F448152

General Info

Members Datasets Scaffolds Average Seq Length
458 220 458 197

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100004878|Ga0068853_1000048788
Length 204
Sequence MFTGIITDIGTIRAAEQRGDLRLTIDCSYAMDTVAIGASIACSGACLTVVAKGPDWFAADLSAETVARTAPGLWAVGGKLNLERAAKVGDELGGHIVTGHVDGIGTVVGICPEGDSHRVGFSAPPEIAPLIAPKGSITIDGVSLTVNDVRDGARNGGNETHFSVNLIPHTWQVTTLGALAIGKPVNLEIDIIARYLSRMRSYVG

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0
Rhizoplane 4.8
Rhizosphere 79.04
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10003196 3300003791 Bacteria 9603
2 Ga0055530_10034121 3300003791 Bacteria 1303
3 Ga0055531_10008221 3300003794 Bacteria 5554
4 Ga0055531_10027122 3300003794 Bacteria 2020
5 Ga0055531_10039064 3300003794 Bacteria 1415
6 Ga0065165_1002063 3300005262 Bacteria 18574
7 Ga0065707_10089398 3300005295 Bacteria 4382
8 Ga0070658_10797069 3300005327 Bacteria 821
9 Ga0070658_10888734 3300005327 Bacteria 774
10 Ga0070683_101061174 3300005329 Bacteria 778
11 Ga0070670_100000039 3300005331 Bacteria 152618
12 Ga0070670_100245898 3300005331 Bacteria 1558
13 Ga0068869_100750441 3300005334 Bacteria 835
14 Ga0070666_10097235 3300005335 Bacteria 2027
15 Ga0070680_100000595 3300005336 Bacteria 24971
16 Ga0070680_100016657 3300005336 Bacteria 5787
17 Ga0070660_100064898 3300005339 Bacteria 2841
18 Ga0070660_100189065 3300005339 Bacteria 1668
19 Ga0070660_100198255 3300005339 Bacteria 1628
20 Ga0070660_100227869 3300005339 Bacteria 1516
21 Ga0070691_10071252 3300005341 Bacteria 1687
22 Ga0070691_10180539 3300005341 Bacteria 1099
23 Ga0070692_10594425 3300005345 Bacteria 731
24 Ga0070668_100001314 3300005347 Bacteria 17796
25 Ga0070668_100010134 3300005347 Bacteria 6988
26 Ga0070668_100049606 3300005347 Bacteria 3229
27 Ga0070668_100085198 3300005347 Bacteria 2483
28 Ga0070668_100092997 3300005347 Bacteria 2379
29 Ga0070668_100438515 3300005347 Bacteria 1121
30 Ga0070675_100463315 3300005354 Bacteria 1138
31 Ga0070671_100162059 3300005355 Bacteria 1891
32 Ga0070671_100187745 3300005355 Bacteria 1751
33 Ga0070671_100357505 3300005355 Bacteria 1247
34 Ga0070673_100029285 3300005364 Bacteria 4105
35 Ga0070659_100015408 3300005366 Bacteria 5726
36 Ga0070659_100081660 3300005366 Bacteria 2582
37 Ga0070667_100000164 3300005367 Bacteria 82930
38 Ga0070667_100002234 3300005367 Bacteria 17045
39 Ga0070667_100009378 3300005367 Bacteria 8116
40 Ga0070678_100102871 3300005456 Bacteria 2218
41 Ga0070662_100081290 3300005457 Bacteria 2414
42 Ga0070681_10006620 3300005458 Bacteria 11282
43 Ga0070681_10054252 3300005458 Bacteria 3993
44 Ga0070681_10063126 3300005458 Bacteria 3677
45 Ga0070681_10114667 3300005458 Bacteria 2633
46 Ga0070679_100009570 3300005530 Bacteria 9165
47 Ga0070679_100013942 3300005530 Bacteria 7702
48 Ga0070679_100045010 3300005530 Bacteria 4397
49 Ga0068853_100004878 3300005539 Bacteria 10436
50 Ga0068853_100029981 3300005539 Bacteria 4591
51 Ga0068853_100337883 3300005539 Bacteria 1399
52 Ga0068853_100983733 3300005539 Bacteria 812
53 Ga0068853_101432065 3300005539 Bacteria 669
54 Ga0070693_100372293 3300005547 Bacteria 983
55 Ga0070665_100000327 3300005548 Bacteria 73382
56 Ga0070665_100000489 3300005548 Bacteria 56677
57 Ga0070665_100000884 3300005548 Bacteria 38426
58 Ga0070665_100057710 3300005548 Bacteria 3892
59 Ga0070665_100535709 3300005548 Bacteria 1183
60 Ga0068855_100011800 3300005563 Bacteria 10564
61 Ga0068855_100012184 3300005563 Bacteria 10392
62 Ga0068855_100086795 3300005563 Bacteria 3618
63 Ga0068855_100116069 3300005563 Bacteria 3068
64 Ga0068855_100132845 3300005563 Bacteria 2841
65 Ga0068855_100885675 3300005563 Bacteria 944
66 Ga0070664_100020803 3300005564 Bacteria 5405
67 Ga0070664_100054641 3300005564 Bacteria 3389
68 Ga0068857_100014812 3300005577 Bacteria 6802
69 Ga0068856_100137406 3300005614 Bacteria 2450
70 Ga0068856_100218507 3300005614 Bacteria 1921
71 Ga0068856_100296961 3300005614 Bacteria 1633
72 Ga0068852_100006205 3300005616 Bacteria 8617
73 Ga0068852_100017395 3300005616 Bacteria 5641
74 Ga0068852_100730146 3300005616 Bacteria 1002
75 Ga0068859_100074718 3300005617 Bacteria 3428
76 Ga0068859_100198810 3300005617 Bacteria 2089
77 Ga0068864_100000068 3300005618 Bacteria 115507
78 Ga0068864_100000115 3300005618 Bacteria 79542
79 Ga0068864_100184243 3300005618 Bacteria 1910
80 Ga0068864_100535460 3300005618 Bacteria 1131
81 Ga0068864_101246812 3300005618 Bacteria 743
82 Ga0068861_100103396 3300005719 Bacteria 2270
83 Ga0068861_100227695 3300005719 Bacteria 1579
84 Ga0068861_101358518 3300005719 Bacteria 693
85 Ga0068863_100000007 3300005841 Bacteria 257578
86 Ga0068863_100051273 3300005841 Bacteria 3911
87 Ga0068863_100717119 3300005841 Bacteria 995
88 Ga0068858_100000031 3300005842 Bacteria 143397
89 Ga0068858_100002686 3300005842 Bacteria 17901
90 Ga0068858_100159440 3300005842 Bacteria 2124
91 Ga0068858_100217668 3300005842 Bacteria 1808
92 Ga0068860_100000139 3300005843 Bacteria 119188
93 Ga0068860_100000625 3300005843 Bacteria 41833
94 Ga0068860_100026830 3300005843 Bacteria 5550
95 Ga0068860_100039597 3300005843 Bacteria 4508
96 Ga0068862_100001908 3300005844 Bacteria 18938
97 Ga0068862_100011747 3300005844 Bacteria 7227
98 Ga0068862_100030528 3300005844 Bacteria 4542
99 Ga0068862_100056498 3300005844 Bacteria 3363
100 Ga0068862_100097646 3300005844 Bacteria 2565
101 Ga0068862_100162469 3300005844 Bacteria 1995
102 Ga0068862_100496724 3300005844 Bacteria 1157
103 Ga0070717_10235061 3300006028 Bacteria 1614
104 Ga0075362_10055552 3300006177 Bacteria 1781
105 Ga0075362_10344180 3300006177 Bacteria 745
106 Ga0075370_10076570 3300006353 Bacteria 1919
107 Ga0068865_100014225 3300006881 Bacteria 5051
108 Ga0097620_100074716 3300006931 Bacteria 3428
109 Ga0097620_100198806 3300006931 Bacteria 2089
110 Ga0105240_10008921 3300009093 Bacteria 14257
111 Ga0105240_10012992 3300009093 Bacteria 11468
112 Ga0105240_10050283 3300009093 Bacteria 5256
113 Ga0105240_10105361 3300009093 Bacteria 3423
114 Ga0105240_10156827 3300009093 Bacteria 2706
115 Ga0105240_10263605 3300009093 Bacteria 1987
116 Ga0105245_10019471 3300009098 Bacteria 5946
117 Ga0105243_10549498 3300009148 Bacteria 1103
118 Ga0105243_11520494 3300009148 Bacteria 694
119 Ga0105241_10237200 3300009174 Bacteria 1540
120 Ga0105248_10015263 3300009177 Bacteria 8467
121 Ga0105248_10039633 3300009177 Bacteria 5279
122 Ga0105248_10066598 3300009177 Bacteria 4044
123 Ga0105248_10117460 3300009177 Bacteria 3000
