314_10398822 | Ga0265314_103988221 | 143 |
| 264 | 3300031712 | Ga0265342_10304014 | Ga0265342_103040141 | 143 |
| 265 | 3300031712 | Ga0265342_10509273 | Ga0265342_105092731 | 143 |
| 266 | 3300031727 | Ga0316576_10006116 | Ga0316576_100061163 | 143 |
| 267 | 3300031727 | Ga0316576_10106486 | Ga0316576_101064862 | 143 |
| 268 | 3300031727 | Ga0316576_10502649 | Ga0316576_105026491 | 143 |
| 269 | 3300031728 | Ga0316578_10019991 | Ga0316578_100199917 | 143 |
| 270 | 3300031728 | Ga0316578_10072887 | Ga0316578_100728873 | 143 |
| 271 | 3300031728 | Ga0316578_10337165 | Ga0316578_103371651 | 143 |
| 272 | 3300031728 | Ga0316578_10665384 | Ga0316578_106653841 | 143 |
| 273 | 3300031733 | Ga0316577_10022896 | Ga0316577_100228961 | 143 |
| 274 | 3300031733 | Ga0316577_10237518 | Ga0316577_102375181 | 143 |
| 275 | 3300031733 | Ga0316577_10241282 | Ga0316577_102412821 | 143 |
| 276 | 3300032002 | Ga0307416_102067138 | Ga0307416_1020671382 | 143 |
| 277 | 3300032133 | Ga0316583_10009252 | Ga0316583_100092521 | 143 |
| 278 | 3300032133 | Ga0316583_10187099 | Ga0316583_101870991 | 143 |
| 279 | 3300032137 | Ga0316585_10002548 | Ga0316585_100025482 | 143 |
| 280 | 3300032137 | Ga0316585_10260000 | Ga0316585_102600001 | 143 |
| 281 | 3300032139 | Ga0316580_10001639 | Ga0316580_100016398 | 143 |
| 282 | 3300032139 | Ga0316580_10168399 | Ga0316580_101683991 | 143 |
| 283 | 3300033524 | Ga0316592_1070459 | Ga0316592_10704591 | 143 |
| 284 | 3300033527 | Ga0316586_1008087 | Ga0316586_10080873 | 143 |
| 285 | 3300033528 | Ga0316588_1037895 | Ga0316588_10378952 | 143 |
| 286 | 3300033529 | Ga0316587_1001281 | Ga0316587_10012816 | 143 |
| 287 | 3300034819 | Ga0373958_0135454 | Ga0373958_0135454_58_489 | 143 |
| 288 | 3300034819 | Ga0373958_0214945 | Ga0373958_0214945_20_451 | 143 |
| 289 | 3300034820 | Ga0373959_0056629 | Ga0373959_0056629_167_598 | 143 |
| 290 | 3300035084 | Ga0373928_0196360 | Ga0373928_0196360_117_548 | 143 |
| 291 | 3300035086 | Ga0373934_0153642 | Ga0373934_0153642_484_915 | 143 |
| 292 | 3300035088 | Ga0373940_0106804 | Ga0373940_0106804_132_563 | 143 |
| 293 | 3300035088 | Ga0373940_0215988 | Ga0373940_0215988_90_521 | 143 |
| 294 | 3300035111 | Ga0373923_0473208 | Ga0373923_0473208_105_536 | 143 |
| 295 | 3300035112 | Ga0373932_0196234 | Ga0373932_0196234_186_617 | 143 |
| 296 | 3300035112 | Ga0373932_0283180 | Ga0373932_0283180_122_553 | 143 |
| 297 | 3300035114 | Ga0373939_0292347 | Ga0373939_0292347_122_553 | 143 |
| 298 | 3300035115 | Ga0373941_0422068 | Ga0373941_0422068_18_449 | 143 |
| 299 | 3300035117 | Ga0373953_0032090 | Ga0373953_0032090_277_708 | 143 |
| 300 | 3300035118 | Ga0373954_0251964 | Ga0373954_0251964_69_500 | 143 |
| 301 | 3300035118 | Ga0373954_0345609 | Ga0373954_0345609_288_719 | 143 |
