F448184

General Info

Members Datasets Scaffolds Average Seq Length
458 230 916 112

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12275418|Ga0105249_122754181
Length 123
Sequence MPPVLTVIRWRDIPAQVTAKDGRAVAKRVLHRRFQVAIDRAAMKAGKKAASDYIGEWVSDRRACSADLQAEVDQLADRFEAEHTREVLAHLVANGGWQDPSAHPETPATPPTTTPSDEEPQPA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 5.46
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12275418 3300009553 Bacteria 615
2 SwRhRL2b_contig_27200 2162886007 Bacteria 1401
3 rootH1_10098468 3300003316 Bacteria 2515
4 rootH2_10144114 3300003320 Bacteria 1489
5 rootH1_10245607 3300003323 Bacteria 2532
6 Ga0070676_10065451 3300005328 Bacteria 2170
7 Ga0070676_10158462 3300005328 Bacteria 1455
8 Ga0070690_101294777 3300005330 Bacteria 584
9 Ga0070670_100027091 3300005331 Bacteria 4929
10 Ga0070670_100057298 3300005331 Bacteria 3345
11 Ga0070670_100076980 3300005331 Bacteria 2867
12 Ga0070670_100212662 3300005331 Bacteria 1681
13 Ga0070677_10011551 3300005333 Bacteria 3049
14 Ga0068869_100094169 3300005334 Bacteria 2258
15 Ga0068869_101043657 3300005334 Bacteria 713
16 Ga0070666_10011162 3300005335 Bacteria 5628
17 Ga0070680_100191340 3300005336 Bacteria 1724
18 Ga0068868_100018307 3300005338 Bacteria 5234
19 Ga0068868_102094959 3300005338 Bacteria 538
20 Ga0070689_100092819 3300005340 Bacteria 2382
21 Ga0070689_100186142 3300005340 Bacteria 1689
22 Ga0070689_101373725 3300005340 Bacteria 638
23 Ga0070691_10276770 3300005341 Bacteria 909
24 Ga0070687_100564540 3300005343 Bacteria 776
25 Ga0070661_100289604 3300005344 Bacteria 1272
26 Ga0070668_100024091 3300005347 Bacteria 4609
27 Ga0070668_100117434 3300005347 Bacteria 2122
28 Ga0070668_100348579 3300005347 Bacteria 1253
29 Ga0070669_100031525 3300005353 Bacteria 3828
30 Ga0070669_100050694 3300005353 Bacteria 3032
31 Ga0070669_100279212 3300005353 Bacteria 1338
32 Ga0070675_100040236 3300005354 Bacteria 3815
33 Ga0070675_100048376 3300005354 Bacteria 3486
34 Ga0070675_100121368 3300005354 Bacteria 2221
35 Ga0070675_100354111 3300005354 Unclassified 1302
36 Ga0070675_100506219 3300005354 Bacteria 1088
37 Ga0070671_100196582 3300005355 Bacteria 1710
38 Ga0070671_101088707 3300005355 Bacteria 702
39 Ga0070674_100011039 3300005356 Bacteria 5481
40 Ga0070674_100361034 3300005356 Bacteria 1176
41 Ga0070673_100058090 3300005364 Bacteria 3058
42 Ga0070673_100062592 3300005364 Bacteria 2957
43 Ga0070688_100259653 3300005365 Bacteria 1240
44 Ga0070667_100040179 3300005367 Bacteria 3922
45 Ga0070667_100717725 3300005367 Bacteria 925
46 Ga0070667_100836913 3300005367 Bacteria 855
47 Ga0070667_101860517 3300005367 Bacteria 567
48 Ga0070711_100100994 3300005439 Bacteria 2099
49 Ga0070700_100643770 3300005441 Bacteria 836
50 Ga0070700_101965599 3300005441 Bacteria 507
51 Ga0070694_100853717 3300005444 Bacteria 749
52 Ga0070663_100054174 3300005455 Bacteria 2866
53 Ga0070678_100889879 3300005456 Bacteria 813
54 Ga0070678_101171776 3300005456 Unclassified 712
55 Ga0070678_101683412 3300005456 Bacteria 597
56 Ga0070662_100034282 3300005457 Bacteria 3579
57 Ga0070662_100041537 3300005457 Bacteria 3281
58 Ga0070662_100260809 3300005457 Bacteria 1396
59 Ga0070662_101210808 3300005457 Bacteria 649
60 Ga0068867_100050509 3300005459 Bacteria 3065
61 Ga0068867_100187874 3300005459 Bacteria 1647
62 Ga0068867_100238232 3300005459 Bacteria 1474
63 Ga0068867_100283792 3300005459 Bacteria 1359
64 Ga0070685_10258026 3300005466 Unclassified 1158
65 Ga0070685_10784292 3300005466 Bacteria 701
66 Ga0070684_100467845 3300005535 Bacteria 1166
67 Ga0068853_100255752 3300005539 Bacteria 1609
68 Ga0068853_100277371 3300005539 Bacteria 1545
69 Ga0070672_100002260 3300005543 Bacteria 12152
70 Ga0070672_100128424 3300005543 Bacteria 2081
71 Ga0070672_100138360 3300005543 Bacteria 2006
72 Ga0070672_100701567 3300005543 Bacteria 886
73 Ga0070672_101056986 3300005543 Bacteria 721
74 Ga0070672_101168728 3300005543 Bacteria 685
75 Ga0070686_100462130 3300005544 Bacteria 978
76 Ga0070686_101247419 3300005544 Bacteria 619
77 Ga0070686_101582779 3300005544 Bacteria 554
78 Ga0070665_100008652 3300005548 Bacteria 10304
79 Ga0070665_100057936 3300005548 Bacteria 3884
80 Ga0070665_100363394 3300005548 Bacteria 1454
81 Ga0070704_100293450 3300005549 Bacteria 1352
82 Ga0068855_100219530 3300005563 Bacteria 2132
83 Ga0068855_101956808 3300005563 Bacteria 593