124 Ga0105248_10271360 3300009177 Bacteria 1910
125 Ga0105248_10724761 3300009177 Bacteria 1122
126 Ga0105237_10598610 3300009545 Bacteria 1109
127 Ga0105238_10021552 3300009551 Bacteria 6563
128 Ga0105238_10044939 3300009551 Bacteria 4464
129 Ga0105238_10057727 3300009551 Bacteria 3891
130 Ga0105249_10001181 3300009553 Bacteria 23119
131 Ga0105239_10216562 3300010375 Bacteria 2147
132 Ga0105239_10614585 3300010375 Bacteria 1240
133 Ga0105239_10737241 3300010375 Bacteria 1127
134 Ga0105239_10770756 3300010375 Bacteria 1101
135 Ga0105239_11398715 3300010375 Bacteria 808
136 Ga0157373_10002645 3300013100 Bacteria 13586
137 Ga0157373_10015335 3300013100 Bacteria 5601
138 Ga0157370_10129336 3300013104 Bacteria 2356
139 Ga0157370_10407612 3300013104 Bacteria 1251
140 Ga0157372_10315870 3300013307 Bacteria 1819
141 Ga0157375_10095126 3300013308 Bacteria 3049
142 Ga0163163_10040269 3300014325 Bacteria 4563
143 Ga0163163_10171221 3300014325 Bacteria 2218
144 Ga0163163_10395112 3300014325 Bacteria 1441
145 Ga0157380_10258644 3300014326 Bacteria 1580
146 Ga0157379_10024461 3300014968 Bacteria 5361
147 Ga0157379_10024695 3300014968 Bacteria 5334
148 Ga0157379_10136688 3300014968 Bacteria 2208
149 Ga0157379_11123088 3300014968 Bacteria 753
150 Ga0213876_10011757 3300021384 Bacteria 4671
151 Ga0209026_1000477 3300025250 Bacteria 30249
152 Ga0209676_1000061 3300025292 Bacteria 332674
153 Ga0209676_1014503 3300025292 Bacteria 2959
154 Ga0209758_1002231 3300025297 Bacteria 20133
155 Ga0209050_1000200 3300025298 Bacteria 134115
156 Ga0209050_1007833 3300025298 Bacteria 5871
157 Ga0209257_1000225 3300025304 Bacteria 134023
158 Ga0209257_1000439 3300025304 Bacteria 79332
159 Ga0209257_1000514 3300025304 Bacteria 67345
160 Ga0207680_10050984 3300025903 Bacteria 2473
161 Ga0207680_10517450 3300025903 Bacteria 851
162 Ga0207705_10022751 3300025909 Bacteria 4470
163 Ga0207705_10183726 3300025909 Bacteria 1579
164 Ga0207707_10008709 3300025912 Bacteria 8803
165 Ga0207707_10025726 3300025912 Bacteria 5148
166 Ga0207707_10044666 3300025912 Bacteria 3862
167 Ga0207707_10061291 3300025912 Bacteria 3273
168 Ga0207695_10000728 3300025913 Bacteria 63935
169 Ga0207695_10002551 3300025913 Bacteria 26766
170 Ga0207695_10010898 3300025913 Bacteria 11064
171 Ga0207695_10014064 3300025913 Bacteria 9503
172 Ga0207695_10017230 3300025913 Bacteria 8414
173 Ga0207695_10131306 3300025913 Bacteria 2462
174 Ga0207660_10005567 3300025917 Bacteria 8182
175 Ga0207660_10032401 3300025917 Bacteria 3607
176 Ga0207660_10112819 3300025917 Bacteria 2048
177 Ga0207657_10004872 3300025919 Bacteria 14126
178 Ga0207657_10191521 3300025919 Bacteria 1650
179 Ga0207657_10315221 3300025919 Bacteria 1237
180 Ga0207652_10006779 3300025921 Bacteria 9235
181 Ga0207652_10014009 3300025921 Bacteria 6492
182 Ga0207681_10058520 3300025923 Bacteria 2639
183 Ga0207694_10016558 3300025924 Bacteria 5566
184 Ga0207694_10017119 3300025924 Bacteria 5476
185 Ga0207694_10046881 3300025924 Bacteria 3341
186 Ga0207694_10621894 3300025924 Bacteria 909
187 Ga0207650_10000099 3300025925 Bacteria 113522
188 Ga0207650_10194608 3300025925 Bacteria 1622
189 Ga0207650_10217517 3300025925 Bacteria 1536
190 Ga0207650_10268261 3300025925 Bacteria 1387
191 Ga0207644_10023439 3300025931 Bacteria 4228
192 Ga0207644_10076708 3300025931 Bacteria 2459
193 Ga0207644_10682284 3300025931 Bacteria 856
194 Ga0207690_10000294 3300025932 Bacteria 35162
195 Ga0207690_10026746 3300025932 Bacteria 3636
196 Ga0207706_10025131 3300025933 Bacteria 5340
197 Ga0207706_10279711 3300025933 Bacteria 1455
198 Ga0207709_10270111 3300025935 Bacteria 1251
199 Ga0207704_10000378 3300025938 Bacteria 20477
200 Ga0207711_10001005 3300025941 Bacteria 27049
201 Ga0207711_10002202 3300025941 Bacteria 17507
202 Ga0207711_10010573 3300025941 Bacteria 7671
203 Ga0207711_10050004 3300025941 Bacteria 3579
204 Ga0207711_10243990 3300025941 Bacteria 1648
205 Ga0207711_10402481 3300025941 Bacteria 1272
206 Ga0207711_10944826 3300025941 Bacteria 801
207 Ga0207689_10500446 3300025942 Bacteria 1018
208 Ga0207689_10641747 3300025942 Bacteria 894
209 Ga0207661_11131109 3300025944 Bacteria 721
210 Ga0207679_10025200 3300025945 Bacteria 4088
211 Ga0207679_10441677 3300025945 Bacteria 1152
212 Ga0207667_10006530 3300025949 Bacteria 14103
213 Ga0207667_10008653 3300025949 Bacteria 12070
214 Ga0207667_10013885 3300025949 Bacteria 9202
215 Ga0207667_10019379 3300025949 Bacteria 7597
216 Ga0207667_10280556 3300025949 Bacteria 1702
217 Ga0207667_10474936 3300025949 Bacteria 1269
218 Ga0207667_10665006 3300025949 Bacteria 1046
219 Ga0207667_10744389 3300025949 Bacteria 980
220 Ga0207651_10034339 3300025960 Bacteria 3284
221 Ga0207712_10000810 3300025961 Bacteria 23035
222 Ga0207668_10000413 3300025972 Bacteria 26960
223 Ga0207668_10003735 3300025972 Bacteria 8957
224 Ga0207668_10009302 3300025972 Bacteria 5882
225 Ga0207668_10021497 3300025972 Bacteria 4115
226 Ga0207668_10083160 3300025972 Bacteria 2328
227 Ga0207668_10163024 3300025972 Bacteria 1739
228 Ga0207668_10637949 3300025972 Bacteria 931
229 Ga0207658_10000106 3300025986 Bacteria 90920
230 Ga0207658_10008882 3300025986 Bacteria 6819
231 Ga0207703_10000038 3300026035 Bacteria 175917
232 Ga0207703_10002283 3300026035 Bacteria 16717
233 Ga0207703_10394673 3300026035 Bacteria 1282
234 Ga0207639_10079911 3300026041 Bacteria 2585
235 Ga0207639_10254192 3300026041 Bacteria 1534
236 Ga0207639_10688029 3300026041 Bacteria 948
237 Ga0207702_10125055 3300026078 Bacteria 2307
238 Ga0207702_10170954 3300026078 Bacteria 1993
239 Ga0207702_10783651 3300026078 Bacteria 942
240 Ga0207641_10000012 3300026088 Bacteria 375486
241 Ga0207641_10002857 3300026088 Bacteria 15687
242 Ga0207641_10026081 3300026088 Bacteria 4822
243 Ga0207641_10041181 3300026088 Bacteria 3871
244 Ga0207676_10000119 3300026095 Bacteria 69303
245 Ga0207676_10000610 3300026095 Bacteria 29371
246 Ga0207676_10004542 3300026095 Bacteria 9822
247 Ga0207676_10199992 3300026095 Bacteria 1765
248 Ga0207676_10630618 3300026095 Bacteria 1032
249 Ga0207674_10177691 3300026116 Bacteria 2081
250 Ga0207675_100139706 3300026118 Bacteria 2301
251 Ga0207675_100278096 3300026118 Bacteria 1626
252 Ga0207675_100565166 3300026118 Bacteria 1138
253 Ga0207675_100807595 3300026118 Bacteria 952
254 Ga0207683_10055051 3300026121 Bacteria 3489
255 Ga0207698_10071513 3300026142 Bacteria 2753
256 Ga0207698_10076331 3300026142 Bacteria 2681
257 Ga0207698_11138893 3300026142 Bacteria 793