| 302 | 3300035119 | Ga0373956_0009228 | Ga0373956_0009228_233_664 | 143 |
| 303 | 3300035120 | Ga0373957_0007945 | Ga0373957_0007945_1559_1990 | 143 |
| 304 | 3300035120 | Ga0373957_0228484 | Ga0373957_0228484_234_665 | 143 |
| 305 | 3300035121 | Ga0373960_0228640 | Ga0373960_0228640_198_629 | 143 |
| 306 | 3300035172 | Ga0373955_0067013 | Ga0373955_0067013_118_549 | 143 |
| 307 | 3300035172 | Ga0373955_0744022 | Ga0373955_0744022_150_581 | 143 |
| 308 | 3300035241 | Ga0373961_0229985 | Ga0373961_0229985_145_576 | 143 |
| 309 | 3300035242 | Ga0373962_0170633 | Ga0373962_0170633_158_589 | 143 |
| 310 | 3300035398 | Ga0316574_0434028 | Ga0316574_0434028_126_563 | 143 |
| 311 | 3300035410 | Ga0373924_0100156 | Ga0373924_0100156_760_1191 | 143 |
| 312 | 3300035410 | Ga0373924_0201094 | Ga0373924_0201094_270_701 | 143 |
| 313 | 3300035691 | Ga0373931_0383824 | Ga0373931_0383824_332_763 | 143 |
| 314 | 3300035692 | Ga0373935_1065550 | Ga0373935_1065550_123_554 | 143 |
| 315 | 3300035692 | Ga0373935_1148527 | Ga0373935_1148527_42_473 | 143 |
| 316 | 3300035695 | Ga0373927_0557884 | Ga0373927_0557884_187_618 | 143 |
| 317 | 3300035724 | Ga0373933_0068163 | Ga0373933_0068163_868_1299 | 143 |
| 318 | 3300035724 | Ga0373933_0171011 | Ga0373933_0171011_733_1164 | 143 |
| 319 | 3300035724 | Ga0373933_0435896 | Ga0373933_0435896_258_689 | 143 |
| 320 | 3300035725 | Ga0373947_0170145 | Ga0373947_0170145_284_715 | 143 |
| 321 | 3300035725 | Ga0373947_0796822 | Ga0373947_0796822_131_562 | 143 |
| 322 | 3300035725 | Ga0373947_1193402 | Ga0373947_1193402_55_486 | 143 |
| 323 | 3300036401 | Ga0373937_0055138 | Ga0373937_0055138_1461_1892 | 143 |
| 324 | 3300036401 | Ga0373937_0362310 | Ga0373937_0362310_70_501 | 143 |
| 325 | 3300036401 | Ga0373937_0772338 | Ga0373937_0772338_78_509 | 143 |
| 326 | 3300036401 | Ga0373937_0803726 | Ga0373937_0803726_329_760 | 143 |
| 327 | 3300036647 | Ga0316582_0574279 | Ga0316582_0574279_150_587 | 143 |
| 328 | 3300036712 | Ga0316584_0425482 | Ga0316584_0425482_214_651 | 143 |
| 329 | 3300037418 | Ga0395900_1548816 | Ga0395900_1548816_10_441 | 143 |
| 330 | 3300037471 | Ga0395905_0965788 | Ga0395905_0965788_180_611 | 143 |
| 331 | 3300038996 | Ga0242420_002770 | Ga0242420_002770_130_561 | 143 |
| 332 | 3300039110 | Ga0400487_36462 | Ga0400487_36462_551_982 | 143 |
| 333 | 3300039438 | Ga0436360_0369323 | Ga0436360_0369323_208_639 | 143 |
| 334 | 3300039438 | Ga0436360_0468036 | Ga0436360_0468036_106_537 | 143 |
| 335 | 3300039438 | Ga0436360_0628886 | Ga0436360_0628886_337_768 | 143 |
| 336 | 3300039438 | Ga0436360_0979164 | Ga0436360_0979164_511_942 | 143 |
| 337 | 3300039438 | Ga0436360_1195181 | Ga0436360_1195181_102_533 | 143 |