84 Ga0070664_100520104 3300005564 Bacteria 1098
85 Ga0070664_101896418 3300005564 Unclassified 565
86 Ga0068857_100564655 3300005577 Bacteria 1073
87 Ga0068857_100897762 3300005577 Unclassified 850
88 Ga0068857_101641616 3300005577 Unclassified 628
89 Ga0068854_101849312 3300005578 Unclassified 554
90 Ga0068856_100554513 3300005614 Bacteria 1170
91 Ga0070702_100484421 3300005615 Bacteria 905
92 Ga0070702_100742261 3300005615 Unclassified 753
93 Ga0068852_100092884 3300005616 Bacteria 2704
94 Ga0068859_100050942 3300005617 Bacteria 4161
95 Ga0068859_100872056 3300005617 Unclassified 986
96 Ga0068864_100004827 3300005618 Bacteria 11049
97 Ga0068864_100096849 3300005618 Bacteria 2611
98 Ga0068864_100365489 3300005618 Bacteria 1364
99 Ga0068864_100514965 3300005618 Bacteria 1153
100 Ga0068866_10069110 3300005718 Bacteria 1860
101 Ga0068866_10102440 3300005718 Bacteria 1582
102 Ga0068866_10677437 3300005718 Unclassified 705
103 Ga0068861_100010302 3300005719 Bacteria 6487
104 Ga0068861_100042956 3300005719 Bacteria 3390
105 Ga0068861_100591981 3300005719 Unclassified 1017
106 Ga0068861_102628788 3300005719 Unclassified 507
107 Ga0068870_10056700 3300005840 Bacteria 2092
108 Ga0068870_10294002 3300005840 Unclassified 1023
109 Ga0068870_10328508 3300005840 Bacteria 974
110 Ga0068870_10750397 3300005840 Unclassified 678
111 Ga0068863_100003529 3300005841 Bacteria 15435
112 Ga0068863_100015448 3300005841 Bacteria 7338
113 Ga0068863_100088595 3300005841 Bacteria 2933
114 Ga0068863_100126011 3300005841 Bacteria 2443
115 Ga0068863_100386321 3300005841 Bacteria 1367
116 Ga0068863_101362858 3300005841 Bacteria 717
117 Ga0068863_101404640 3300005841 Bacteria 706
118 Ga0068858_100004634 3300005842 Bacteria 13464
119 Ga0068860_100000969 3300005843 Bacteria 31793
120 Ga0068860_100007946 3300005843 Bacteria 10582
121 Ga0068860_100246144 3300005843 Bacteria 1740
122 Ga0068860_100801311 3300005843 Bacteria 955
123 Ga0068862_100013574 3300005844 Bacteria 6747
124 Ga0068862_100059728 3300005844 Bacteria 3274
125 Ga0068862_100142758 3300005844 Bacteria 2126
126 Ga0068862_100162417 3300005844 Bacteria 1995
127 Ga0068862_100258111 3300005844 Bacteria 1590
128 Ga0068862_100451881 3300005844 Bacteria 1211
129 Ga0070715_10845406 3300006163 Unclassified 559
130 Ga0097621_100047799 3300006237 Bacteria 3468
131 Ga0097621_100220545 3300006237 Bacteria 1652
132 Ga0097621_100329123 3300006237 Bacteria 1355
133 Ga0097621_100842787 3300006237 Bacteria 851
134 Ga0068871_100022310 3300006358 Bacteria 4880
135 Ga0068871_100030082 3300006358 Bacteria 4273
136 Ga0068871_100211439 3300006358 Bacteria 1678
137 Ga0068871_100962310 3300006358 Bacteria 794
138 Ga0075428_100521891 3300006844 Bacteria 1270
139 Ga0075428_100901857 3300006844 Bacteria 937
140 Ga0075430_100181701 3300006846 Bacteria 1749
141 Ga0075430_100341720 3300006846 Bacteria 1236
142 Ga0075431_100206101 3300006847 Bacteria 2010
143 Ga0075431_100245213 3300006847 Bacteria 1821
144 Ga0075429_100207301 3300006880 Bacteria 1717
145 Ga0068865_100098189 3300006881 Bacteria 2139
146 Ga0068865_101304281 3300006881 Unclassified 646
147 Ga0097620_100050939 3300006931 Bacteria 4161
148 Ga0097620_100872052 3300006931 Unclassified 986
149 Ga0099795_10000031 3300007788 Bacteria 38284
150 Ga0099795_10002758 3300007788 Bacteria 4215
151 Ga0099795_10362982 3300007788 Unclassified 650
152 Ga0105240_10120086 3300009093 Bacteria 3166
153 Ga0105240_10422922 3300009093 Bacteria 1496
154 Ga0105240_10451665 3300009093 Bacteria 1438
155 Ga0111539_10197721 3300009094 Bacteria 2345
156 Ga0111539_10512921 3300009094 Bacteria 1397
157 Ga0111539_10568065 3300009094 Bacteria 1321
158 Ga0111539_12296488 3300009094 Unclassified 626
159 Ga0105245_10018503 3300009098 Bacteria 6092
160 Ga0105247_10048816 3300009101 Bacteria 2600
161 Ga0105247_10430610 3300009101 Bacteria 947
162 Ga0105243_12713737 3300009148 Unclassified 536
163 Ga0105241_11172048 3300009174 Bacteria 726
164 Ga0105242_10078757 3300009176 Bacteria 2751
165 Ga0105242_10127315 3300009176 Bacteria 2194
166 Ga0105237_10270060 3300009545 Bacteria 1704
167 Ga0105237_10333517 3300009545 Bacteria 1521
168 Ga0105238_10071797 3300009551 Bacteria 3459
169 Ga0105238_10338232 3300009551 Bacteria 1493
170 Ga0105238_10471155 3300009551 Bacteria 1254
171 Ga0105249_10191896 3300009553 Bacteria 1994