258 Ga0209968_1014060 3300027526 Bacteria 1259
259 Ga0268266_10000064 3300028379 Bacteria 249533
260 Ga0268266_10001163 3300028379 Bacteria 32562
261 Ga0268266_10004729 3300028379 Bacteria 12943
262 Ga0268266_10184589 3300028379 Bacteria 1901
263 Ga0268265_10003868 3300028380 Bacteria 10572
264 Ga0268265_10007069 3300028380 Bacteria 7589
265 Ga0268265_10015891 3300028380 Bacteria 5163
266 Ga0268265_10027889 3300028380 Bacteria 4037
267 Ga0268265_10041590 3300028380 Bacteria 3403
268 Ga0268265_10057320 3300028380 Bacteria 2968
269 Ga0268265_10063263 3300028380 Bacteria 2846
270 Ga0268264_10000046 3300028381 Bacteria 364597
271 Ga0268264_10000059 3300028381 Bacteria 306927
272 Ga0268264_10264489 3300028381 Bacteria 1604
273 Ga0268264_10405675 3300028381 Bacteria 1311
274 Ga0307517_10012217 3300028786 Bacteria 11814
275 Ga0307517_10123315 3300028786 Bacteria 1904
276 Ga0307517_10188608 3300028786 Bacteria 1314
277 Ga0265338_10048920 3300028800 Bacteria 3839
278 Ga0265338_10094574 3300028800 Bacteria 2458
279 Ga0265324_10113972 3300029957 Bacteria 918
280 Ga0307511_10036802 3300030521 Bacteria 4241
281 Ga0265332_10105906 3300031238 Bacteria 1186
282 Ga0265320_10038813 3300031240 Bacteria 2386
283 Ga0265340_10023067 3300031247 Bacteria 3175
284 Ga0265327_10000758 3300031251 Bacteria 50091
285 Ga0265327_10001144 3300031251 Bacteria 36241
286 Ga0307513_10000181 3300031456 Bacteria 91264
287 Ga0307513_10002130 3300031456 Bacteria 27783
288 Ga0307513_10025779 3300031456 Bacteria 6800
289 Ga0307513_10027970 3300031456 Bacteria 6461
290 Ga0307513_10416694 3300031456 Bacteria 1074
291 Ga0307408_100525866 3300031548 Bacteria 1040
292 Ga0307516_10000004 3300031730 Bacteria 367451
293 Ga0307410_10382143 3300031852 Bacteria 1133
294 Ga0307406_10001331 3300031901 Bacteria 13870
295 Ga0307407_10068692 3300031903 Bacteria 2100
296 Ga0307412_10003813 3300031911 Bacteria 8385
297 Ga0307409_100102691 3300031995 Bacteria 2376
298 Ga0307414_10107772 3300032004 Bacteria 2112
299 Ga0307414_10368565 3300032004 Bacteria 1238
300 Ga0307414_10382388 3300032004 Bacteria 1217
301 Ga0307414_10907328 3300032004 Bacteria 808
302 Ga0307414_11092628 3300032004 Bacteria 736
303 Ga0307411_10050887 3300032005 Bacteria 2700
304 Ga0307411_10195685 3300032005 Bacteria 1548
305 Ga0307510_10056604 3300033180 Bacteria 4080
306 Ga0373935_0536879 3300035692 Bacteria 852
307 Ga0373927_0073140 3300035695 Bacteria 2219
308 Ga0373933_0318877 3300035724 Bacteria 1008
309 Ga0373947_0074166 3300035725 Bacteria 2093
310 Ga0373937_0455044 3300036401 Bacteria 1216
311 Ga0373937_0568236 3300036401 Bacteria 1077
312 Ga0373925_0004687 3300037068 Bacteria 10318
313 Ga0373925_0050501 3300037068 Bacteria 3102
314 Ga0395899_0000013 3300037312 Bacteria 510397
315 Ga0395899_0000100 3300037312 Bacteria 151710
316 Ga0395899_0038557 3300037312 Bacteria 3578
317 Ga0395899_0105750 3300037312 Bacteria 2027
318 Ga0395899_0128641 3300037312 Bacteria 1810
319 Ga0395900_0000009 3300037418 Bacteria 476249
320 Ga0395900_0029418 3300037418 Bacteria 5635
321 Ga0395900_0137456 3300037418 Bacteria 2504
322 Ga0395900_0950113 3300037418 Bacteria 781
323 Ga0395898_0101595 3300037466 Bacteria 2761
324 Ga0395905_0016592 3300037471 Bacteria 6999
325 Ga0395905_0086901 3300037471 Bacteria 2931
326 Ga0395905_0146779 3300037471 Bacteria 2219
327 Ga0395905_0469954 3300037471 Bacteria 1156
328 Ga0395905_0652825 3300037471 Bacteria 954
329 Ga0395905_0894803 3300037471 Bacteria 791
330 Ga0395901_0000014 3300038443 Bacteria 375100
331 Ga0395901_0218675 3300038443 Bacteria 1992
332 Ga0436365_1385343 3300039437 Bacteria 889
333 Ga0436365_1649611 3300039437 Bacteria 5929
334 Ga0436361_0511852 3300039447 Bacteria 4509
335 Ga0436361_1042392 3300039447 Bacteria 2036
336 Ga0451849_0455578 3300041505 Bacteria 751
337 Ga0451853_0347771 3300041512 Bacteria 786
338 Ga0466961_0128085 3300044693 Bacteria 1592
339 Ga0466964_0242360 3300044706 Bacteria 885
340 Ga0466960_0266682 3300044901 Bacteria 956
341 Ga0466959_0025528 3300045049 Bacteria 4380
342 Ga0466967_0938499 3300045976 Bacteria 861
343 Ga0495638_0222461 3300046460 Bacteria 1054
344 Ga0495651_0420671 3300046462 Bacteria 869
345 Ga0495584_0059892 3300046491 Bacteria 1915
346 Ga0495585_0322406 3300046492 Bacteria 755
347 Ga0495583_0017377 3300046506 Bacteria 3822
348 Ga0495606_0168265 3300046507 Bacteria 1274
349 Ga0495620_0029351 3300046515 Bacteria 2546
350 Ga0495637_0117462 3300046520 Bacteria 1026
351 Ga0495643_0043779 3300046522 Bacteria 2434
352 Ga0495648_0231905 3300046524 Bacteria 903
353 Ga0495642_0010364 3300046528 Bacteria 3570
354 Ga0495642_0383763 3300046528 Bacteria 619
355 Ga0495586_0019211 3300046535 Bacteria 3635
356 Ga0495597_0012714 3300046542 Bacteria 4054
357 Ga0495645_0363178 3300046543 Bacteria 930
358 Ga0495622_0009433 3300046557 Bacteria 4514
359 Ga0495622_0216648 3300046557 Bacteria 849
360 Ga0495668_0037638 3300046616 Bacteria 2707
361 Ga0495668_0188099 3300046616 Bacteria 1131
362 Ga0495625_0072987 3300046660 Bacteria 2406
363 Ga0495625_0119985 3300046660 Bacteria 1790
364 Ga0495625_0147534 3300046660 Bacteria 1583
365 Ga0495625_0286025 3300046660 Bacteria 1059
366 Ga0495659_0173880 3300046664 Bacteria 875
367 Ga0495647_0019293 3300046681 Bacteria 2437
368 Ga0495658_0022467 3300046683 Bacteria 3336
369 Ga0495669_0000001 3300046684 Bacteria 291866
370 Ga0495669_0001628 3300046684 Bacteria 9224
371 Ga0495613_0004569 3300046689 Bacteria 10382
372 Ga0495624_0104075 3300046690 Bacteria 1747
373 Ga0495649_0002816 3300046694 Bacteria 12104
374 Ga0495672_0041690 3300047320 Bacteria 2774
375 Ga0495686_0005471 3300047472 Bacteria 10010
376 Ga0496100_0029766 3300048903 Bacteria 3381
377 Ga0496100_0292402 3300048903 Bacteria 1217
378 Ga0496100_0460278 3300048903 Bacteria 976
379 Ga0496101_0101156 3300048904 Bacteria 2158
380 Ga0496101_0369006 3300048904 Bacteria 1129
381 Ga0496102_0060433 3300048905 Bacteria 3466
382 Ga0496106_0476388 3300048909 Bacteria 1003
383 Ga0496107_0164889 3300048910 Bacteria 1643
384 Ga0496107_0324726 3300048910 Bacteria 1145
385 Ga0496108_0009257 3300048911 Bacteria 7968
386 Ga0496109_0048685 3300048912 Bacteria 3856
387 Ga0496110_0186247 3300048913 Bacteria 1885
388 Ga0496111_0491155 3300048914 Bacteria 904
389 Ga0496112_0186065 3300048915 Bacteria 2040
390 Ga0496113_0198381 3300048916 Bacteria 1595
391 Ga0496113_0567332 3300048916 Bacteria 910
392 Ga0496115_0000607 3300048918 Bacteria 27313
393 Ga0496115_0007666 3300048918 Bacteria 7955
394 Ga0496115_0041427 3300048918 Bacteria 3666
395 Ga0496115_0248512 3300048918 Bacteria 1465
396 Ga0496115_0286571 3300048918 Bacteria 1352
397 Ga0496115_0472062 3300048918 Bacteria 1011
398 Ga0496116_0026561 3300048919 Bacteria 4232
399 Ga0496119_0023770 3300048922 Bacteria 4334
400 Ga0496122_0002699 3300048925 Bacteria 24684
401 Ga0496123_0002784 3300048926 Bacteria 20812
402 Ga0496125_0001384 3300048928 Bacteria 35511
403 Ga0501033_0013351 3300049570 Bacteria 6259
404 Ga0501033_0237586 3300049570 Bacteria 1293
405 Ga0501033_0784643 3300049570 Bacteria 645
406 Ga0501034_0606713 3300049571 Bacteria 999
407 Ga0501036_1000082 3300049572 Bacteria 685
408 Ga0501037_0514898 3300049573 Bacteria 810
409 Ga0501043_0259550 3300049579 Bacteria 1337
410 Ga0501047_0001192 3300049581 Bacteria 25737
411 Ga0501047_0127184 3300049581 Bacteria 2429
412 Ga0501047_0172875 3300049581 Bacteria 2029
413 Ga0501047_0356961 3300049581 Bacteria 1298
414 Ga0501047_0411365 3300049581 Bacteria 1185
415 Ga0501048_0610308 3300049582 Bacteria 783
416 Ga0501073_0613798 3300049589 Bacteria 751
417 Ga0501257_004147 3300049686 Bacteria 3151
418 Ga0501257_019396 3300049686 Bacteria 1591
419 Ga0501035_0007223 3300049822 Bacteria 10393
420 Ga0501035_0657847 3300049822 Bacteria 849
421 Ga0501044_0001836 3300049823 Bacteria 24727
422 Ga0501044_0061010 3300049823 Bacteria 3859
423 Ga0501044_0526450 3300049823 Bacteria 1081
424 nmdc:mga06z11_149101_c1 3300050494 Bacteria 1328
425 nmdc:mga07m45_165072_c1 3300050496 Bacteria 1286
426 nmdc:mga07m45_354656_c1 3300050496 Bacteria 852
427 Ga0500635_0001089 3300053080 Bacteria 6493
428 Ga0500644_0002992 3300053088 Bacteria 4189
429 Ga0500647_0003051 3300053091 Bacteria 6424
430 Ga0500583_0113992 3300053092 Bacteria 1333
431 Ga0500566_0023945 3300053094 Bacteria 3586
432 Ga0500555_001231 3300053103 Bacteria 8237
433 Ga0500562_000348 3300053108 Bacteria 11115
434 Ga0500569_001684 3300053109 Bacteria 4216
435 Ga0500572_001672 3300053111 Bacteria 5802
436 Ga0500595_003363 3300053119 Bacteria 7501
437 Ga0500607_038193 3300053121 Bacteria 2614
438 Ga0500607_098274 3300053121 Bacteria 1459
439 Ga0500608_003023 3300053122 Bacteria 6225
440 Ga0500608_005856 3300053122 Bacteria 4935
441 Ga0500642_0015144 3300053130 Bacteria 2891
442 Ga0500642_0044259 3300053130 Bacteria 1938
443 Ga0500559_0000035 3300053136 Bacteria 110851
444 Ga0500559_0009070 3300053136 Bacteria 4323
445 Ga0500559_0086185 3300053136 Bacteria 1433
446 Ga0500559_0199401 3300053136 Bacteria 944
447 Ga0500559_0314884 3300053136 Bacteria 734
448 Ga0500577_0093932 3300053142 Bacteria 1217
449 Ga0500590_010345 3300053148 Bacteria 4710
450 Ga0500590_078279 3300053148 Bacteria 1630
451 Ga0500624_006317 3300053157 Bacteria 1599
452 Ga0500638_009580 3300053162 Bacteria 4199
453 Ga0500639_144775 3300053163 Bacteria 1105
454 Ga0500639_238806 3300053163 Bacteria 740
455 Ga0500636_0014403 3300053177 Bacteria 4651
456 Ga0500637_0032237 3300053178 Bacteria 2921
457 Ga0500625_088297 3300053729 Bacteria 1334
458 Ga0500645_002678 3300053730 Bacteria 7751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100565166 Ga0207675_1005651662 179
2 3300005295 Ga0065707_10089398 Ga0065707_100893982 194
3 3300005719 Ga0068861_100227695 Ga0068861_1002276952 194
4 3300005843 Ga0068860_100039597 Ga0068860_1000395975 194
5 3300005844 Ga0068862_100011747 Ga0068862_1000117474 194
6 3300005844 Ga0068862_100056498 Ga0068862_1000564982 194
7 3300006177 Ga0075362_10055552 Ga0075362_100555522 194
8 3300009148 Ga0105243_10549498 Ga0105243_105494982 194
9 3300014968 Ga0157379_10024461 Ga0157379_100244616 194
10 3300025935 Ga0207709_10270111 Ga0207709_102701111 194
11 3300025942 Ga0207689_10641747 Ga0207689_106417472 194
12 3300026118 Ga0207675_100278096 Ga0207675_1002780962 194
13 3300028380 Ga0268265_10027889 Ga0268265_100278893 194
14 3300028381 Ga0268264_10405675 Ga0268264_104056752 194
15 3300031548 Ga0307408_100525866 Ga0307408_1005258661 194
16 3300035695 Ga0373927_0073140 Ga0373927_0073140_1487_2110 194
17 3300037068 Ga0373925_0004687 Ga0373925_0004687_7681_8304 194
18 3300041505 Ga0451849_0455578 Ga0451849_0455578_76_705 194
19 3300041512 Ga0451853_0347771 Ga0451853_0347771_98_727 194
20 3300046535 Ga0495586_0019211 Ga0495586_0019211_1008_1631 194
21 3300046681 Ga0495647_0019293 Ga0495647_0019293_541_1164 194
22 3300046683 Ga0495658_0022467 Ga0495658_0022467_1692_2315 194
23 3300049823 Ga0501044_0061010 Ga0501044_0061010_2837_3463 194
24 3300050494 nmdc:mga06z11_149101_c1 nmdc:mga06z11_149101_c1_495_1127 194
25 3300005539 Ga0068853_100004878 Ga0068853_1000048788 195
26 3300005577 Ga0068857_100014812 Ga0068857_1000148127 195
27 3300005614 Ga0068856_100137406 Ga0068856_1001374064 195
28 3300005616 Ga0068852_100017395 Ga0068852_1000173956 195
29 3300026078 Ga0207702_10125055 Ga0207702_101250554 195
30 3300026142 Ga0207698_10071513 Ga0207698_100715133 195
31 3300046460 Ga0495638_0222461 Ga0495638_0222461_372_986 195
32 3300046491 Ga0495584_0059892 Ga0495584_0059892_615_1217 195
33 3300046664 Ga0495659_0173880 Ga0495659_0173880_122_724 195
34 3300003791 Ga0055530_10003196 Ga0055530_100031964 196
35 3300003791 Ga0055530_10034121 Ga0055530_100341212 196
36 3300003794 Ga0055531_10008221 Ga0055531_100082214 196
37 3300003794 Ga0055531_10027122 Ga0055531_100271223 196
38 3300003794 Ga0055531_10039064 Ga0055531_100390642 196
39 3300005262 Ga0065165_1002063 Ga0065165_100206316 196
40 3300005327 Ga0070658_10797069 Ga0070658_107970692 196
41 3300005327 Ga0070658_10888734 Ga0070658_108887341 196
42 3300005329 Ga0070683_101061174 Ga0070683_1010611741 196
43 3300005331 Ga0070670_100000039 Ga0070670_10000003968 196
44 3300005331 Ga0070670_100245898 Ga0070670_1002458983 196
45 3300005334 Ga0068869_100750441 Ga0068869_1007504411 196
46 3300005335 Ga0070666_10097235 Ga0070666_100972352 196
47 3300005336 Ga0070680_100000595 Ga0070680_1000005959 196
48 3300005336 Ga0070680_100016657 Ga0070680_1000166574 196
49 3300005339 Ga0070660_100064898 Ga0070660_1000648984 196
50 3300005339 Ga0070660_100189065 Ga0070660_1001890651 196
51 3300005339 Ga0070660_100198255 Ga0070660_1001982552 196
52 3300005339 Ga0070660_100227869 Ga0070660_1002278691 196
53 3300005341 Ga0070691_10071252 Ga0070691_100712522 196
54 3300005341 Ga0070691_10180539 Ga0070691_101805391 196
55 3300005345 Ga0070692_10594425 Ga0070692_105944251 196
56 3300005347 Ga0070668_100001314 Ga0070668_10000131417 196
57 3300005347 Ga0070668_100010134 Ga0070668_1000101343 196
58 3300005347 Ga0070668_100049606 Ga0070668_1000496064 196
59 3300005347 Ga0070668_100085198 Ga0070668_1000851984 196
60 3300005347 Ga0070668_100092997 Ga0070668_1000929972 196
61 3300005347 Ga0070668_100438515 Ga0070668_1004385151 196
62 3300005354 Ga0070675_100463315 Ga0070675_1004633152 196
63 3300005355 Ga0070671_100162059 Ga0070671_1001620592 196
64 3300005355 Ga0070671_100187745 Ga0070671_1001877452 196
65 3300005355 Ga0070671_100357505 Ga0070671_1003575052 196
66 3300005364 Ga0070673_100029285 Ga0070673_1000292854 196
67 3300005366 Ga0070659_100015408 Ga0070659_1000154087 196
68 3300005366 Ga0070659_100081660 Ga0070659_1000816601 196
69 3300005367 Ga0070667_100000164 Ga0070667_10000016464 196
70 3300005367 Ga0070667_100002234 Ga0070667_10000223410 196
71 3300005367 Ga0070667_100009378 Ga0070667_1000093785 196
72 3300005456 Ga0070678_100102871 Ga0070678_1001028713 196
73 3300005457 Ga0070662_100081290 Ga0070662_1000812903 196
74 3300005458 Ga0070681_10006620 Ga0070681_100066202 196
75 3300005458 Ga0070681_10054252 Ga0070681_100542524 196
76 3300005458 Ga0070681_10063126 Ga0070681_100631264 196
77 3300005458 Ga0070681_10114667 Ga0070681_101146672 196
78 3300005530 Ga0070679_100009570 Ga0070679_1000095707 196
79 3300005530 Ga0070679_100013942 Ga0070679_1000139423 196
80 3300005530 Ga0070679_100045010 Ga0070679_1000450106 196
81 3300005539 Ga0068853_100029981 Ga0068853_1000299815 196
82 3300005539 Ga0068853_100337883 Ga0068853_1003378832 196
83 3300005539 Ga0068853_100983733 Ga0068853_1009837331 196
84 3300005539 Ga0068853_101432065 Ga0068853_1014320651 196
85 3300005547 Ga0070693_100372293 Ga0070693_1003722932 196
86 3300005548 Ga0070665_100000327 Ga0070665_10000032752 196
87 3300005548 Ga0070665_100000489 Ga0070665_10000048960 196
88 3300005548 Ga0070665_100000884 Ga0070665_1000008844 196
89 3300005548 Ga0070665_100057710 Ga0070665_1000577101 196
90 3300005548 Ga0070665_100535709 Ga0070665_1005357092 196
91 3300005563 Ga0068855_100011800 Ga0068855_1000118004 196
92 3300005563 Ga0068855_100012184 Ga0068855_1000121842 196
93 3300005563 Ga0068855_100086795 Ga0068855_1000867952 196
94 3300005563 Ga0068855_100116069 Ga0068855_1001160695 196
95 3300005563 Ga0068855_100132845 Ga0068855_1001328452 196
96 3300005563 Ga0068855_100885675 Ga0068855_1008856751 196
97 3300005564 Ga0070664_100020803 Ga0070664_1000208034 196
98 3300005564 Ga0070664_100054641 Ga0070664_1000546412 196
99 3300005614 Ga0068856_100218507 Ga0068856_1002185072 196
100 3300005614 Ga0068856_100296961 Ga0068856_1002969612 196
101 3300005616 Ga0068852_100006205 Ga0068852_1000062057 196
102 3300005616 Ga0068852_100730146 Ga0068852_1007301462 196
103 3300005617 Ga0068859_100074718 Ga0068859_1000747184 196
104 3300005617 Ga0068859_100198810 Ga0068859_1001988102 196
105 3300005618 Ga0068864_100000068 Ga0068864_10000006810 196
106 3300005618 Ga0068864_100000115 Ga0068864_10000011565 196
107 3300005618 Ga0068864_100184243 Ga0068864_1001842433 196
108 3300005618 Ga0068864_100535460 Ga0068864_1005354602 196
109 3300005618 Ga0068864_101246812 Ga0068864_1012468122 196
110 3300005719 Ga0068861_100103396 Ga0068861_1001033964 196
111 3300005719 Ga0068861_101358518 Ga0068861_1013585181 196
112 3300005841 Ga0068863_100000007 Ga0068863_100000007112 196
113 3300005841 Ga0068863_100051273 Ga0068863_1000512734 196
114 3300005841 Ga0068863_100717119 Ga0068863_1007171192 196
115 3300005842 Ga0068858_100000031 Ga0068858_10000003152 196
116 3300005842 Ga0068858_100002686 Ga0068858_10000268610 196
117 3300005842 Ga0068858_100159440 Ga0068858_1001594404 196
118 3300005842 Ga0068858_100217668 Ga0068858_1002176682 196
119 3300005843 Ga0068860_100000139 Ga0068860_100000139110 196
120 3300005843 Ga0068860_100000625 Ga0068860_10000062546 196
121 3300005843 Ga0068860_100026830 Ga0068860_1000268302 196
122 3300005844 Ga0068862_100001908 Ga0068862_1000019088 196
123 3300005844 Ga0068862_100030528 Ga0068862_1000305283 196
124 3300005844 Ga0068862_100097646 Ga0068862_1000976462 196
125 3300005844 Ga0068862_100162469 Ga0068862_1001624692 196
126 3300005844 Ga0068862_100496724 Ga0068862_1004967242 196
127 3300006028 Ga0070717_10235061 Ga0070717_102350612 196
128 3300006177 Ga0075362_10344180 Ga0075362_103441802 196
129 3300006353 Ga0075370_10076570 Ga0075370_100765702 196
130 3300006881 Ga0068865_100014225 Ga0068865_1000142254 196
131 3300006931 Ga0097620_100074716 Ga0097620_1000747164 196
132 3300006931 Ga0097620_100198806 Ga0097620_1001988064 196
133 3300009093 Ga0105240_10008921 Ga0105240_100089217 196
134 3300009093 Ga0105240_10012992 Ga0105240_100129928 196
135 3300009093 Ga0105240_10050283 Ga0105240_100502837 196
136 3300009093 Ga0105240_10105361 Ga0105240_101053614 196
137 3300009093 Ga0105240_10156827 Ga0105240_101568274 196
138 3300009093 Ga0105240_10263605 Ga0105240_102636054 196
139 3300009098 Ga0105245_10019471 Ga0105245_100194717 196
140 3300009148 Ga0105243_11520494 Ga0105243_115204941 196
141 3300009174 Ga0105241_10237200 Ga0105241_102372001 196
142 3300009177 Ga0105248_10015263 Ga0105248_100152638 196
143 3300009177 Ga0105248_10039633 Ga0105248_100396332 196
144 3300009177 Ga0105248_10066598 Ga0105248_100665982 196
145 3300009177 Ga0105248_10117460 Ga0105248_101174601 196
146 3300009177 Ga0105248_10271360 Ga0105248_102713602 196
147 3300009177 Ga0105248_10724761 Ga0105248_107247612 196
148 3300009545 Ga0105237_10598610 Ga0105237_105986102 196
149 3300009551 Ga0105238_10021552 Ga0105238_100215523 196
150 3300009551 Ga0105238_10044939 Ga0105238_100449395 196
151 3300009551 Ga0105238_10057727 Ga0105238_100577274 196
152 3300009553 Ga0105249_10001181 Ga0105249_100011818 196
153 3300010375 Ga0105239_10216562 Ga0105239_102165623 196
154 3300010375 Ga0105239_10614585 Ga0105239_106145852 196
155 3300010375 Ga0105239_10737241 Ga0105239_107372412 196
156 3300010375 Ga0105239_10770756 Ga0105239_107707562 196
157 3300010375 Ga0105239_11398715 Ga0105239_113987152 196
158 3300013100 Ga0157373_10002645 Ga0157373_100026456 196
159 3300013100 Ga0157373_10015335 Ga0157373_100153354 196
160 3300013104 Ga0157370_10129336 Ga0157370_101293364 196
161 3300013104 Ga0157370_10407612 Ga0157370_104076121 196
162 3300013307 Ga0157372_10315870 Ga0157372_103158702 196
163 3300013308 Ga0157375_10095126 Ga0157375_100951264 196
164 3300014325 Ga0163163_10040269 Ga0163163_100402694 196
165 3300014325 Ga0163163_10171221 Ga0163163_101712212 196
166 3300014325 Ga0163163_10395112 Ga0163163_103951122 196
167 3300014326 Ga0157380_10258644 Ga0157380_102586442 196
168 3300014968 Ga0157379_10024695 Ga0157379_100246953 196
169 3300014968 Ga0157379_10136688 Ga0157379_101366884 196
170 3300014968 Ga0157379_11123088 Ga0157379_111230881 196
171 3300021384 Ga0213876_10011757 Ga0213876_100117576 196
172 3300025250 Ga0209026_1000477 Ga0209026_10004778 196
173 3300025292 Ga0209676_1000061 Ga0209676_100006183 196
174 3300025292 Ga0209676_1014503 Ga0209676_10145033 196
175 3300025297 Ga0209758_1002231 Ga0209758_100223120 196
176 3300025298 Ga0209050_1000200 Ga0209050_1000200140 196
177 3300025298 Ga0209050_1007833 Ga0209050_10078332 196
178 3300025304 Ga0209257_1000225 Ga0209257_1000225140 196
179 3300025304 Ga0209257_1000439 Ga0209257_100043975 196
180 3300025304 Ga0209257_1000514 Ga0209257_10005148 196
181 3300025903 Ga0207680_10050984 Ga0207680_100509844 196
182 3300025903 Ga0207680_10517450 Ga0207680_105174501 196
183 3300025909 Ga0207705_10022751 Ga0207705_100227512 196
184 3300025909 Ga0207705_10183726 Ga0207705_101837262 196
185 3300025912 Ga0207707_10008709 Ga0207707_100087094 196
186 3300025912 Ga0207707_10025726 Ga0207707_100257267 196
187 3300025912 Ga0207707_10044666 Ga0207707_100446662 196
188 3300025912 Ga0207707_10061291 Ga0207707_100612912 196
189 3300025913 Ga0207695_10000728 Ga0207695_1000072820 196
190 3300025913 Ga0207695_10002551 Ga0207695_1000255124 196
191 3300025913 Ga0207695_10010898 Ga0207695_100108989 196
192 3300025913 Ga0207695_10014064 Ga0207695_100140648 196
193 3300025913 Ga0207695_10017230 Ga0207695_100172303 196
194 3300025913 Ga0207695_10131306 Ga0207695_101313063 196
195 3300025917 Ga0207660_10005567 Ga0207660_100055677 196
196 3300025917 Ga0207660_10032401 Ga0207660_100324014 196
197 3300025917 Ga0207660_10112819 Ga0207660_101128194 196
198 3300025919 Ga0207657_10004872 Ga0207657_1000487210 196
199 3300025919 Ga0207657_10191521 Ga0207657_101915211 196
200 3300025919 Ga0207657_10315221 Ga0207657_103152211 196
201 3300025921 Ga0207652_10006779 Ga0207652_1000677910 196
202 3300025921 Ga0207652_10014009 Ga0207652_100140097 196
203 3300025923 Ga0207681_10058520 Ga0207681_100585202 196
204 3300025924 Ga0207694_10016558 Ga0207694_100165584 196
205 3300025924 Ga0207694_10017119 Ga0207694_100171194 196
206 3300025924 Ga0207694_10046881 Ga0207694_100468815 196
207 3300025924 Ga0207694_10621894 Ga0207694_106218942 196
208 3300025925 Ga0207650_10000099 Ga0207650_100000994 196
209 3300025925 Ga0207650_10194608 Ga0207650_101946082 196
210 3300025925 Ga0207650_10217517 Ga0207650_102175172 196
211 3300025925 Ga0207650_10268261 Ga0207650_102682612 196
212 3300025931 Ga0207644_10023439 Ga0207644_100234393 196
213 3300025931 Ga0207644_10076708 Ga0207644_100767082 196
214 3300025931 Ga0207644_10682284 Ga0207644_106822841 196
215 3300025932 Ga0207690_10000294 Ga0207690_1000029427 196
216 3300025932 Ga0207690_10026746 Ga0207690_100267464 196
217 3300025933 Ga0207706_10025131 Ga0207706_100251317 196
218 3300025933 Ga0207706_10279711 Ga0207706_102797113 196
219 3300025938 Ga0207704_10000378 Ga0207704_100003789 196
220 3300025941 Ga0207711_10001005 Ga0207711_100010059 196
221 3300025941 Ga0207711_10002202 Ga0207711_100022025 196
222 3300025941 Ga0207711_10010573 Ga0207711_100105734 196
223 3300025941 Ga0207711_10050004 Ga0207711_100500045 196
224 3300025941 Ga0207711_10243990 Ga0207711_102439902 196
225 3300025941 Ga0207711_10402481 Ga0207711_104024811 196
226 3300025941 Ga0207711_10944826 Ga0207711_109448262 196
227 3300025942 Ga0207689_10500446 Ga0207689_105004462 196
228 3300025944 Ga0207661_11131109 Ga0207661_111311091 196
229 3300025945 Ga0207679_10025200 Ga0207679_100252004 196
230 3300025945 Ga0207679_10441677 Ga0207679_104416772 196
231 3300025949 Ga0207667_10006530 Ga0207667_100065305 196
232 3300025949 Ga0207667_10008653 Ga0207667_100086539 196
233 3300025949 Ga0207667_10013885 Ga0207667_100138858 196
234 3300025949 Ga0207667_10019379 Ga0207667_100193794 196
235 3300025949 Ga0207667_10280556 Ga0207667_102805562 196
236 3300025949 Ga0207667_10474936 Ga0207667_104749362 196
237 3300025949 Ga0207667_10665006 Ga0207667_106650062 196
238 3300025949 Ga0207667_10744389 Ga0207667_107443892 196
239 3300025960 Ga0207651_10034339 Ga0207651_100343394 196
240 3300025961 Ga0207712_10000810 Ga0207712_1000081024 196
241 3300025972 Ga0207668_10000413 Ga0207668_1000041317 196
242 3300025972 Ga0207668_10003735 Ga0207668_100037357 196
243 3300025972 Ga0207668_10009302 Ga0207668_100093027 196
244 3300025972 Ga0207668_10021497 Ga0207668_100214974 196
245 3300025972 Ga0207668_10083160 Ga0207668_100831602 196
246 3300025972 Ga0207668_10163024 Ga0207668_101630241 196
247 3300025972 Ga0207668_10637949 Ga0207668_106379492 196
248 3300025986 Ga0207658_10000106 Ga0207658_1000010673 196
249 3300025986 Ga0207658_10008882 Ga0207658_100088825 196
250 3300026035 Ga0207703_10000038 Ga0207703_10000038135 196
251 3300026035 Ga0207703_10002283 Ga0207703_1000228313 196
252 3300026035 Ga0207703_10394673 Ga0207703_103946732 196
253 3300026041 Ga0207639_10079911 Ga0207639_100799112 196
254 3300026041 Ga0207639_10254192 Ga0207639_102541922 196
255 3300026041 Ga0207639_10688029 Ga0207639_106880292 196
256 3300026078 Ga0207702_10170954 Ga0207702_101709542 196
257 3300026078 Ga0207702_10783651 Ga0207702_107836512 196
258 3300026088 Ga0207641_10000012 Ga0207641_10000012197 196
259 3300026088 Ga0207641_10002857 Ga0207641_100028578 196
260 3300026088 Ga0207641_10026081 Ga0207641_100260814 196
261 3300026088 Ga0207641_10041181 Ga0207641_100411815 196
262 3300026095 Ga0207676_10000119 Ga0207676_1000011913 196
263 3300026095 Ga0207676_10000610 Ga0207676_1000061013 196
264 3300026095 Ga0207676_10004542 Ga0207676_1000454213 196
265 3300026095 Ga0207676_10199992 Ga0207676_101999923 196
266 3300026095 Ga0207676_10630618 Ga0207676_106306182 196
267 3300026116 Ga0207674_10177691 Ga0207674_101776912 196
268 3300026118 Ga0207675_100139706 Ga0207675_1001397062 196
269 3300026118 Ga0207675_100807595 Ga0207675_1008075951 196
270 3300026121 Ga0207683_10055051 Ga0207683_100550512 196
271 3300026142 Ga0207698_10076331 Ga0207698_100763313 196
272 3300026142 Ga0207698_11138893 Ga0207698_111388932 196
273 3300027526 Ga0209968_1014060 Ga0209968_10140602 196
274 3300028379 Ga0268266_10000064 Ga0268266_1000006456 196
275 3300028379 Ga0268266_10001163 Ga0268266_100011634 196
276 3300028379 Ga0268266_10004729 Ga0268266_100047295 196
277 3300028379 Ga0268266_10184589 Ga0268266_101845894 196
278 3300028380 Ga0268265_10003868 Ga0268265_100038687 196
279 3300028380 Ga0268265_10007069 Ga0268265_100070695 196
280 3300028380 Ga0268265_10015891 Ga0268265_100158917 196
281 3300028380 Ga0268265_10041590 Ga0268265_100415905 196
282 3300028380 Ga0268265_10057320 Ga0268265_100573203 196
283 3300028380 Ga0268265_10063263 Ga0268265_100632632 196
284 3300028381 Ga0268264_10000046 Ga0268264_10000046299 196
285 3300028381 Ga0268264_10000059 Ga0268264_10000059113 196
286 3300028381 Ga0268264_10264489 Ga0268264_102644892 196
287 3300028786 Ga0307517_10012217 Ga0307517_100122175 196
288 3300028786 Ga0307517_10123315 Ga0307517_101233153 196
289 3300028786 Ga0307517_10188608 Ga0307517_101886082 196
290 3300028800 Ga0265338_10048920 Ga0265338_100489202 196
291 3300028800 Ga0265338_10094574 Ga0265338_100945742 196
292 3300029957 Ga0265324_10113972 Ga0265324_101139722 196
293 3300030521 Ga0307511_10036802 Ga0307511_100368023 196
294 3300031238 Ga0265332_10105906 Ga0265332_101059062 196
295 3300031240 Ga0265320_10038813 Ga0265320_100388132 196
296 3300031247 Ga0265340_10023067 Ga0265340_100230672 196
297 3300031251 Ga0265327_10000758 Ga0265327_1000075828 196
298 3300031251 Ga0265327_10001144 Ga0265327_1000114442 196
299 3300031456 Ga0307513_10000181 Ga0307513_1000018159 196
300 3300031456 Ga0307513_10002130 Ga0307513_100021308 196
301 3300031456 Ga0307513_10025779 Ga0307513_100257796 196
302 3300031456 Ga0307513_10027970 Ga0307513_100279704 196
303 3300031456 Ga0307513_10416694 Ga0307513_104166941 196
304 3300031730 Ga0307516_10000004 Ga0307516_1000000440 196
305 3300031852 Ga0307410_10382143 Ga0307410_103821432 196
306 3300031901 Ga0307406_10001331 Ga0307406_1000133115 196
307 3300031903 Ga0307407_10068692 Ga0307407_100686924 196
308 3300031911 Ga0307412_10003813 Ga0307412_100038135 196
309 3300031995 Ga0307409_100102691 Ga0307409_1001026914 196
310 3300032004 Ga0307414_10107772 Ga0307414_101077723 196
311 3300032004 Ga0307414_10368565 Ga0307414_103685651 196
312 3300032004 Ga0307414_10382388 Ga0307414_103823881 196
313 3300032004 Ga0307414_10907328 Ga0307414_109073281 196
314 3300032004 Ga0307414_11092628 Ga0307414_110926282 196
315 3300032005 Ga0307411_10050887 Ga0307411_100508872 196
316 3300032005 Ga0307411_10195685 Ga0307411_101956853 196
317 3300033180 Ga0307510_10056604 Ga0307510_100566044 196
318 3300035692 Ga0373935_0536879 Ga0373935_0536879_213_803 196
319 3300035724 Ga0373933_0318877 Ga0373933_0318877_191_781 196
320 3300035725 Ga0373947_0074166 Ga0373947_0074166_380_970 196
321 3300036401 Ga0373937_0455044 Ga0373937_0455044_527_1117 196
322 3300036401 Ga0373937_0568236 Ga0373937_0568236_87_677 196
323 3300037068 Ga0373925_0050501 Ga0373925_0050501_948_1538 196
324 3300037312 Ga0395899_0000013 Ga0395899_0000013_361929_362519 196
325 3300037312 Ga0395899_0000100 Ga0395899_0000100_113218_113808 196
326 3300037312 Ga0395899_0038557 Ga0395899_0038557_479_1069 196
327 3300037312 Ga0395899_0105750 Ga0395899_0105750_778_1368 196
328 3300037312 Ga0395899_0128641 Ga0395899_0128641_439_1029 196
329 3300037418 Ga0395900_0000009 Ga0395900_0000009_175740_176330 196
330 3300037418 Ga0395900_0029418 Ga0395900_0029418_4245_4835 196
331 3300037418 Ga0395900_0137456 Ga0395900_0137456_116_706 196
332 3300037418 Ga0395900_0950113 Ga0395900_0950113_167_757 196
333 3300037466 Ga0395898_0101595 Ga0395898_0101595_830_1420 196
334 3300037471 Ga0395905_0016592 Ga0395905_0016592_3788_4378 196
335 3300037471 Ga0395905_0086901 Ga0395905_0086901_2205_2795 196
336 3300037471 Ga0395905_0146779 Ga0395905_0146779_1057_1647 196
337 3300037471 Ga0395905_0469954 Ga0395905_0469954_162_752 196
338 3300037471 Ga0395905_0652825 Ga0395905_0652825_210_800 196
339 3300037471 Ga0395905_0894803 Ga0395905_0894803_179_769 196
340 3300038443 Ga0395901_0000014 Ga0395901_0000014_126939_127529 196
341 3300038443 Ga0395901_0218675 Ga0395901_0218675_1000_1590 196
342 3300039437 Ga0436365_1385343 Ga0436365_1385343_130_720 196
343 3300039437 Ga0436365_1649611 Ga0436365_1649611_2095_2685 196
344 3300039447 Ga0436361_0511852 Ga0436361_0511852_2115_2705 196
345 3300039447 Ga0436361_1042392 Ga0436361_1042392_724_1314 196
346 3300044693 Ga0466961_0128085 Ga0466961_0128085_839_1429 196
347 3300044706 Ga0466964_0242360 Ga0466964_0242360_165_755 196
348 3300044901 Ga0466960_0266682 Ga0466960_0266682_203_793 196
349 3300045049 Ga0466959_0025528 Ga0466959_0025528_2512_3102 196
350 3300045976 Ga0466967_0938499 Ga0466967_0938499_10_600 196
351 3300046462 Ga0495651_0420671 Ga0495651_0420671_262_852 196
352 3300046492 Ga0495585_0322406 Ga0495585_0322406_155_745 196
353 3300046506 Ga0495583_0017377 Ga0495583_0017377_497_1087 196
354 3300046507 Ga0495606_0168265 Ga0495606_0168265_229_819 196
355 3300046515 Ga0495620_0029351 Ga0495620_0029351_510_1100 196
356 3300046520 Ga0495637_0117462 Ga0495637_0117462_91_681 196
357 3300046522 Ga0495643_0043779 Ga0495643_0043779_1257_1847 196
358 3300046524 Ga0495648_0231905 Ga0495648_0231905_241_831 196
359 3300046528 Ga0495642_0010364 Ga0495642_0010364_320_910 196
360 3300046528 Ga0495642_0383763 Ga0495642_0383763_19_609 196
361 3300046542 Ga0495597_0012714 Ga0495597_0012714_2117_2707 196
362 3300046543 Ga0495645_0363178 Ga0495645_0363178_326_916 196
363 3300046557 Ga0495622_0009433 Ga0495622_0009433_1557_2147 196
364 3300046557 Ga0495622_0216648 Ga0495622_0216648_162_752 196
365 3300046616 Ga0495668_0037638 Ga0495668_0037638_114_704 196
366 3300046616 Ga0495668_0188099 Ga0495668_0188099_11_601 196
367 3300046660 Ga0495625_0072987 Ga0495625_0072987_463_1053 196
368 3300046660 Ga0495625_0119985 Ga0495625_0119985_17_607 196
369 3300046660 Ga0495625_0147534 Ga0495625_0147534_530_1120 196
370 3300046660 Ga0495625_0286025 Ga0495625_0286025_433_1023 196
371 3300046684 Ga0495669_0000001 Ga0495669_0000001_83212_83802 196
372 3300046684 Ga0495669_0001628 Ga0495669_0001628_5958_6548 196
373 3300046689 Ga0495613_0004569 Ga0495613_0004569_3882_4472 196
374 3300046690 Ga0495624_0104075 Ga0495624_0104075_212_802 196
375 3300046694 Ga0495649_0002816 Ga0495649_0002816_5792_6382 196
376 3300047320 Ga0495672_0041690 Ga0495672_0041690_1753_2343 196
377 3300047472 Ga0495686_0005471 Ga0495686_0005471_5591_6181 196
378 3300048903 Ga0496100_0029766 Ga0496100_0029766_179_769 196
379 3300048903 Ga0496100_0292402 Ga0496100_0292402_248_838 196
380 3300048903 Ga0496100_0460278 Ga0496100_0460278_313_903 196
381 3300048904 Ga0496101_0101156 Ga0496101_0101156_1059_1649 196
382 3300048904 Ga0496101_0369006 Ga0496101_0369006_96_686 196
383 3300048905 Ga0496102_0060433 Ga0496102_0060433_2810_3400 196
384 3300048909 Ga0496106_0476388 Ga0496106_0476388_377_967 196
385 3300048910 Ga0496107_0164889 Ga0496107_0164889_464_1054 196
386 3300048910 Ga0496107_0324726 Ga0496107_0324726_275_865 196
387 3300048911 Ga0496108_0009257 Ga0496108_0009257_2946_3536 196
388 3300048912 Ga0496109_0048685 Ga0496109_0048685_3224_3814 196
389 3300048913 Ga0496110_0186247 Ga0496110_0186247_1265_1855 196
390 3300048914 Ga0496111_0491155 Ga0496111_0491155_85_675 196
391 3300048915 Ga0496112_0186065 Ga0496112_0186065_494_1084 196
392 3300048916 Ga0496113_0198381 Ga0496113_0198381_771_1361 196
393 3300048916 Ga0496113_0567332 Ga0496113_0567332_47_637 196
394 3300048918 Ga0496115_0000607 Ga0496115_0000607_18643_19233 196
395 3300048918 Ga0496115_0007666 Ga0496115_0007666_1891_2481 196
396 3300048918 Ga0496115_0041427 Ga0496115_0041427_2784_3374 196
397 3300048918 Ga0496115_0248512 Ga0496115_0248512_24_614 196
398 3300048918 Ga0496115_0286571 Ga0496115_0286571_197_787 196
399 3300048918 Ga0496115_0472062 Ga0496115_0472062_45_635 196
400 3300048919 Ga0496116_0026561 Ga0496116_0026561_3464_4054 196
401 3300048922 Ga0496119_0023770 Ga0496119_0023770_948_1538 196
402 3300048925 Ga0496122_0002699 Ga0496122_0002699_1431_2021 196
403 3300048926 Ga0496123_0002784 Ga0496123_0002784_3200_3790 196
404 3300048928 Ga0496125_0001384 Ga0496125_0001384_23994_24584 196
405 3300049570 Ga0501033_0013351 Ga0501033_0013351_2202_2792 196
406 3300049570 Ga0501033_0237586 Ga0501033_0237586_661_1251 196
407 3300049570 Ga0501033_0784643 Ga0501033_0784643_39_629 196
408 3300049571 Ga0501034_0606713 Ga0501034_0606713_62_652 196
409 3300049572 Ga0501036_1000082 Ga0501036_1000082_64_654 196
410 3300049573 Ga0501037_0514898 Ga0501037_0514898_142_732 196
411 3300049579 Ga0501043_0259550 Ga0501043_0259550_270_860 196
412 3300049581 Ga0501047_0001192 Ga0501047_0001192_2783_3373 196
413 3300049581 Ga0501047_0127184 Ga0501047_0127184_942_1532 196
414 3300049581 Ga0501047_0172875 Ga0501047_0172875_480_1070 196
415 3300049581 Ga0501047_0356961 Ga0501047_0356961_316_906 196
416 3300049581 Ga0501047_0411365 Ga0501047_0411365_273_863 196
417 3300049582 Ga0501048_0610308 Ga0501048_0610308_104_694 196
418 3300049589 Ga0501073_0613798 Ga0501073_0613798_148_738 196
419 3300049686 Ga0501257_004147 Ga0501257_004147_224_814 196
420 3300049686 Ga0501257_019396 Ga0501257_019396_397_987 196
421 3300049822 Ga0501035_0007223 Ga0501035_0007223_137_727 196
422 3300049822 Ga0501035_0657847 Ga0501035_0657847_234_824 196
423 3300049823 Ga0501044_0001836 Ga0501044_0001836_12091_12681 196
424 3300049823 Ga0501044_0526450 Ga0501044_0526450_383_973 196
425 3300050496 nmdc:mga07m45_165072_c1 nmdc:mga07m45_165072_c1_141_731 196
426 3300050496 nmdc:mga07m45_354656_c1 nmdc:mga07m45_354656_c1_61_651 196
427 3300053080 Ga0500635_0001089 Ga0500635_0001089_3489_4079 196
428 3300053088 Ga0500644_0002992 Ga0500644_0002992_2831_3421 196
429 3300053091 Ga0500647_0003051 Ga0500647_0003051_1581_2171 196
430 3300053092 Ga0500583_0113992 Ga0500583_0113992_37_627 196
431 3300053094 Ga0500566_0023945 Ga0500566_0023945_2830_3420 196
432 3300053103 Ga0500555_001231 Ga0500555_001231_7158_7748 196
433 3300053108 Ga0500562_000348 Ga0500562_000348_1080_1670 196
434 3300053109 Ga0500569_001684 Ga0500569_001684_1092_1682 196
435 3300053111 Ga0500572_001672 Ga0500572_001672_4422_5012 196
436 3300053119 Ga0500595_003363 Ga0500595_003363_3881_4471 196
437 3300053121 Ga0500607_038193 Ga0500607_038193_1524_2114 196
438 3300053121 Ga0500607_098274 Ga0500607_098274_200_790 196
439 3300053122 Ga0500608_003023 Ga0500608_003023_2207_2797 196
440 3300053122 Ga0500608_005856 Ga0500608_005856_508_1098 196
441 3300053130 Ga0500642_0015144 Ga0500642_0015144_1894_2484 196
442 3300053130 Ga0500642_0044259 Ga0500642_0044259_1066_1656 196
443 3300053136 Ga0500559_0000035 Ga0500559_0000035_103719_104309 196
444 3300053136 Ga0500559_0009070 Ga0500559_0009070_277_867 196
445 3300053136 Ga0500559_0086185 Ga0500559_0086185_761_1351 196
446 3300053136 Ga0500559_0199401 Ga0500559_0199401_201_791 196
447 3300053136 Ga0500559_0314884 Ga0500559_0314884_20_610 196
448 3300053142 Ga0500577_0093932 Ga0500577_0093932_552_1142 196
449 3300053148 Ga0500590_010345 Ga0500590_010345_3466_4056 196
450 3300053148 Ga0500590_078279 Ga0500590_078279_95_685 196
451 3300053157 Ga0500624_006317 Ga0500624_006317_419_1009 196
452 3300053162 Ga0500638_009580 Ga0500638_009580_2109_2699 196
453 3300053163 Ga0500639_144775 Ga0500639_144775_295_885 196
454 3300053163 Ga0500639_238806 Ga0500639_238806_16_606 196
455 3300053177 Ga0500636_0014403 Ga0500636_0014403_3082_3672 196
456 3300053178 Ga0500637_0032237 Ga0500637_0032237_427_1017 196
457 3300053729 Ga0500625_088297 Ga0500625_088297_159_749 196
458 3300053730 Ga0500645_002678 Ga0500645_002678_2745_3335 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

98

190

0.93

PF00677

Lum_binding

Lumazine binding domain

3

85

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9249 1 194
3a3g-assembly2.cif.gz_B crystal structure of lump complexed with 6,7-dimethyl-8-(1'-d-ribityl) lumazine 0.9216 1 182
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.9195 1 182
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9163 1 194
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9157 1 196
ID Description Score Start End Superfamily
3a3bA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9344 94 181 2.40.30.20
3a35A01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9324 99 182 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9301 1 88 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9288 101 191 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9198 1 88 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7X7FJ84-F1-model_v4 deleted 0.9777 5 169
AF-A0A7X7FJ84-F1-model_v4 deleted 0.9662 5 169
AF-A0A382GLW1-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9622 1 185 GO:0004746
GO:0009231
AF-A0A2G4H3R9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.962 2 181 GO:0004746
GO:0009231
AF-A0A3M1LSZ9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9585 1 182 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
89.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map