| 338 | 3300039438 | Ga0436360_1211632 | Ga0436360_1211632_490_921 | 143 |
| 339 | 3300039447 | Ga0436361_0129794 | Ga0436361_0129794_140_571 | 143 |
| 340 | 3300039447 | Ga0436361_0239872 | Ga0436361_0239872_4711_5142 | 143 |
| 341 | 3300039447 | Ga0436361_0320695 | Ga0436361_0320695_203_634 | 143 |
| 342 | 3300039447 | Ga0436361_0480685 | Ga0436361_0480685_111_542 | 143 |
| 343 | 3300039447 | Ga0436361_0836684 | Ga0436361_0836684_199_630 | 143 |
| 344 | 3300039447 | Ga0436361_0966661 | Ga0436361_0966661_183_614 | 143 |
| 345 | 3300039453 | Ga0436362_0182241 | Ga0436362_0182241_76_507 | 143 |
| 346 | 3300039453 | Ga0436362_0721132 | Ga0436362_0721132_185_616 | 143 |
| 347 | 3300039453 | Ga0436362_1033962 | Ga0436362_1033962_61_492 | 143 |
| 348 | 3300041407 | Ga0439447_113318 | Ga0439447_113318_68_499 | 143 |
| 349 | 3300041410 | Ga0439461_0085568 | Ga0439461_0085568_125_556 | 143 |
| 350 | 3300041997 | Ga0439431_0160406 | Ga0439431_0160406_186_617 | 143 |
| 351 | 3300042001 | Ga0439441_028965 | Ga0439441_028965_156_587 | 143 |
| 352 | 3300042117 | Ga0450913_035135 | Ga0450913_035135_19_450 | 143 |
| 353 | 3300042127 | Ga0450890_017308 | Ga0450890_017308_282_713 | 143 |
| 354 | 3300042136 | Ga0450900_029368 | Ga0450900_029368_202_633 | 143 |
| 355 | 3300042142 | Ga0450905_030072 | Ga0450905_030072_182_613 | 143 |
| 356 | 3300042156 | Ga0439446_0131708 | Ga0439446_0131708_200_631 | 143 |
| 357 | 3300042435 | Ga0439434_0126258 | Ga0439434_0126258_80_511 | 143 |
| 358 | 3300042438 | Ga0439459_0039360 | Ga0439459_0039360_201_632 | 143 |
| 359 | 3300042439 | Ga0439464_0223451 | Ga0439464_0223451_130_561 | 143 |
| 360 | 3300042461 | Ga0439460_0013328 | Ga0439460_0013328_567_998 | 143 |
| 361 | 3300042530 | Ga0450916_048173 | Ga0450916_048173_94_525 | 143 |
| 362 | 3300042876 | Ga0451577_0939715 | Ga0451577_0939715_115_546 | 143 |
| 363 | 3300044683 | Ga0466965_0504898 | Ga0466965_0504898_117_548 | 143 |
| 364 | 3300044684 | Ga0466966_0400186 | Ga0466966_0400186_279_710 | 143 |
| 365 | 3300044693 | Ga0466961_0407135 | Ga0466961_0407135_157_588 | 143 |
| 366 | 3300044693 | Ga0466961_0588293 | Ga0466961_0588293_119_550 | 143 |
| 367 | 3300044694 | Ga0466963_0490874 | Ga0466963_0490874_251_682 | 143 |
| 368 | 3300044694 | Ga0466963_1088997 | Ga0466963_1088997_99_530 | 143 |
| 369 | 3300044706 | Ga0466964_0322562 | Ga0466964_0322562_153_584 | 143 |
| 370 | 3300044712 | Ga0453684_1345869 | Ga0453684_1345869_125_556 | 143 |
| 371 | 3300044712 | Ga0453684_1913342 | Ga0453684_1913342_26_463 | 143 |
| 372 | 3300044719 | Ga0466971_0225173 | Ga0466971_0225173_404_835 | 143 |
| 373 | 3300044901 | Ga0466960_0425184 | Ga0466960_0425184_46_477 | 143 |
| 374 | 3300045049 | Ga0466959_0198019 | Ga0466959_0198019_50_481 | 143 |