172 Ga0105249_10312581 3300009553 Bacteria 1580
173 Ga0105249_10345944 3300009553 Bacteria 1505
174 Ga0099796_10000176 3300010159 Bacteria 9698
175 Ga0099796_10004827 3300010159 Bacteria 3304
176 Ga0105246_10564332 3300011119 Unclassified 978
177 Ga0105246_11989896 3300011119 Bacteria 560
178 Ga0157374_10004260 3300013296 Bacteria 12027
179 Ga0157374_10851643 3300013296 Bacteria 928
180 Ga0157374_11007361 3300013296 Bacteria 852
181 Ga0157374_11542215 3300013296 Bacteria 688
182 Ga0157378_10014449 3300013297 Bacteria 6911
183 Ga0157378_10075042 3300013297 Bacteria 3043
184 Ga0163162_10028144 3300013306 Bacteria 5559
185 Ga0163162_10112393 3300013306 Bacteria 2822
186 Ga0163162_10272805 3300013306 Bacteria 1823
187 Ga0157375_10006526 3300013308 Bacteria 10154
188 Ga0157375_10366409 3300013308 Bacteria 1607
189 Ga0157375_10411707 3300013308 Bacteria 1518
190 Ga0157375_12301080 3300013308 Unclassified 642
191 Ga0157375_12952126 3300013308 Unclassified 568
192 Ga0163163_10007202 3300014325 Bacteria 9797
193 Ga0163163_10013185 3300014325 Bacteria 7554
194 Ga0163163_10081106 3300014325 Bacteria 3245
195 Ga0163163_11012485 3300014325 Unclassified 894
196 Ga0163163_11284832 3300014325 Unclassified 794
197 Ga0163163_11702541 3300014325 Bacteria 691
198 Ga0163163_11997956 3300014325 Unclassified 640
199 Ga0157380_10136664 3300014326 Bacteria 2099
200 Ga0157380_10160911 3300014326 Bacteria 1951
201 Ga0157380_10402932 3300014326 Bacteria 1298
202 Ga0157380_11593049 3300014326 Unclassified 708
203 Ga0157377_10201637 3300014745 Bacteria 1263
204 Ga0157379_10000582 3300014968 Bacteria 29612
205 Ga0157379_10130448 3300014968 Bacteria 2262
206 Ga0157379_10287929 3300014968 Bacteria 1496
207 Ga0157379_10392068 3300014968 Bacteria 1275
208 Ga0157379_11506119 3300014968 Unclassified 655
209 Ga0157379_11942437 3300014968 Unclassified 581
210 Ga0157379_12208874 3300014968 Unclassified 547
211 Ga0157376_10083972 3300014969 Bacteria 2741
212 Ga0157376_10918356 3300014969 Bacteria 894
213 Ga0157376_11231147 3300014969 Bacteria 777
214 Ga0163161_10368774 3300017792 Bacteria 1145
215 Ga0207697_10050709 3300025315 Bacteria 1714
216 Ga0207656_10031639 3300025321 Bacteria 2194
217 Ga0207682_10032478 3300025893 Bacteria 2098
218 Ga0207682_10261088 3300025893 Unclassified 808
219 Ga0207710_10019491 3300025900 Bacteria 2894
220 Ga0207647_10070679 3300025904 Bacteria 2108
221 Ga0207685_10585240 3300025905 Unclassified 597
222 Ga0207645_10001943 3300025907 Bacteria 16674
223 Ga0207645_10040901 3300025907 Bacteria 2969
224 Ga0207645_10274775 3300025907 Bacteria 1118
225 Ga0207643_10025188 3300025908 Bacteria 3287
226 Ga0207643_10029232 3300025908 Bacteria 3065
227 Ga0207643_10049098 3300025908 Bacteria 2391
228 Ga0207643_10341926 3300025908 Bacteria 938
229 Ga0207654_10432969 3300025911 Bacteria 920
230 Ga0207695_10111153 3300025913 Bacteria 2719
231 Ga0207695_10145496 3300025913 Bacteria 2315
232 Ga0207671_11559772 3300025914 Bacteria 509
233 Ga0207663_10047292 3300025916 Bacteria 2655
234 Ga0207660_10055208 3300025917 Bacteria 2838
235 Ga0207681_10036333 3300025923 Bacteria 3250
236 Ga0207681_10078496 3300025923 Bacteria 2323
237 Ga0207681_10306301 3300025923 Bacteria 1258
238 Ga0207694_10021083 3300025924 Bacteria 4935
239 Ga0207694_11033331 3300025924 Bacteria 695
240 Ga0207650_10015673 3300025925 Bacteria 5283
241 Ga0207650_10036728 3300025925 Bacteria 3565
242 Ga0207650_10098764 3300025925 Bacteria 2244
243 Ga0207650_10112969 3300025925 Bacteria 2105
244 Ga0207650_10196622 3300025925 Bacteria 1613
245 Ga0207650_10657464 3300025925 Bacteria 884
246 Ga0207650_10968706 3300025925 Bacteria 723
247 Ga0207659_10038855 3300025926 Bacteria 3313
248 Ga0207659_10090931 3300025926 Bacteria 2279
249 Ga0207659_10103261 3300025926 Bacteria 2153
250 Ga0207687_10040686 3300025927 Bacteria 3188
251 Ga0207700_10404572 3300025928 Unclassified 1197
252 Ga0207644_10370264 3300025931 Bacteria 1167
253 Ga0207644_10385652 3300025931 Bacteria 1143
254 Ga0207644_10586909 3300025931 Bacteria 924
255 Ga0207706_10002027 3300025933 Bacteria 19857
256 Ga0207706_10036879 3300025933 Bacteria 4343
257 Ga0207706_10955499 3300025933 Bacteria 722
258 Ga0207706_10984613 3300025933 Bacteria 709
259 Ga0207686_11599124 3300025934 Bacteria 538
260 Ga0207709_10228439 3300025935 Bacteria 1347
261 Ga0207670_11430550 3300025936 Bacteria 587
262 Ga0207669_10177379 3300025937 Bacteria 1523
263 Ga0207669_10557115 3300025937 Bacteria 926
264 Ga0207704_10050993 3300025938 Bacteria 2499
265 Ga0207704_10291126 3300025938 Bacteria 1246
266 Ga0207691_10003185 3300025940 Bacteria 16038
267 Ga0207691_10008910 3300025940 Bacteria 9634
268 Ga0207691_10019894 3300025940 Bacteria 6350
269 Ga0207691_11113373 3300025940 Bacteria 657
270 Ga0207711_10007272 3300025941 Bacteria 9280
271 Ga0207689_10134236 3300025942 Bacteria 2038
272 Ga0207689_10213430 3300025942 Bacteria 1595
273 Ga0207689_10503047 3300025942 Bacteria 1015
274 Ga0207679_10546408 3300025945 Bacteria 1039
275 Ga0207679_11405330 3300025945 Unclassified 640
276 Ga0207667_10358822 3300025949 Bacteria 1486
277 Ga0207667_10440892 3300025949 Bacteria 1324
278 Ga0207651_10030802 3300025960 Bacteria 3421
279 Ga0207651_10124449 3300025960 Bacteria 1962
280 Ga0207651_10666526 3300025960 Bacteria 914
281 Ga0207712_10366948 3300025961 Bacteria 1201
282 Ga0207712_11263253 3300025961 Unclassified 659
283 Ga0207668_10006060 3300025972 Bacteria 7130
284 Ga0207668_10081796 3300025972 Bacteria 2344
285 Ga0207668_10271254 3300025972 Bacteria 1387
286 Ga0207668_10377909 3300025972 Bacteria 1192
287 Ga0207640_10138815 3300025981 Bacteria 1768
288 Ga0207658_10015518 3300025986 Bacteria 5226
289 Ga0207658_10039912 3300025986 Bacteria 3389
290 Ga0207658_10900362 3300025986 Bacteria 806
291 Ga0207658_10965458 3300025986 Unclassified 777
292 Ga0207677_11404093 3300026023 Bacteria 643
293 Ga0207703_10006729 3300026035 Bacteria 9170
294 Ga0207703_10073313 3300026035 Bacteria 2832
295 Ga0207703_10798669 3300026035 Bacteria 901
296 Ga0207639_10251175 3300026041 Bacteria 1542
297 Ga0207639_11687845 3300026041 Bacteria 594
298 Ga0207678_10031531 3300026067 Bacteria 4624
299 Ga0207702_10258641 3300026078 Bacteria 1638
300 Ga0207641_10000247 3300026088 Bacteria 69132
301 Ga0207641_10007406 3300026088 Bacteria 9128
302 Ga0207641_10087237 3300026088 Bacteria 2722
303 Ga0207641_10125295 3300026088 Bacteria 2299
304 Ga0207641_10250646 3300026088 Bacteria 1653
305 Ga0207648_10001335 3300026089 Bacteria 27395
306 Ga0207648_10021635 3300026089 Bacteria 5778
307 Ga0207648_10218823 3300026089 Bacteria 1692
308 Ga0207676_10005172 3300026095 Bacteria 9230
309 Ga0207676_10276775 3300026095 Bacteria 1522
310 Ga0207674_10400479 3300026116 Bacteria 1326
311 Ga0207674_10840080 3300026116 Unclassified 886
312 Ga0207674_11196552 3300026116 Unclassified 729
313 Ga0207674_11984954 3300026116 Archaea 547
314 Ga0207675_100002343 3300026118 Bacteria 18769
315 Ga0207675_100012965 3300026118 Bacteria 7784
316 Ga0207675_100171288 3300026118 Bacteria 2075
317 Ga0207683_10040971 3300026121 Bacteria 4043
318 Ga0207683_10131420 3300026121 Bacteria 2252
319 Ga0207683_11616569 3300026121 Bacteria 597
320 Ga0209996_1058556 3300027395 Bacteria 590
321 Ga0209179_1000014 3300027512 Bacteria 53305
322 Ga0209971_1002808 3300027682 Bacteria 4162
323 Ga0209998_10000619 3300027717 Bacteria 9530
324 Ga0209974_10027535 3300027876 Bacteria 1881
325 Ga0207428_10193590 3300027907 Bacteria 1532
326 Ga0265356_1000760 3300028017 Bacteria 5453
327 Ga0268266_10000898 3300028379 Bacteria 38471
328 Ga0268266_10047272 3300028379 Bacteria 3686
329 Ga0268266_10395964 3300028379 Bacteria 1305
330 Ga0268266_10952153 3300028379 Unclassified 831
331 Ga0268265_10058118 3300028380 Bacteria 2951
332 Ga0268265_10062787 3300028380 Bacteria 2855
333 Ga0268265_10198007 3300028380 Bacteria 1740
334 Ga0268265_10576440 3300028380 Bacteria 1072
335 Ga0268265_10896708 3300028380 Bacteria 870
336 Ga0268264_10000165 3300028381 Bacteria 147648
337 Ga0268264_10005594 3300028381 Bacteria 10649
338 Ga0268264_10477341 3300028381 Bacteria 1212
339 Ga0268264_10597412 3300028381 Bacteria 1087
340 Ga0268264_11347090 3300028381 Bacteria 724
341 Ga0307515_10756844 3300028794 Bacteria 591
342 Ga0265338_10180337 3300028800 Bacteria 1611
343 Ga0307511_10000529 3300030521 Bacteria 40854
344 Ga0265332_10229379 3300031238 Bacteria 770
345 Ga0265328_10022565 3300031239 Bacteria 2394
346 Ga0265340_10058621 3300031247 Bacteria 1848
347 Ga0265316_10509866 3300031344 Bacteria 859
348 Ga0265316_10522686 3300031344 Bacteria 846
349 Ga0307509_10648544 3300031507 Unclassified 725
350 Ga0265314_10173581 3300031711 Bacteria 1299
351 Ga0307410_10048399 3300031852 Bacteria 2847
352 Ga0307409_101301643 3300031995 Unclassified 752
353 Ga0307416_100204005 3300032002 Bacteria 1879
354 Ga0307414_10808786 3300032004 Bacteria 855
355 Ga0307510_10000015 3300033180 Bacteria 258937
356 Ga0307510_10014855 3300033180 Bacteria 9213
357 Ga0307510_10393395 3300033180 Unclassified 830
358 Ga0373923_0257048 3300035111 Bacteria 819
359 Ga0373936_0579994 3300035113 Unclassified 526
360 Ga0373945_0075920 3300035116 Bacteria 1280
361 Ga0373954_0271922 3300035118 Unclassified 835
362 Ga0373956_0185601 3300035119 Bacteria 984
363 Ga0373957_0556809 3300035120 Unclassified 502
364 Ga0373955_0489501 3300035172 Unclassified 751
365 Ga0373955_0904283 3300035172 Unclassified 543
366 Ga0373935_1028525 3300035692 Unclassified 612
367 Ga0373935_1166987 3300035692 Bacteria 574
368 Ga0373933_1089206 3300035724 Unclassified 526
369 Ga0373937_0108056 3300036401 Bacteria 2587
370 Ga0373937_0167497 3300036401 Bacteria 2061
371 Ga0373937_0764940 3300036401 Bacteria 913
372 Ga0373925_0126384 3300037068 Bacteria 1990
373 Ga0373925_0223705 3300037068 Bacteria 1503
374 Ga0436364_0950737 3300037853 Unclassified 669
375 Ga0436365_0172328 3300039437 Bacteria 6591
376 Ga0436360_0203958 3300039438 Bacteria 1303
377 Ga0436363_0465820 3300039450 Bacteria 1123
378 Ga0436363_0734725 3300039450 Bacteria 1848
379 Ga0451807_2097254 3300041486 Unclassified 1063
380 Ga0451835_0558620 3300041492 Unclassified 673
381 Ga0451845_0661823 3300041501 Unclassified 534
382 Ga0451853_0733419 3300041512 Bacteria 1315
383 Ga0451577_0035916 3300042876 Bacteria 4463
384 Ga0451577_0278947 3300042876 Bacteria 1514
385 Ga0466972_0350870 3300044658 Unclassified 690
386 Ga0453683_0215877 3300044673 Bacteria 1219
387 Ga0466961_0174322 3300044693 Bacteria 1337
388 Ga0453684_0109403 3300044712 Bacteria 3361
389 Ga0453684_0148364 3300044712 Bacteria 2790
390 Ga0453684_0725822 3300044712 Bacteria 1077
391 Ga0466959_0018030 3300045049 Bacteria 5179
392 Ga0451576_0035796 3300045051 Bacteria 5265
393 Ga0451576_1363206 3300045051 Bacteria 739
394 Ga0495629_1152014 3300046459 Unclassified 500
395 Ga0495606_0082679 3300046507 Bacteria 1993
396 Ga0495616_0290926 3300046513 Bacteria 692
397 Ga0495628_0608552 3300046516 Unclassified 780
398 Ga0495632_0041722 3300046519 Bacteria 2304
399 Ga0495643_0164487 3300046522 Bacteria 1089
400 Ga0495645_0683224 3300046543 Unclassified 625
401 Ga0495625_0335049 3300046660 Bacteria 960
402 Ga0495671_0302432 3300046692 Bacteria 769
403 Ga0495671_0650882 3300046692 Unclassified 501
404 Ga0495674_0552005 3300047319 Bacteria 917
405 Ga0495687_159352 3300047443 Bacteria 761
406 Ga0496100_0022871 3300048903 Bacteria 3788
407 Ga0496100_0174485 3300048903 Bacteria 1551
408 Ga0496101_0296254 3300048904 Bacteria 1266
409 Ga0496101_0488487 3300048904 Bacteria 972
410 Ga0496102_0003397 3300048905 Bacteria 13497
411 Ga0496103_0061097 3300048906 Bacteria 2343
412 Ga0496104_0038786 3300048907 Bacteria 4458
413 Ga0496104_0234607 3300048907 Bacteria 1746
414 Ga0496104_1356995 3300048907 Unclassified 614
415 Ga0496105_0099041 3300048908 Bacteria 2407
416 Ga0496106_0464461 3300048909 Bacteria 1017
417 Ga0496106_0985439 3300048909 Bacteria 663
418 Ga0496108_0485829 3300048911 Bacteria 1079
419 Ga0496109_0187116 3300048912 Bacteria 1945
420 Ga0496109_1230290 3300048912 Bacteria 685
421 Ga0496110_0116390 3300048913 Bacteria 2406
422 Ga0496110_0553564 3300048913 Bacteria 1045
423 Ga0496111_0069369 3300048914 Bacteria 2564
424 Ga0496113_0453017 3300048916 Bacteria 1031
425 Ga0496114_0016670 3300048917 Bacteria 5925
426 Ga0496114_0261300 3300048917 Bacteria 1524
427 Ga0496114_0611924 3300048917 Bacteria 960
428 Ga0496115_0020873 3300048918 Bacteria 5055
429 Ga0496115_0350618 3300048918 Bacteria 1204
430 Ga0496116_0061285 3300048919 Bacteria 2436
431 Ga0496117_0000106 3300048920 Bacteria 188425
432 Ga0496118_0000005 3300048921 Bacteria 697350
433 Ga0496119_0021531 3300048922 Bacteria 4655
434 Ga0496120_0055504 3300048923 Bacteria 2239
435 Ga0496120_0272057 3300048923 Bacteria 786
436 Ga0496121_0042460 3300048924 Bacteria 3955
437 Ga0496121_0137436 3300048924 Bacteria 1818
438 Ga0496124_0028187 3300048927 Bacteria 5026
439 Ga0496125_0000711 3300048928 Bacteria 55017
440 Ga0496125_0009678 3300048928 Bacteria 9847
441 Ga0496126_0023942 3300048929 Bacteria 5904
442 Ga0496126_0100760 3300048929 Bacteria 2527
443 nmdc:mga05p37_668059_c1 3300050507 Bacteria 1160
444 nmdc:mga09592_93737_c1 3300050508 Bacteria 2568
445 nmdc:mga0qj67_965645_c1 3300050509 Bacteria 670
446 nmdc:mga06r32_128355_c1 3300050510 Bacteria 2506
447 nmdc:mga06r32_191004_c1 3300050510 Bacteria 2036
448 nmdc:mga08y16_164900_c1 3300050511 Bacteria 2302
449 nmdc:mga08y16_771034_c1 3300050511 Bacteria 956
450 Ga0495601_0321898 3300053077 Bacteria 1007
451 Ga0495595_0103336 3300053084 Bacteria 1377
452 Ga0495619_0448187 3300053085 Unclassified 890
453 Ga0495619_0483272 3300053085 Bacteria 852
454 Ga0500583_0544444 3300053092 Unclassified 540
455 Ga0500591_120954 3300053115 Bacteria 1076
456 Ga0500636_0153819 3300053177 Bacteria 1261
457 Ga0587067_139025 3300059640 Bacteria 600
458 Ga0466962_0193399 3300061719 Bacteria 993
459 Ga0105249_12275418
460 SwRhRL2b_contig_27200
461 rootH1_10098468
462 rootH2_10144114
463 rootH1_10245607
464 Ga0070676_10065451
465 Ga0070676_10158462
466 Ga0070690_101294777
467 Ga0070670_100027091
468 Ga0070670_100057298
469 Ga0070670_100076980
470 Ga0070670_100212662
471 Ga0070677_10011551
472 Ga0068869_100094169
473 Ga0068869_101043657
474 Ga0070666_10011162
475 Ga0070680_100191340
476 Ga0068868_100018307
477 Ga0068868_102094959
478 Ga0070689_100092819
479 Ga0070689_100186142
480 Ga0070689_101373725
481 Ga0070691_10276770
482 Ga0070687_100564540
483 Ga0070661_100289604
484 Ga0070668_100024091
485 Ga0070668_100117434
486 Ga0070668_100348579
487 Ga0070669_100031525
488 Ga0070669_100050694
489 Ga0070669_100279212
490 Ga0070675_100040236
491 Ga0070675_100048376
492 Ga0070675_100121368
493 Ga0070675_100354111
494 Ga0070675_100506219
495 Ga0070671_100196582
496 Ga0070671_101088707
497 Ga0070674_100011039
498 Ga0070674_100361034
499 Ga0070673_100058090
500 Ga0070673_100062592
501 Ga0070688_100259653
502 Ga0070667_100040179
503 Ga0070667_100717725
504 Ga0070667_100836913
505 Ga0070667_101860517
506 Ga0070711_100100994
507 Ga0070700_100643770
508 Ga0070700_101965599
509 Ga0070694_100853717
510 Ga0070663_100054174
511 Ga0070678_100889879
512 Ga0070678_101171776
513 Ga0070678_101683412
514 Ga0070662_100034282
515 Ga0070662_100041537
516 Ga0070662_100260809
517 Ga0070662_101210808
518 Ga0068867_100050509
519 Ga0068867_100187874
520 Ga0068867_100238232
521 Ga0068867_100283792
522 Ga0070685_10258026
523 Ga0070685_10784292
524 Ga0070684_100467845
525 Ga0068853_100255752
526 Ga0068853_100277371
527 Ga0070672_100002260
528 Ga0070672_100128424
529 Ga0070672_100138360
530 Ga0070672_100701567
531 Ga0070672_101056986
532 Ga0070672_101168728
533 Ga0070686_100462130
534 Ga0070686_101247419
535 Ga0070686_101582779
536 Ga0070665_100008652
537 Ga0070665_100057936
538 Ga0070665_100363394
539 Ga0070704_100293450
540 Ga0068855_100219530
541 Ga0068855_101956808
542 Ga0070664_100520104
543 Ga0070664_101896418
544 Ga0068857_100564655
545 Ga0068857_100897762
546 Ga0068857_101641616
547 Ga0068854_101849312
548 Ga0068856_100554513
549 Ga0070702_100484421
550 Ga0070702_100742261
551 Ga0068852_100092884
552 Ga0068859_100050942
553 Ga0068859_100872056
554 Ga0068864_100004827
555 Ga0068864_100096849
556 Ga0068864_100365489
557 Ga0068864_100514965
558 Ga0068866_10069110
559 Ga0068866_10102440
560 Ga0068866_10677437
561 Ga0068861_100010302
562 Ga0068861_100042956
563 Ga0068861_100591981
564 Ga0068861_102628788
565 Ga0068870_10056700
566 Ga0068870_10294002
567 Ga0068870_10328508
568 Ga0068870_10750397
569 Ga0068863_100003529
570 Ga0068863_100015448
571 Ga0068863_100088595
572 Ga0068863_100126011
573 Ga0068863_100386321
574 Ga0068863_101362858
575 Ga0068863_101404640
576 Ga0068858_100004634
577 Ga0068860_100000969
578 Ga0068860_100007946
579 Ga0068860_100246144
580 Ga0068860_100801311
581 Ga0068862_100013574
582 Ga0068862_100059728
583 Ga0068862_100142758
584 Ga0068862_100162417
585 Ga0068862_100258111
586 Ga0068862_100451881
587 Ga0070715_10845406
588 Ga0097621_100047799
589 Ga0097621_100220545
590 Ga0097621_100329123
591 Ga0097621_100842787
592 Ga0068871_100022310
593 Ga0068871_100030082
594 Ga0068871_100211439
595 Ga0068871_100962310
596 Ga0075428_100521891
597 Ga0075428_100901857
598 Ga0075430_100181701
599 Ga0075430_100341720
600 Ga0075431_100206101
601 Ga0075431_100245213
602 Ga0075429_100207301
603 Ga0068865_100098189
604 Ga0068865_101304281
605 Ga0097620_100050939
606 Ga0097620_100872052
607 Ga0099795_10000031
608 Ga0099795_10002758
609 Ga0099795_10362982
610 Ga0105240_10120086
611 Ga0105240_10422922
612 Ga0105240_10451665
613 Ga0111539_10197721
614 Ga0111539_10512921
615 Ga0111539_10568065
616 Ga0111539_12296488
617 Ga0105245_10018503
618 Ga0105247_10048816
619 Ga0105247_10430610
620 Ga0105243_12713737
621 Ga0105241_11172048
622 Ga0105242_10078757
623 Ga0105242_10127315
624 Ga0105237_10270060
625 Ga0105237_10333517
626 Ga0105238_10071797
627 Ga0105238_10338232
628 Ga0105238_10471155
629 Ga0105249_10191896
630 Ga0105249_10312581
631 Ga0105249_10345944
632 Ga0099796_10000176
633 Ga0099796_10004827
634 Ga0105246_10564332
635 Ga0105246_11989896
636 Ga0157374_10004260
637 Ga0157374_10851643
638 Ga0157374_11007361
639 Ga0157374_11542215
640 Ga0157378_10014449
641 Ga0157378_10075042
642 Ga0163162_10028144
643 Ga0163162_10112393
644 Ga0163162_10272805
645 Ga0157375_10006526
646 Ga0157375_10366409
647 Ga0157375_10411707
648 Ga0157375_12301080
649 Ga0157375_12952126
650 Ga0163163_10007202
651 Ga0163163_10013185
652 Ga0163163_10081106
653 Ga0163163_11012485
654 Ga0163163_11284832
655 Ga0163163_11702541
656 Ga0163163_11997956
657 Ga0157380_10136664
658 Ga0157380_10160911
659 Ga0157380_10402932
660 Ga0157380_11593049
661 Ga0157377_10201637
662 Ga0157379_10000582
663 Ga0157379_10130448
664 Ga0157379_10287929
665 Ga0157379_10392068
666 Ga0157379_11506119
667 Ga0157379_11942437
668 Ga0157379_12208874
669 Ga0157376_10083972
670 Ga0157376_10918356
671 Ga0157376_11231147
672 Ga0163161_10368774
673 Ga0207697_10050709
674 Ga0207656_10031639
675 Ga0207682_10032478
676 Ga0207682_10261088
677 Ga0207710_10019491
678 Ga0207647_10070679
679 Ga0207685_10585240
680 Ga0207645_10001943
681 Ga0207645_10040901
682 Ga0207645_10274775
683 Ga0207643_10025188
684 Ga0207643_10029232
685 Ga0207643_10049098
686 Ga0207643_10341926
687 Ga0207654_10432969
688 Ga0207695_10111153
689 Ga0207695_10145496
690 Ga0207671_11559772
691 Ga0207663_10047292
692 Ga0207660_10055208
693 Ga0207681_10036333
694 Ga0207681_10078496
695 Ga0207681_10306301
696 Ga0207694_10021083
697 Ga0207694_11033331
698 Ga0207650_10015673
699 Ga0207650_10036728
700 Ga0207650_10098764
701 Ga0207650_10112969
702 Ga0207650_10196622
703 Ga0207650_10657464
704 Ga0207650_10968706
705 Ga0207659_10038855
706 Ga0207659_10090931
707 Ga0207659_10103261
708 Ga0207687_10040686
709 Ga0207700_10404572
710 Ga0207644_10370264
711 Ga0207644_10385652
712 Ga0207644_10586909
713 Ga0207706_10002027
714 Ga0207706_10036879
715 Ga0207706_10955499
716 Ga0207706_10984613
717 Ga0207686_11599124
718 Ga0207709_10228439
719 Ga0207670_11430550
720 Ga0207669_10177379
721 Ga0207669_10557115
722 Ga0207704_10050993
723 Ga0207704_10291126
724 Ga0207691_10003185
725 Ga0207691_10008910
726 Ga0207691_10019894
727 Ga0207691_11113373
728 Ga0207711_10007272
729 Ga0207689_10134236
730 Ga0207689_10213430
731 Ga0207689_10503047
732 Ga0207679_10546408
733 Ga0207679_11405330
734 Ga0207667_10358822
735 Ga0207667_10440892
736 Ga0207651_10030802
737 Ga0207651_10124449
738 Ga0207651_10666526
739 Ga0207712_10366948
740 Ga0207712_11263253
741 Ga0207668_10006060
742 Ga0207668_10081796
743 Ga0207668_10271254
744 Ga0207668_10377909
745 Ga0207640_10138815
746 Ga0207658_10015518
747 Ga0207658_10039912
748 Ga0207658_10900362
749 Ga0207658_10965458
750 Ga0207677_11404093
751 Ga0207703_10006729
752 Ga0207703_10073313
753 Ga0207703_10798669
754 Ga0207639_10251175
755 Ga0207639_11687845
756 Ga0207678_10031531
757 Ga0207702_10258641
758 Ga0207641_10000247
759 Ga0207641_10007406
760 Ga0207641_10087237
761 Ga0207641_10125295
762 Ga0207641_10250646
763 Ga0207648_10001335
764 Ga0207648_10021635
765 Ga0207648_10218823
766 Ga0207676_10005172
767 Ga0207676_10276775
768 Ga0207674_10400479
769 Ga0207674_10840080
770 Ga0207674_11196552
771 Ga0207674_11984954
772 Ga0207675_100002343
773 Ga0207675_100012965
774 Ga0207675_100171288
775 Ga0207683_10040971
776 Ga0207683_10131420
777 Ga0207683_11616569
778 Ga0209996_1058556
779 Ga0209179_1000014
780 Ga0209971_1002808
781 Ga0209998_10000619
782 Ga0209974_10027535
783 Ga0207428_10193590
784 Ga0265356_1000760
785 Ga0268266_10000898
786 Ga0268266_10047272
787 Ga0268266_10395964
788 Ga0268266_10952153
789 Ga0268265_10058118
790 Ga0268265_10062787
791 Ga0268265_10198007
792 Ga0268265_10576440
793 Ga0268265_10896708
794 Ga0268264_10000165
795 Ga0268264_10005594
796 Ga0268264_10477341
797 Ga0268264_10597412
798 Ga0268264_11347090
799 Ga0307515_10756844
800 Ga0265338_10180337
801 Ga0307511_10000529
802 Ga0265332_10229379
803 Ga0265328_10022565
804 Ga0265340_10058621
805 Ga0265316_10509866
806 Ga0265316_10522686
807 Ga0307509_10648544
808 Ga0265314_10173581
809 Ga0307410_10048399
810 Ga0307409_101301643
811 Ga0307416_100204005
812 Ga0307414_10808786
813 Ga0307510_10000015
814 Ga0307510_10014855
815 Ga0307510_10393395
816 Ga0373923_0257048
817 Ga0373936_0579994
818 Ga0373945_0075920
819 Ga0373954_0271922
820 Ga0373956_0185601
821 Ga0373957_0556809
822 Ga0373955_0489501
823 Ga0373955_0904283
824 Ga0373935_1028525
825 Ga0373935_1166987
826 Ga0373933_1089206
827 Ga0373937_0108056
828 Ga0373937_0167497
829 Ga0373937_0764940
830 Ga0373925_0126384
831 Ga0373925_0223705
832 Ga0436364_0950737
833 Ga0436365_0172328
834 Ga0436360_0203958
835 Ga0436363_0465820
836 Ga0436363_0734725
837 Ga0451807_2097254
838 Ga0451835_0558620
839 Ga0451845_0661823
840 Ga0451853_0733419
841 Ga0451577_0035916
842 Ga0451577_0278947
843 Ga0466972_0350870
844 Ga0453683_0215877
845 Ga0466961_0174322
846 Ga0453684_0109403
847 Ga0453684_0148364
848 Ga0453684_0725822
849 Ga0466959_0018030
850 Ga0451576_0035796
851 Ga0451576_1363206
852 Ga0495629_1152014
853 Ga0495606_0082679
854 Ga0495616_0290926
855 Ga0495628_0608552
856 Ga0495632_0041722
857 Ga0495643_0164487
858 Ga0495645_0683224
859 Ga0495625_0335049
860 Ga0495671_0302432
861 Ga0495671_0650882
862 Ga0495674_0552005
863 Ga0495687_159352
864 Ga0496100_0022871
865 Ga0496100_0174485
866 Ga0496101_0296254
867 Ga0496101_0488487
868 Ga0496102_0003397
869 Ga0496103_0061097
870 Ga0496104_0038786
871 Ga0496104_0234607
872 Ga0496104_1356995
873 Ga0496105_0099041
874 Ga0496106_0464461
875 Ga0496106_0985439
876 Ga0496108_0485829
877 Ga0496109_0187116
878 Ga0496109_1230290
879 Ga0496110_0116390
880 Ga0496110_0553564
881 Ga0496111_0069369
882 Ga0496113_0453017
883 Ga0496114_0016670
884 Ga0496114_0261300
885 Ga0496114_0611924
886 Ga0496115_0020873
887 Ga0496115_0350618
888 Ga0496116_0061285
889 Ga0496117_0000106
890 Ga0496118_0000005
891 Ga0496119_0021531
892 Ga0496120_0055504
893 Ga0496120_0272057
894 Ga0496121_0042460
895 Ga0496121_0137436
896 Ga0496124_0028187
897 Ga0496125_0000711
898 Ga0496125_0009678
899 Ga0496126_0023942
900 Ga0496126_0100760
901 nmdc:mga05p37_668059_c1
902 nmdc:mga09592_93737_c1
903 nmdc:mga0qj67_965645_c1
904 nmdc:mga06r32_128355_c1
905 nmdc:mga06r32_191004_c1
906 nmdc:mga08y16_164900_c1
907 nmdc:mga08y16_771034_c1
908 Ga0495601_0321898
909 Ga0495595_0103336
910 Ga0495619_0448187
911 Ga0495619_0483272
912 Ga0500583_0544444
913 Ga0500591_120954
914 Ga0500636_0153819
915 Ga0587067_139025
916 Ga0466962_0193399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13769

Virulence_fact

Virulence factor

8

92

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cma-assembly1.cif.gz_C-2 structure of a151r from african swine fever virus georgia 0.6843 4 33
5av7-assembly1.cif.gz_A crystal structure of calsepa lectin in complex with bisected glycan 0.6664 3 28
2z0l-assembly1.cif.gz_A crystal structure of ebv-dna polymerase accessory protein bmrf1 0.6088 2 30
3f8t-assembly1.cif.gz_A crystal structure analysis of a full-length mcm homolog from methanopyrus kandleri 0.5829 2 29
6f97-assembly1.cif.gz_B crystal structure of the v465t mutant of 5-(hydroxymethyl)furfural oxidase (hmfo) 0.5807 2 28
ID Description Score Start End Superfamily
af_F1QEB7_661_850_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7195 1 27 2.130.10.10
af_Q9R069_26_139_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6953 2 30 2.60.40.10
5av7A00 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.6664 3 28 2.100.10.30
3aqgA00 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.6553 1 30 2.100.10.30
af_Q9US12_483_612_2.100.10.30 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.655 5 28 2.100.10.30
ID Description Score Start End GO Terms
AF-A0A369T6C9-F1-model_v4 Virulence factor domain-containing protein 0.9889 1 98
AF-A0A2S6R4G4-F1-model_v4 Virulence factor domain-containing protein 0.9871 2 98
AF-A0A0A0DBM2-F1-model_v4 Virulence factor domain-containing protein 0.9833 1 99
AF-A0A2E7BC90-F1-model_v4 Virulence factor domain-containing protein 0.9825 1 98
AF-A0A1W9KGC7-F1-model_v4 deleted 0.9823 1 98

Map