| 375 | 3300045836 | Ga0466958_0315242 | Ga0466958_0315242_355_786 | 143 |
| 376 | 3300045836 | Ga0466958_0471690 | Ga0466958_0471690_207_638 | 143 |
| 377 | 3300046454 | Ga0495592_0714649 | Ga0495592_0714649_14_445 | 143 |
| 378 | 3300046462 | Ga0495651_0559534 | Ga0495651_0559534_124_555 | 143 |
| 379 | 3300046463 | Ga0495653_0436967 | Ga0495653_0436967_239_670 | 143 |
| 380 | 3300046472 | Ga0495580_0648195 | Ga0495580_0648195_126_557 | 143 |
| 381 | 3300046477 | Ga0495664_0520244 | Ga0495664_0520244_113_544 | 143 |
| 382 | 3300046511 | Ga0495608_0778787 | Ga0495608_0778787_75_506 | 143 |
| 383 | 3300046514 | Ga0495618_0488513 | Ga0495618_0488513_164_595 | 143 |
| 384 | 3300046516 | Ga0495628_0094602 | Ga0495628_0094602_1765_2196 | 143 |
| 385 | 3300046529 | Ga0495652_0597031 | Ga0495652_0597031_194_625 | 143 |
| 386 | 3300046533 | Ga0495640_0625660 | Ga0495640_0625660_93_524 | 143 |
| 387 | 3300046536 | Ga0495587_0460103 | Ga0495587_0460103_139_570 | 143 |
| 388 | 3300046543 | Ga0495645_0053090 | Ga0495645_0053090_2050_2481 | 143 |
| 389 | 3300046559 | Ga0495667_0498995 | Ga0495667_0498995_152_583 | 143 |
| 390 | 3300046642 | Ga0495634_0502004 | Ga0495634_0502004_156_587 | 143 |
| 391 | 3300046663 | Ga0495635_0478256 | Ga0495635_0478256_176_607 | 143 |
| 392 | 3300046675 | Ga0495657_0161239 | Ga0495657_0161239_804_1235 | 143 |
| 393 | 3300046678 | Ga0495599_0440427 | Ga0495599_0440427_212_643 | 143 |
| 394 | 3300046680 | Ga0495646_0509439 | Ga0495646_0509439_48_479 | 143 |
| 395 | 3300046681 | Ga0495647_0430069 | Ga0495647_0430069_51_482 | 143 |
| 396 | 3300047317 | Ga0495604_0273142 | Ga0495604_0273142_573_1004 | 143 |
| 397 | 3300047317 | Ga0495604_0326571 | Ga0495604_0326571_135_566 | 143 |
| 398 | 3300047318 | Ga0495636_0020045 | Ga0495636_0020045_158_592 | 143 |
| 399 | 3300047319 | Ga0495674_0592149 | Ga0495674_0592149_277_708 | 143 |
| 400 | 3300047322 | Ga0495680_0307725 | Ga0495680_0307725_242_673 | 143 |
| 401 | 3300047322 | Ga0495680_0963743 | Ga0495680_0963743_83_514 | 143 |
| 402 | 3300047444 | Ga0495675_0552511 | Ga0495675_0552511_114_545 | 143 |
| 403 | 3300047471 | Ga0495684_0316777 | Ga0495684_0316777_156_587 | 143 |
| 404 | 3300047471 | Ga0495684_0646863 | Ga0495684_0646863_216_647 | 143 |
| 405 | 3300048088 | Ga0495602_0138328 | Ga0495602_0138328_330_761 | 143 |
| 406 | 3300048088 | Ga0495602_0483319 | Ga0495602_0483319_271_702 | 143 |
| 407 | 3300048903 | Ga0496100_0536831 | Ga0496100_0536831_217_648 | 143 |
| 408 | 3300048905 | Ga0496102_0014212 | Ga0496102_0014212_3514_3945 | 143 |
| 409 | 3300048907 | Ga0496104_0636884 | Ga0496104_0636884_492_923 | 143 |
| 410 | 3300048907 | Ga0496104_0875443 | Ga0496104_0875443_180_611 | 143 |
| 411 | 3300048908 | Ga0496105_0080853 | Ga0496105_0080853_329_760 | 143 |
| 412 | 3300048909 | Ga0496106_0002447 | Ga0496106_0002447_7278_7709 | 143 |
| 413 | 3300048910 | Ga0496107_0026376 | Ga0496107_0026376_1187_1618 | 143 |
| 414 | 3300048910 | Ga0496107_0614262 | Ga0496107_0614262_207_638 | 143 |
| 415 | 3300048910 | Ga0496107_0690500 | Ga0496107_0690500_167_598 | 143 |
| 416 | 3300048911 | Ga0496108_1213415 | Ga0496108_1213415_54_485 | 143 |
| 417 | 3300048916 | Ga0496113_1040369 | Ga0496113_1040369_83_514 | 143 |
| 418 | 3300048916 | Ga0496113_1056771 | Ga0496113_1056771_134_565 | 143 |
| 419 | 3300048929 | Ga0496126_0578384 | Ga0496126_0578384_274_705 | 143 |
| 420 | 3300048986 | Ga0466983_0399903 | Ga0466983_0399903_292_723 | 143 |
| 421 | 3300049568 | Ga0501031_0196781 | Ga0501031_0196781_281_712 | 143 |
| 422 | 3300049570 | Ga0501033_0022991 | Ga0501033_0022991_4206_4637 | 143 |
| 423 | 3300049572 | Ga0501036_0723926 | Ga0501036_0723926_230_661 | 143 |
| 424 | 3300049573 | Ga0501037_0215813 | Ga0501037_0215813_658_1089 | 143 |
| 425 | 3300049575 | Ga0501039_0200821 | Ga0501039_0200821_964_1395 | 143 |
| 426 | 3300049575 | Ga0501039_0632950 | Ga0501039_0632950_117_548 | 143 |
| 427 | 3300049576 | Ga0501040_1116500 | Ga0501040_1116500_101_532 | 143 |
| 428 | 3300049578 | Ga0501042_0178443 | Ga0501042_0178443_1035_1466 | 143 |
| 429 | 3300049579 | Ga0501043_0312737 | Ga0501043_0312737_291_722 | 143 |
| 430 | 3300049580 | Ga0501046_0178048 | Ga0501046_0178048_871_1302 | 143 |
| 431 | 3300049580 | Ga0501046_1087331 | Ga0501046_1087331_98_529 | 143 |
| 432 | 3300049582 | Ga0501048_0065956 | Ga0501048_0065956_294_725 | 143 |
| 433 | 3300049584 | Ga0501068_0385093 | Ga0501068_0385093_230_661 | 143 |
| 434 | 3300049586 | Ga0501070_0179084 | Ga0501070_0179084_1074_1505 | 143 |
| 435 | 3300049589 | Ga0501073_0564209 | Ga0501073_0564209_226_657 | 143 |
| 436 | 3300049590 | Ga0501074_0496179 | Ga0501074_0496179_393_824 | 143 |
| 437 | 3300049592 | Ga0501076_1374119 | Ga0501076_1374119_59_490 | 143 |
| 438 | 3300049822 | Ga0501035_0467799 | Ga0501035_0467799_222_653 | 143 |
| 439 | 3300049823 | Ga0501044_0872715 | Ga0501044_0872715_103_534 | 143 |
| 440 | 3300049823 | Ga0501044_0877719 | Ga0501044_0877719_148_579 | 143 |
| 441 | 3300050491 | nmdc:mga00v17_243571_c1 | nmdc:mga00v17_243571_c1_254_688 | 143 |
| 442 | 3300050492 | nmdc:mga0yw44_540307_c1 | nmdc:mga0yw44_540307_c1_135_569 | 143 |
| 443 | 3300050507 | nmdc:mga05p37_1251570_c1 | nmdc:mga05p37_1251570_c1_113_544 | 143 |
| 444 | 3300050507 | nmdc:mga05p37_692491_c1 | nmdc:mga05p37_692491_c1_102_533 | 143 |
| 445 | 3300050509 | nmdc:mga0qj67_818773_c1 | nmdc:mga0qj67_818773_c1_146_580 | 143 |
| 446 | 3300050510 | nmdc:mga06r32_46101_c1 | nmdc:mga06r32_46101_c1_3116_3547 | 143 |
| 447 | 3300050510 | nmdc:mga06r32_5471_c1 | nmdc:mga06r32_5471_c1_10767_11198 | 143 |
| 448 | 3300050511 | nmdc:mga08y16_250347_c1 | nmdc:mga08y16_250347_c1_1365_1796 | 143 |
| 449 | 3300050512 | nmdc:mga0n895_128292_c1 | nmdc:mga0n895_128292_c1_2048_2479 | 143 |
| 450 | 3300050512 | nmdc:mga0n895_989245_c1 | nmdc:mga0n895_989245_c1_20_451 | 143 |
| 451 | 3300050515 | nmdc:mga0a205_157231_c1 | nmdc:mga0a205_157231_c1_1572_2003 | 143 |
| 452 | 3300053077 | Ga0495601_0630508 | Ga0495601_0630508_136_567 | 143 |
| 453 | 3300053078 | Ga0495612_0180253 | Ga0495612_0180253_104_535 | 143 |
| 454 | 3300053084 | Ga0495595_0169998 | Ga0495595_0169998_177_608 | 143 |
| 455 | 3300053085 | Ga0495619_0617587 | Ga0495619_0617587_287_718 | 143 |
| 456 | 3300053085 | Ga0495619_0728237 | Ga0495619_0728237_148_579 | 143 |
| 457 | 3300059424 | Ga0590075_090971 | Ga0590075_090971_21_452 | 143 |
| 458 | 3300061719 | Ga0466962_0154943 | Ga0466962_0154943_531_962 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fyx-assembly1.cif.gz_B | crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution | 0.8419 | 12 | 129 |
| 2xo6-assembly1.cif.gz_D | deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site | 0.7719 | 13 | 127 |
| 2fyx-assembly1.cif.gz_B | crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution | 0.7653 | 12 | 129 |
| 2xma-assembly1.cif.gz_B | deinococcus radiodurans isdra2 transposase right end dna complex | 0.7586 | 12 | 128 |
| 2xqc-assembly1.cif.gz_A | deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn | 0.7509 | 12 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1W3_4_135_3.30.70.1290 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like | 0.8982 | 6 | 133 | 3.30.70.1290 |
| af_Q2G1W3_4_135_3.30.70.1290 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like | 0.8658 | 6 | 133 | 3.30.70.1290 |
| af_Q9UUH2_88_244_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8197 | 39 | 69 | 3.40.50.150 |
| 2xm3E00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like | 0.7716 | 12 | 126 | 3.30.70.1290 |
| 2vjvB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like | 0.767 | 12 | 126 | 3.30.70.1290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A413CQK0-F1-model_v4 | IS200/IS605 family transposase | 0.9298 | 13 | 95 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A659FQX9-F1-model_v4 | deleted | 0.9104 | 8 | 141 |
|
| AF-A0A356ADD6-F1-model_v4 | deleted | 0.9075 | 8 | 93 |
|
| AF-A0A413CQK0-F1-model_v4 | IS200/IS605 family transposase | 0.8993 | 13 | 95 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A3D1WHT3-F1-model_v4 | IS200/IS605 family transposase | 0.8962 | 6 | 139 |
GO:0003677
GO:0004803 GO:0006313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar