F448041

General Info

Members Datasets Scaffolds Average Seq Length
457 256 424 299

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0328076|Ga0466963_0328076_17_985
Length 322
Sequence MRTPTVVRAAPAPLAPMPDRVTIYEVGPRDGLQNEKALLEVDQKLEFIQRLEAAGARRIETVSFVNPKRVPQMAGAEEISAALPHEAGRSRIGLVLNARGWDRCLEAKCDEANVVVCATDGFGIRNQGASAAEQTQAMQAILARRKAEGGPPITVTISVAFGCPFDGEVSEDQVIRIVRAAAEAGADEIALADTIGVADPWLVRKRVEATKTAAPGIPLRMHFHDTRNTGLANAFASVEAGVDVLDASCGGLGGCPFAPDATGNIGTEDLVYMLERAGYSTGYDLDGLIGTAKWMAGILGKPPAASVSRAGGFPVPKAQAAA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
19 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
20 2818991435 Caulobacter henricii 536 Isolate Unclassified
21 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
22 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
23 2849560528 Caulobacter zeae 410 Isolate Unclassified
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2851153111 Caulobacter radicis 736 Isolate Unclassified
26 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
27 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
28 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
29 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
30 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
31 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
32 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
245 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.44
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.26
Nodule 0.22
Rhizoplane 3.5
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10024978 3300003215 Bacteria 2144
2 JGI25153J46596_10045067 3300003215 Bacteria 1319
3 rootH1_10081374 3300003316 Bacteria 1996
4 Ga0006562J51391_1084114 3300003578 Bacteria 3520
5 Ga0006562J51391_1084116 3300003578 Bacteria 2090
6 Ga0055524_1006227 3300003775 Bacteria 5206
7 Ga0055536_1001011 3300003781 Bacteria 17865
8 Ga0055536_1001362 3300003781 Bacteria 14857
9 Ga0055536_1002645 3300003781 Bacteria 9958
10 Ga0055536_1002964 3300003781 Bacteria 9309
11 Ga0055536_1015837 3300003781 Bacteria 2556
12 Ga0055528_1003679 3300003790 Bacteria 7606
13 Ga0055530_10001080 3300003791 Bacteria 21471
14 Ga0055530_10003058 3300003791 Bacteria 9958
15 Ga0055531_10002770 3300003794 Bacteria 11506
16 Ga0065165_1000264 3300005262 Bacteria 90435
17 Ga0065165_1001205 3300005262 Bacteria 29843
18 Ga0070670_100000013 3300005331 Bacteria 250768
19 Ga0070670_100009610 3300005331 Bacteria 8254
20 Ga0070680_100023814 3300005336 Bacteria 4887
21 Ga0070680_100228410 3300005336 Bacteria 1571
22 Ga0070660_100246796 3300005339 Bacteria 1455
23 Ga0070661_100360119 3300005344 Bacteria 1143
24 Ga0070668_100000042 3300005347 Bacteria 78694
25 Ga0070668_100000707 3300005347 Bacteria 22821
26 Ga0070668_100005345 3300005347 Bacteria 9534
27 Ga0070668_100007523 3300005347 Bacteria 8089
28 Ga0070668_100009879 3300005347 Bacteria 7068
29 Ga0070671_100084419 3300005355 Bacteria 2656
30 Ga0070659_100000428 3300005366 Bacteria 31806
31 Ga0070659_100001301 3300005366 Bacteria 18120
32 Ga0070659_100067459 3300005366 Bacteria 2837
33 Ga0070667_100000168 3300005367 Bacteria 81935
34 Ga0070667_100001255 3300005367 Bacteria 23018
35 Ga0070667_100003824 3300005367 Bacteria 12796
36 Ga0070663_100038077 3300005455 Bacteria 3352
37 Ga0070678_100195914 3300005456 Bacteria 1664
38 Ga0070662_100057789 3300005457 Bacteria 2820
39 Ga0070681_10011298 3300005458 Bacteria 8834
40 Ga0070681_10117505 3300005458 Bacteria 2596
41 Ga0070681_10192454 3300005458 Bacteria 1959
42 Ga0070679_100000858 3300005530 Bacteria 26439
43 Ga0070679_100013292 3300005530 Bacteria 7881
44 Ga0068853_100033140 3300005539 Bacteria 4381
45 Ga0068853_100048684 3300005539 Bacteria 3642
46 Ga0068853_100121869 3300005539 Bacteria 2327
47 Ga0068853_100194710 3300005539 Bacteria 1843
48 Ga0070693_100192798 3300005547 Bacteria 1319
49 Ga0070665_100000363 3300005548 Bacteria 67699
50 Ga0070665_100000593 3300005548 Bacteria 50386
51 Ga0070665_100035716 3300005548 Bacteria 4999
52 Ga0070665_100709724 3300005548 Bacteria 1019
53 Ga0068855_100009421 3300005563 Bacteria 11794
54 Ga0068855_100029587 3300005563 Bacteria 6547
55 Ga0068855_100038442 3300005563 Bacteria 5686
56 Ga0068855_100152342 3300005563 Bacteria 2629
57 Ga0068857_100288394 3300005577 Bacteria 1511
58 Ga0068856_100373172 3300005614 Bacteria 1445
59 Ga0068856_100443989 3300005614 Bacteria 1318
60 Ga0068864_100000135 3300005618 Bacteria 71759
61 Ga0068864_100004585 3300005618 Bacteria 11336
62 Ga0068861_100417565 3300005719 Bacteria 1195
63 Ga0068863_100000735 3300005841 Bacteria 32827
64 Ga0068863_100003449 3300005841 Bacteria 15593
65 Ga0068863_100302201 3300005841 Bacteria 1552
66 Ga0068863_100539567 3300005841 Bacteria 1151
67 Ga0068858_100000020 3300005842 Bacteria 175896
68 Ga0068858_100006409 3300005842 Bacteria 11462
69 Ga0068858_100155985 3300005842 Bacteria 2148
70 Ga0068860_100000133 3300005843 Bacteria 120382
71 Ga0068860_100000382 3300005843 Bacteria 58081
72 Ga0068860_100022661 3300005843 Bacteria 6071
73 Ga0068862_100000463 3300005844 Bacteria 43942
74 Ga0068862_100017278 3300005844 Bacteria 6005
75 Ga0068862_100017936 3300005844 Bacteria 5895
76 Ga0075366_10017266 3300006195 Bacteria 4152
77 Ga0075370_10059242 3300006353 Bacteria 2179
78 Ga0068865_100001019 3300006881 Bacteria 16107
79 Ga0079104_1012955 3300006946 Bacteria 2593
80 Ga0105250_10008707 3300009092 Bacteria 4298
81 Ga0105240_10014687 3300009093 Bacteria 10685
82 Ga0105240_10015807 3300009093 Bacteria 10241
83 Ga0105240_10071922 3300009093 Bacteria 4276
84 Ga0105240_10393733 3300009093 Bacteria 1562
85 Ga0105247_10108210 3300009101 Bacteria 1786
86 Ga0105248_10000305 3300009177 Bacteria 58472
87 Ga0105248_10007895 3300009177 Bacteria 11694
88 Ga0105248_10044159 3300009177 Bacteria 4998
89 Ga0105248_10115539 3300009177 Bacteria 3027
90 Ga0105248_10249898 3300009177 Bacteria 1996
91 Ga0105248_10376092 3300009177 Bacteria 1599
92 Ga0105238_10010208 3300009551 Bacteria 9415
93 Ga0105238_10062344 3300009551 Bacteria 3729
94 Ga0105238_10071800 3300009551 Bacteria 3459
95 Ga0105238_10107471 3300009551 Bacteria 2771
96 Ga0105238_10390454 3300009551 Bacteria 1384
97 Ga0105249_10000610 3300009553 Bacteria 32602
98 Ga0105249_10158178 3300009553 Bacteria 2187
99 Ga0157373_10010029 3300013100 Bacteria 6981
100 Ga0157373_10011866 3300013100 Bacteria 6402
101 Ga0157371_10268736 3300013102 Bacteria 1230
102 Ga0157370_10013802 3300013104 Bacteria 8298
103 Ga0157370_10305478 3300013104 Bacteria 1468
104 Ga0157369_10002971 3300013105 Bacteria 20293
105 Ga0163163_10019624 3300014325 Bacteria 6349
106 Ga0163163_10034972 3300014325 Bacteria 4871
107 Ga0163163_10076982 3300014325 Bacteria 3332
108 Ga0163163_10119452 3300014325 Bacteria 2669
109 Ga0163163_10254132 3300014325 Bacteria 1808
110 Ga0157379_10032873 3300014968 Bacteria 4625
111 Ga0157379_10113097 3300014968 Bacteria 2440
112 Ga0163161_10248513 3300017792 Bacteria 1386
113 Ga0213872_10048638 3300021361 Bacteria 1927
114 Ga0213874_10060618 3300021377 Bacteria 1184
115 Ga0213876_10000081 3300021384 Bacteria 108997
116 Ga0209026_1010478 3300025250 Bacteria 1727
117 Ga0209565_1000395 3300025263 Bacteria 36792
118 Ga0209673_1010662 3300025273 Bacteria 3853
119 Ga0209676_1000213 3300025292 Bacteria 128039
120 Ga0209676_1000467 3300025292 Bacteria 67659
121 Ga0209676_1000560 3300025292 Bacteria 56233
122 Ga0209676_1005154 3300025292 Bacteria 6949
123 Ga0209564_1001381 3300025295 Bacteria 25325
124 Ga0209564_1017524 3300025295 Bacteria 2786
125 Ga0209564_1024212 3300025295 Bacteria 2080
126 Ga0209758_1001633 3300025297 Bacteria 25481
127 Ga0209758_1002447 3300025297 Bacteria 18951
128 Ga0209758_1005737 3300025297 Bacteria 9350
129 Ga0209050_1000461 3300025298 Bacteria 72912
130 Ga0209050_1001753 3300025298 Bacteria 21523
131 Ga0209050_1002433 3300025298 Bacteria 15998
132 Ga0209050_1003548 3300025298 Bacteria 11365
133 Ga0209256_1003362 3300025299 Bacteria 11323
134 Ga0209256_1005306 3300025299 Bacteria 7502
135 Ga0209257_1000125 3300025304 Bacteria 218126
136 Ga0209257_1000246 3300025304 Bacteria 125942
137 Ga0209257_1000427 3300025304 Bacteria 81007
138 Ga0209257_1000757 3300025304 Bacteria 48772
139 Ga0209257_1002416 3300025304 Bacteria 18671
140 Ga0209257_1012142 3300025304 Bacteria 4030
141 Ga0207696_1030365 3300025711 Bacteria 1643
142 Ga0207680_10027022 3300025903 Bacteria 3189
143 Ga0207705_10000556 3300025909 Bacteria 31398
144 Ga0207707_10021552 3300025912 Bacteria 5633
145 Ga0207707_10056462 3300025912 Bacteria 3416
146 Ga0207695_10001235 3300025913 Bacteria 43771
147 Ga0207695_10002484 3300025913 Bacteria 27149
148 Ga0207695_10012530 3300025913 Bacteria 10169
149 Ga0207695_10050413 3300025913 Bacteria 4380
150 Ga0207695_10364594 3300025913 Bacteria 1331
151 Ga0207660_10000773 3300025917 Bacteria 21298
152 Ga0207657_10000693 3300025919 Bacteria 35842
153 Ga0207657_10031284 3300025919 Bacteria 4824
154 Ga0207657_10057625 3300025919 Bacteria 3347
155 Ga0207657_10216388 3300025919 Bacteria 1536
156 Ga0207652_10019459 3300025921 Bacteria 5584
157 Ga0207681_10297952 3300025923 Bacteria 1275
158 Ga0207694_10005922 3300025924 Bacteria 9376
159 Ga0207694_10133088 3300025924 Bacteria 1994
160 Ga0207650_10000016 3300025925 Bacteria 361958
161 Ga0207644_10514682 3300025931 Bacteria 988
162 Ga0207690_10000373 3300025932 Bacteria 29751
163 Ga0207690_10006047 3300025932 Bacteria 7169
164 Ga0207706_10062893 3300025933 Bacteria 3268
165 Ga0207704_10002498 3300025938 Bacteria 8290
166 Ga0207711_10000160 3300025941 Bacteria 72317
167 Ga0207711_10019133 3300025941 Bacteria 5699
168 Ga0207711_10025271 3300025941 Bacteria 4983
169 Ga0207711_10069290 3300025941 Bacteria 3057
170 Ga0207679_10116834 3300025945 Bacteria 2116
171 Ga0207667_10006652 3300025949 Bacteria 13971
172 Ga0207667_10045108 3300025949 Bacteria 4669
173 Ga0207667_10091845 3300025949 Bacteria 3136
174 Ga0207667_10122271 3300025949 Bacteria 2682
175 Ga0207667_10238422 3300025949 Bacteria 1862
176 Ga0207667_10643135 3300025949 Bacteria 1067
177 Ga0207712_10000641 3300025961 Bacteria 27375
178 Ga0207712_10231955 3300025961 Bacteria 1482
179 Ga0207668_10000002 3300025972 Bacteria 209163
180 Ga0207668_10000401 3300025972 Bacteria 27305
181 Ga0207668_10001930 3300025972 Bacteria 12135
182 Ga0207668_10022346 3300025972 Bacteria 4048
183 Ga0207668_10246916 3300025972 Bacteria 1447
184 Ga0207658_10000399 3300025986 Bacteria 41904
185 Ga0207658_10003349 3300025986 Bacteria 11367
186 Ga0207658_10009133 3300025986 Bacteria 6724
187 Ga0207703_10000082 3300026035 Bacteria 110579
188 Ga0207703_10018799 3300026035 Bacteria 5395
189 Ga0207703_10104196 3300026035 Bacteria 2410
190 Ga0207639_10031860 3300026041 Bacteria 3877
191 Ga0207639_10055804 3300026041 Bacteria 3025
192 Ga0207639_10146673 3300026041 Bacteria 1972
193 Ga0207639_10551417 3300026041 Bacteria 1058
194 Ga0207702_10069163 3300026078 Bacteria 3035
195 Ga0207702_10105626 3300026078 Bacteria 2494
196 Ga0207641_10000007 3300026088 Bacteria 441443
197 Ga0207641_10001614 3300026088 Bacteria 21995
198 Ga0207641_10034834 3300026088 Bacteria 4190
199 Ga0207641_10499341 3300026088 Bacteria 1181
200 Ga0207676_10000191 3300026095 Bacteria 53466
201 Ga0207676_10000618 3300026095 Bacteria 29046
202 Ga0207676_10004212 3300026095 Bacteria 10160
203 Ga0207676_10114800 3300026095 Bacteria 2260
204 Ga0207675_100156846 3300026118 Bacteria 2169
205 Ga0207675_100453083 3300026118 Bacteria 1272
206 Ga0209981_1000327 3300027378 Bacteria 6139
207 Ga0268266_10000003 3300028379 Bacteria 1701703
208 Ga0268266_10026031 3300028379 Bacteria 4976
209 Ga0268266_10163474 3300028379 Bacteria 2015
210 Ga0268265_10000836 3300028380 Bacteria 28993
211 Ga0268265_10007741 3300028380 Bacteria 7251
212 Ga0268265_10043600 3300028380 Bacteria 3336
213 Ga0268265_10049357 3300028380 Bacteria 3165
214 Ga0268265_10065960 3300028380 Bacteria 2796
215 Ga0268264_10000008 3300028381 Bacteria 773387
216 Ga0268264_10000207 3300028381 Bacteria 120086
217 Ga0268264_10010210 3300028381 Bacteria 7772
218 Ga0307517_10019757 3300028786 Bacteria 8620
219 Ga0307517_10053033 3300028786 Bacteria 4048
220 Ga0307515_10016020 3300028794 Bacteria 13759
221 Ga0265338_10009658 3300028800 Bacteria 11448
222 Ga0265338_10066774 3300028800 Bacteria 3110
223 Ga0265338_10247495 3300028800 Bacteria 1317
224 Ga0265331_10106196 3300031250 Bacteria 1289
225 Ga0265327_10000130 3300031251 Bacteria 165066
226 Ga0265327_10003358 3300031251 Bacteria 15423
227 Ga0307513_10000077 3300031456 Bacteria 134167
228 Ga0307513_10002125 3300031456 Bacteria 27813
229 Ga0307513_10007717 3300031456 Bacteria 13899
230 Ga0307513_10009525 3300031456 Bacteria 12284
231 Ga0265314_10015084 3300031711 Bacteria 6146
232 Ga0265314_10118803 3300031711 Bacteria 1668
233 Ga0307516_10000001 3300031730 Bacteria 510338
234 Ga0307412_10004253 3300031911 Bacteria 7982
235 Ga0307409_100299140 3300031995 Bacteria 1496
236 Ga0307414_10036037 3300032004 Bacteria 3298
237 Ga0307414_10040479 3300032004 Bacteria 3148
238 Ga0307414_10067123 3300032004 Bacteria 2568
239 Ga0307414_10341769 3300032004 Bacteria 1281
240 Ga0307411_10044622 3300032005 Bacteria 2846
241 Ga0307411_10433781 3300032005 Bacteria 1095
242 Ga0373936_0015842 3300035113 Bacteria 2892
243 Ga0373943_0142122 3300035170 Bacteria 1294
244 Ga0373946_0024823 3300035171 Bacteria 2353
245 Ga0373931_0153354 3300035691 Bacteria 1345
246 Ga0373927_0003482 3300035695 Bacteria 11271
247 Ga0373925_0000257 3300037068 Bacteria 55764
248 Ga0395900_0012117 3300037418 Bacteria 8810
249 Ga0395900_0371997 3300037418 Bacteria 1398
250 Ga0395898_0008282 3300037466 Bacteria 10996
251 Ga0395898_0265474 3300037466 Bacteria 1637
252 Ga0395905_0005670 3300037471 Bacteria 12700
253 Ga0395905_0020042 3300037471 Bacteria 6337
254 Ga0395905_0102098 3300037471 Bacteria 2692
255 Ga0395905_0262364 3300037471 Bacteria 1613
256 Ga0395901_0001358 3300038443 Bacteria 25609
257 Ga0436365_0330659 3300039437 Bacteria 9341
258 Ga0436365_0966433 3300039437 Bacteria 3104
259 Ga0436365_1275470 3300039437 Bacteria 1107
260 Ga0436365_1469960 3300039437 Bacteria 1229
261 Ga0436360_0483895 3300039438 Bacteria 1150
262 Ga0436361_0323660 3300039447 Bacteria 9818
263 Ga0436363_0052288 3300039450 Bacteria 2134
264 Ga0439441_007053 3300042001 Bacteria 1799
265 Ga0450901_005497 3300042533 Bacteria 1301
266 Ga0466963_0328076 3300044694 Bacteria 1077
267 Ga0466960_0322670 3300044901 Bacteria 875
268 Ga0495627_000923 3300046453 Bacteria 20317
269 Ga0495638_0000951 3300046460 Bacteria 29376
270 Ga0495638_0001655 3300046460 Bacteria 19739
271 Ga0495638_0002462 3300046460 Bacteria 15090
272 Ga0495638_0012523 3300046460 Bacteria 5807
273 Ga0495650_0000024 3300046471 Bacteria 496674
274 Ga0495650_0014492 3300046471 Bacteria 4098
275 Ga0495650_0032075 3300046471 Bacteria 2354
276 Ga0495583_0000003 3300046506 Bacteria 709273
277 Ga0495606_0009985 3300046507 Bacteria 7938
278 Ga0495610_0000802 3300046512 Bacteria 29479
279 Ga0495610_0002149 3300046512 Bacteria 16762
280 Ga0495610_0009764 3300046512 Bacteria 6030
281 Ga0495628_0177985 3300046516 Bacteria 1610
282 Ga0495631_0004042 3300046518 Bacteria 7894
283 Ga0495632_0006611 3300046519 Bacteria 7417
284 Ga0495632_0146181 3300046519 Bacteria 1094
285 Ga0495637_0004049 3300046520 Bacteria 7655
286 Ga0495648_0000066 3300046524 Bacteria 140767
287 Ga0495648_0013634 3300046524 Bacteria 5997
288 Ga0495648_0178903 3300046524 Bacteria 1080
289 Ga0495642_0001584 3300046528 Bacteria 9972
290 Ga0495654_0000118 3300046530 Bacteria 88890
291 Ga0495645_0062316 3300046543 Bacteria 2701
292 Ga0495622_0018656 3300046557 Bacteria 3231
293 Ga0495633_0001599 3300046558 Bacteria 17165
294 Ga0495668_0000342 3300046616 Bacteria 61973
295 Ga0495668_0029861 3300046616 Bacteria 3080
296 Ga0495668_0036744 3300046616 Bacteria 2743
297 Ga0495668_0050483 3300046616 Bacteria 2305
298 Ga0495668_0072147 3300046616 Bacteria 1897
299 Ga0495611_0009790 3300046648 Bacteria 4052
300 Ga0495625_0000854 3300046660 Bacteria 41503
301 Ga0495625_0012473 3300046660 Bacteria 6885
302 Ga0495625_0014395 3300046660 Bacteria 6316
303 Ga0495625_0036019 3300046660 Bacteria 3641
304 Ga0495625_0048184 3300046660 Bacteria 3069
305 Ga0495625_0053122 3300046660 Bacteria 2899
306 Ga0495625_0062964 3300046660 Bacteria 2620
307 Ga0495625_0159468 3300046660 Bacteria 1512
308 Ga0495625_0220979 3300046660 Bacteria 1241
309 Ga0495659_0045568 3300046664 Bacteria 1581
310 Ga0495599_0246452 3300046678 Bacteria 1088
311 Ga0495669_0000002 3300046684 Bacteria 282777
312 Ga0495669_0000353 3300046684 Bacteria 23496
313 Ga0495669_0007404 3300046684 Bacteria 4604
314 Ga0495670_0078163 3300046691 Bacteria 1683
315 Ga0495649_0000089 3300046694 Bacteria 79134
316 Ga0495589_0020569 3300046794 Bacteria 3375
317 Ga0495660_0037000 3300046810 Bacteria 2720
318 Ga0495660_0107819 3300046810 Bacteria 1425
319 Ga0495636_0017989 3300047318 Bacteria 2834
320 Ga0495672_0033438 3300047320 Bacteria 3185
321 Ga0495672_0037253 3300047320 Bacteria 2978
322 Ga0495683_0038727 3300047323 Bacteria 2413
323 Ga0495677_0018180 3300047445 Bacteria 2548
324 Ga0495679_003383 3300047446 Bacteria 7688
325 Ga0495673_0000102 3300047469 Bacteria 173343
326 Ga0495673_0000710 3300047469 Bacteria 32297
327 Ga0495673_0005918 3300047469 Bacteria 7295
328 Ga0495686_0000839 3300047472 Bacteria 39457
329 Ga0495686_0003093 3300047472 Bacteria 14707
330 Ga0495686_0004374 3300047472 Bacteria 11655
331 Ga0495686_0018643 3300047472 Bacteria 4651
332 Ga0495686_0063744 3300047472 Bacteria 2283
333 Ga0495686_0102904 3300047472 Bacteria 1721
334 Ga0495593_0021131 3300047673 Bacteria 3639
335 Ga0496100_0456774 3300048903 Bacteria 980
336 Ga0496102_0020538 3300048905 Bacteria 5836
337 Ga0496102_0157360 3300048905 Bacteria 2136
338 Ga0496103_0031900 3300048906 Bacteria 3214
339 Ga0496106_0028640 3300048909 Bacteria 4149
340 Ga0496107_0000131 3300048910 Bacteria 36633
341 Ga0496108_0017861 3300048911 Bacteria 5802
342 Ga0496109_0024302 3300048912 Bacteria 5386
343 Ga0496110_0125028 3300048913 Bacteria 2320
344 Ga0496112_0052358 3300048915 Bacteria 4006
345 Ga0496112_0114898 3300048915 Bacteria 2662
346 Ga0496114_0257740 3300048917 Bacteria 1535
347 Ga0496115_0002138 3300048918 Bacteria 14127
348 Ga0496115_0002497 3300048918 Bacteria 13220
349 Ga0496115_0011156 3300048918 Bacteria 6732
350 Ga0496115_0268057 3300048918 Bacteria 1403
351 Ga0496116_0021619 3300048919 Bacteria 4844
352 Ga0496117_0018025 3300048920 Bacteria 5874
353 Ga0496118_0015375 3300048921 Bacteria 7087
354 Ga0496119_0023907 3300048922 Bacteria 4317
355 Ga0496121_0000035 3300048924 Bacteria 374316
356 Ga0496121_0006185 3300048924 Bacteria 15012
357 Ga0496121_0184270 3300048924 Bacteria 1503
358 Ga0496122_0004488 3300048925 Bacteria 17259
359 Ga0496123_0003275 3300048926 Bacteria 18348
360 Ga0496124_0012278 3300048927 Bacteria 8464
361 Ga0496125_0002516 3300048928 Bacteria 23670
362 Ga0496125_0043316 3300048928 Bacteria 3823
363 Ga0496126_0001304 3300048929 Bacteria 39731
364 Ga0495678_000558 3300049459 Bacteria 35734
365 Ga0501033_0014073 3300049570 Bacteria 6084
366 Ga0501043_0373914 3300049579 Bacteria 1080
367 Ga0501047_0119071 3300049581 Bacteria 2523
368 Ga0501047_0121608 3300049581 Bacteria 2492
369 Ga0501047_0204388 3300049581 Bacteria 1835
370 Ga0501048_0218427 3300049582 Bacteria 1352
371 Ga0501072_0001474 3300049588 Bacteria 17632
372 Ga0501073_0146081 3300049589 Bacteria 1639
373 Ga0501080_0039302 3300049742 Bacteria 4416
374 Ga0501083_0002355 3300049744 Bacteria 12943
375 nmdc:mga0k408_7317_c1 3300050493 Bacteria 5897
376 nmdc:mga07m45_189688_c1 3300050496 Bacteria 1195
377 nmdc:mga07m45_69490_c1 3300050496 Bacteria 2002
378 nmdc:mga0sz30_6418_c1 3300050516 Bacteria 4364
379 Ga0500635_0000133 3300053080 Bacteria 42884
380 Ga0500578_0000737 3300053086 Bacteria 38789
381 Ga0500578_0130655 3300053086 Bacteria 1575
382 Ga0500643_005318 3300053087 Bacteria 5570
383 Ga0500644_0000084 3300053088 Bacteria 57829
384 Ga0500644_0001419 3300053088 Bacteria 6366
385 Ga0500646_0042612 3300053090 Bacteria 1283
386 Ga0500651_0003759 3300053093 Bacteria 8368
387 Ga0500651_0174963 3300053093 Bacteria 1277
388 Ga0500555_001064 3300053103 Bacteria 9234
389 Ga0500556_0002638 3300053104 Bacteria 5606
390 Ga0500562_001940 3300053108 Bacteria 5184
391 Ga0500562_002822 3300053108 Bacteria 4330
392 Ga0500569_013570 3300053109 Bacteria 1997
393 Ga0500594_0000221 3300053118 Bacteria 13834
394 Ga0500595_006607 3300053119 Bacteria 4897
395 Ga0500608_000187 3300053122 Bacteria 24884
396 Ga0500608_001063 3300053122 Bacteria 9839
397 Ga0500618_002255 3300053125 Bacteria 7500
398 Ga0500642_0024324 3300053130 Bacteria 2446
399 Ga0500642_0053055 3300053130 Bacteria 1797
400 Ga0500655_024543 3300053133 Bacteria 1142
401 Ga0500658_0014910 3300053134 Bacteria 2880
402 Ga0500559_0000212 3300053136 Bacteria 46705
403 Ga0500559_0003398 3300053136 Bacteria 7842
404 Ga0500559_0008444 3300053136 Bacteria 4512
405 Ga0500559_0018941 3300053136 Bacteria 2908
406 Ga0500559_0058687 3300053136 Bacteria 1712
407 Ga0500564_000080 3300053138 Bacteria 24788
408 Ga0500573_0029580 3300053140 Bacteria 3157
409 Ga0500577_0001991 3300053142 Bacteria 5236
410 Ga0500590_004838 3300053148 Bacteria 6422
411 Ga0500616_0066166 3300053153 Bacteria 1856
412 Ga0500619_000501 3300053154 Bacteria 6809
413 Ga0500622_0002814 3300053156 Bacteria 12208
414 Ga0500622_0082362 3300053156 Bacteria 1609
415 Ga0500622_0135390 3300053156 Bacteria 1180
416 Ga0500624_002114 3300053157 Bacteria 2764
417 Ga0500638_061866 3300053162 Bacteria 1798
418 Ga0500636_0003639 3300053177 Bacteria 8694
419 Ga0500637_0029408 3300053178 Bacteria 3047
420 Ga0500625_057543 3300053729 Bacteria 1776
421 Ga0500645_040824 3300053730 Bacteria 1371
422 Ga0500596_001059 3300053735 Bacteria 5540
423 Ga0501082_0002053 3300060353 Bacteria 17707
424 Ga0501082_0006037 3300060353 Bacteria 10509

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042533 Ga0450901_005497 Ga0450901_005497_14_775 243
2 3300044901 Ga0466960_0322670 Ga0466960_0322670_23_814 256
3 3300048912 Ga0496109_0024302 Ga0496109_0024302_4572_5351 257
4 3300049589 Ga0501073_0146081 Ga0501073_0146081_56_961 264
5 3300060353 Ga0501082_0006037 Ga0501082_0006037_8907_9812 265
6 3300039438 Ga0436360_0483895 Ga0436360_0483895_337_1137 266
7 3300048913 Ga0496110_0125028 Ga0496110_0125028_551_1435 270
8 3300046524 Ga0495648_0178903 Ga0495648_0178903_18_917 271
9 3300046616 Ga0495668_0050483 Ga0495668_0050483_394_1293 271
10 3300046660 Ga0495625_0036019 Ga0495625_0036019_1464_2363 271
11 3300046660 Ga0495625_0220979 Ga0495625_0220979_239_1138 271
12 3300050496 nmdc:mga07m45_189688_c1 nmdc:mga07m45_189688_c1_22_921 271
13 3300053156 Ga0500622_0082362 Ga0500622_0082362_376_1275 271
14 3300025949 Ga0207667_10643135 Ga0207667_106431352 272
15 3300048917 Ga0496114_0257740 Ga0496114_0257740_302_1231 272
16 3300049582 Ga0501048_0218427 Ga0501048_0218427_359_1273 272
17 3300003781 Ga0055536_1015837 Ga0055536_10158373 273
18 3300006195 Ga0075366_10017266 Ga0075366_100172662 273
19 3300025292 Ga0209676_1005154 Ga0209676_10051544 273
20 3300025295 Ga0209564_1024212 Ga0209564_10242123 273
21 3300046660 Ga0495625_0053122 Ga0495625_0053122_1663_2562 273
22 3300050493 nmdc:mga0k408_7317_c1 nmdc:mga0k408_7317_c1_3022_3936 273
23 3300005548 Ga0070665_100709724 Ga0070665_1007097241 275
24 3300005547 Ga0070693_100192798 Ga0070693_1001927982 276
25 3300039437 Ga0436365_0966433 Ga0436365_0966433_1930_2832 277
26 3300053088 Ga0500644_0001419 Ga0500644_0001419_2360_3280 277
27 3300053093 Ga0500651_0174963 Ga0500651_0174963_159_1079 277
28 3300003781 Ga0055536_1001011 Ga0055536_100101118 280
29 3300003781 Ga0055536_1001362 Ga0055536_100136212 280
30 3300025292 Ga0209676_1000213 Ga0209676_1000213118 280
31 3300025298 Ga0209050_1003548 Ga0209050_100354810 280
32 3300025304 Ga0209257_1000757 Ga0209257_100075712 280
33 3300053156 Ga0500622_0135390 Ga0500622_0135390_207_1109 280
34 3300025250 Ga0209026_1010478 Ga0209026_10104782 281
35 3300046460 Ga0495638_0000951 Ga0495638_0000951_13866_14768 281
36 3300048903 Ga0496100_0456774 Ga0496100_0456774_43_942 283
37 3300053119 Ga0500595_006607 Ga0500595_006607_1225_2136 284
38 3300032004 Ga0307414_10040479 Ga0307414_100404792 287
39 3300053140 Ga0500573_0029580 Ga0500573_0029580_2048_2965 293
40 3300032005 Ga0307411_10433781 Ga0307411_104337812 294
41 3300049588 Ga0501072_0001474 Ga0501072_0001474_6064_6981 294
42 3300049742 Ga0501080_0039302 Ga0501080_0039302_2215_3132 294
43 3300049744 Ga0501083_0002355 Ga0501083_0002355_4571_5488 294
44 3300053130 Ga0500642_0024324 Ga0500642_0024324_1379_2272 294
45 3300060353 Ga0501082_0002053 Ga0501082_0002053_5913_6830 294
46 iso_pu_bacteria 2643221614 2644087047 294
47 iso_pu_bacteria 2643221661 2644342001 294
48 iso_pu_bacteria 2643221666 2644368288 294
49 iso_pu_bacteria 2510917020 2511121125 295
50 iso_pu_bacteria 2582581279 2585148034 295
51 iso_pu_bacteria 2582581280 2585153931 295
52 iso_pu_bacteria 2582581293 2585194924 295
53 iso_pu_bacteria 2585428106 2587915351 295
54 iso_pu_bacteria 2643221545 2643747279 295
55 iso_pu_bacteria 2643221574 2643882524 295
56 iso_pu_bacteria 2643221583 2643924529 295
57 iso_pu_bacteria 2643221584 2643929935 295
58 iso_pu_bacteria 2643221598 2643998926 295
59 iso_pu_bacteria 2643221640 2644223906 295
60 iso_pu_bacteria 2643221642 2644232892 295
61 iso_pu_bacteria 2643221663 2644353476 295
62 iso_pu_bacteria 2643221691 2644507523 295
63 iso_pu_bacteria 2643221699 2644549523 295
64 iso_pu_bacteria 2643221699 2644550574 295
65 iso_pu_bacteria 2791355048 2792458856 295
66 iso_pu_bacteria 2818991435 2819540451 295
67 iso_pu_bacteria 2818991454 2819649433 295
68 iso_pu_bacteria 2843744320 2843745791 295
69 iso_pu_bacteria 2849560528 2849562296 295
70 iso_pu_bacteria 2849573788 2849577217 295
71 iso_pu_bacteria 2851153111 2851153203 295
72 iso_pu_bacteria 2857504554 2857508048 295
73 iso_pu_bacteria 2884960567 2884963139 295
74 iso_pu_bacteria 2898329390 2898330400 295
75 iso_pu_bacteria 2928531327 2928534797 295
76 iso_pu_bacteria 2928972540 2928973460 295
77 iso_pu_bacteria 2941485952 2941486141 295
78 iso_pu_bacteria 2977240413 2977240561 295
79 3300003215 JGI25153J46596_10045067 JGI25153J46596_100450671 298
80 3300003791 Ga0055530_10001080 Ga0055530_1000108021 298
81 3300005262 Ga0065165_1000264 Ga0065165_10002646 298
82 3300005563 Ga0068855_100038442 Ga0068855_1000384423 298
83 3300009093 Ga0105240_10014687 Ga0105240_100146872 298
84 3300009551 Ga0105238_10010208 Ga0105238_100102082 298
85 3300013100 Ga0157373_10010029 Ga0157373_100100296 298
86 3300021361 Ga0213872_10048638 Ga0213872_100486383 298
87 3300025297 Ga0209758_1002447 Ga0209758_100244712 298
88 3300025298 Ga0209050_1001753 Ga0209050_10017534 298
89 3300025304 Ga0209257_1000125 Ga0209257_100012521 298
90 3300025304 Ga0209257_1002416 Ga0209257_10024163 298
91 3300025924 Ga0207694_10005922 Ga0207694_100059222 298
92 3300025949 Ga0207667_10091845 Ga0207667_100918452 298
93 3300026041 Ga0207639_10055804 Ga0207639_100558042 298
94 3300026041 Ga0207639_10551417 Ga0207639_105514171 298
95 3300035691 Ga0373931_0153354 Ga0373931_0153354_296_1195 298
96 3300037471 Ga0395905_0262364 Ga0395905_0262364_622_1542 298
97 3300039447 Ga0436361_0323660 Ga0436361_0323660_3396_4292 298
98 3300046616 Ga0495668_0029861 Ga0495668_0029861_736_1653 298
99 3300046616 Ga0495668_0072147 Ga0495668_0072147_476_1378 298
100 3300047472 Ga0495686_0004374 Ga0495686_0004374_8196_9107 298
101 3300049570 Ga0501033_0014073 Ga0501033_0014073_32_940 298
102 3300049581 Ga0501047_0204388 Ga0501047_0204388_48_944 298
103 3300053108 Ga0500562_001940 Ga0500562_001940_3574_4470 298
104 3300003215 JGI25153J46596_10024978 JGI25153J46596_100249782 299
105 3300003316 rootH1_10081374 rootH1_100813742 299
106 3300003578 Ga0006562J51391_1084114 Ga0006562J51391_10841143 299
107 3300003578 Ga0006562J51391_1084116 Ga0006562J51391_10841161 299
108 3300003775 Ga0055524_1006227 Ga0055524_10062274 299
109 3300003781 Ga0055536_1002645 Ga0055536_10026456 299
110 3300003781 Ga0055536_1002964 Ga0055536_10029644 299
111 3300003790 Ga0055528_1003679 Ga0055528_10036799 299
112 3300003791 Ga0055530_10003058 Ga0055530_100030585 299
113 3300003794 Ga0055531_10002770 Ga0055531_100027706 299
114 3300005262 Ga0065165_1001205 Ga0065165_100120521 299
115 3300005331 Ga0070670_100000013 Ga0070670_10000001310 299
116 3300005331 Ga0070670_100009610 Ga0070670_10000961011 299
117 3300005336 Ga0070680_100023814 Ga0070680_1000238145 299
118 3300005336 Ga0070680_100228410 Ga0070680_1002284102 299
119 3300005339 Ga0070660_100246796 Ga0070660_1002467962 299
120 3300005344 Ga0070661_100360119 Ga0070661_1003601192 299
121 3300005347 Ga0070668_100000042 Ga0070668_10000004266 299
122 3300005347 Ga0070668_100000707 Ga0070668_10000070714 299
123 3300005347 Ga0070668_100005345 Ga0070668_10000534510 299
124 3300005347 Ga0070668_100007523 Ga0070668_1000075232 299
125 3300005347 Ga0070668_100009879 Ga0070668_1000098799 299
126 3300005355 Ga0070671_100084419 Ga0070671_1000844193 299
127 3300005366 Ga0070659_100000428 Ga0070659_10000042826 299
128 3300005366 Ga0070659_100001301 Ga0070659_1000013016 299
129 3300005366 Ga0070659_100067459 Ga0070659_1000674592 299
130 3300005367 Ga0070667_100000168 Ga0070667_10000016824 299
131 3300005367 Ga0070667_100001255 Ga0070667_1000012553 299
132 3300005367 Ga0070667_100003824 Ga0070667_10000382412 299
133 3300005455 Ga0070663_100038077 Ga0070663_1000380772 299
134 3300005456 Ga0070678_100195914 Ga0070678_1001959142 299
135 3300005457 Ga0070662_100057789 Ga0070662_1000577892 299
136 3300005458 Ga0070681_10011298 Ga0070681_100112988 299
137 3300005458 Ga0070681_10117505 Ga0070681_101175052 299
138 3300005458 Ga0070681_10192454 Ga0070681_101924541 299
139 3300005530 Ga0070679_100000858 Ga0070679_1000008589 299
140 3300005530 Ga0070679_100013292 Ga0070679_1000132924 299
141 3300005539 Ga0068853_100033140 Ga0068853_1000331402 299
142 3300005539 Ga0068853_100048684 Ga0068853_1000486842 299
143 3300005539 Ga0068853_100121869 Ga0068853_1001218692 299
144 3300005539 Ga0068853_100194710 Ga0068853_1001947102 299
145 3300005548 Ga0070665_100000363 Ga0070665_10000036348 299
146 3300005548 Ga0070665_100000593 Ga0070665_10000059331 299
147 3300005548 Ga0070665_100035716 Ga0070665_1000357163 299
148 3300005563 Ga0068855_100009421 Ga0068855_1000094218 299
149 3300005563 Ga0068855_100029587 Ga0068855_1000295873 299
150 3300005563 Ga0068855_100152342 Ga0068855_1001523422 299
151 3300005577 Ga0068857_100288394 Ga0068857_1002883942 299
152 3300005614 Ga0068856_100373172 Ga0068856_1003731722 299
153 3300005614 Ga0068856_100443989 Ga0068856_1004439892 299
154 3300005618 Ga0068864_100000135 Ga0068864_10000013540 299
155 3300005618 Ga0068864_100004585 Ga0068864_1000045857 299
156 3300005719 Ga0068861_100417565 Ga0068861_1004175651 299
157 3300005841 Ga0068863_100000735 Ga0068863_10000073519 299
158 3300005841 Ga0068863_100003449 Ga0068863_10000344914 299
159 3300005841 Ga0068863_100302201 Ga0068863_1003022012 299
160 3300005841 Ga0068863_100539567 Ga0068863_1005395671 299
161 3300005842 Ga0068858_100000020 Ga0068858_10000002089 299
162 3300005842 Ga0068858_100006409 Ga0068858_1000064096 299
163 3300005842 Ga0068858_100155985 Ga0068858_1001559852 299
164 3300005843 Ga0068860_100000133 Ga0068860_10000013353 299
165 3300005843 Ga0068860_100000382 Ga0068860_10000038246 299
166 3300005843 Ga0068860_100022661 Ga0068860_1000226612 299
167 3300005844 Ga0068862_100000463 Ga0068862_10000046336 299
168 3300005844 Ga0068862_100017278 Ga0068862_1000172786 299
169 3300005844 Ga0068862_100017936 Ga0068862_1000179365 299
170 3300006353 Ga0075370_10059242 Ga0075370_100592422 299
171 3300006881 Ga0068865_100001019 Ga0068865_1000010199 299
172 3300006946 Ga0079104_1012955 Ga0079104_10129553 299
173 3300009092 Ga0105250_10008707 Ga0105250_100087072 299
174 3300009093 Ga0105240_10015807 Ga0105240_100158075 299
175 3300009093 Ga0105240_10071922 Ga0105240_100719222 299
176 3300009093 Ga0105240_10393733 Ga0105240_103937332 299
177 3300009101 Ga0105247_10108210 Ga0105247_101082102 299
178 3300009177 Ga0105248_10000305 Ga0105248_1000030524 299
179 3300009177 Ga0105248_10007895 Ga0105248_100078958 299
180 3300009177 Ga0105248_10044159 Ga0105248_100441592 299
181 3300009177 Ga0105248_10115539 Ga0105248_101155393 299
182 3300009177 Ga0105248_10249898 Ga0105248_102498981 299
183 3300009177 Ga0105248_10376092 Ga0105248_103760922 299
184 3300009551 Ga0105238_10062344 Ga0105238_100623442 299
185 3300009551 Ga0105238_10071800 Ga0105238_100718003 299
186 3300009551 Ga0105238_10107471 Ga0105238_101074712 299
187 3300009551 Ga0105238_10390454 Ga0105238_103904542 299
188 3300009553 Ga0105249_10000610 Ga0105249_1000061026 299
189 3300009553 Ga0105249_10158178 Ga0105249_101581782 299
190 3300013100 Ga0157373_10011866 Ga0157373_100118664 299
191 3300013102 Ga0157371_10268736 Ga0157371_102687362 299
192 3300013104 Ga0157370_10013802 Ga0157370_100138029 299
193 3300013104 Ga0157370_10305478 Ga0157370_103054782 299
194 3300013105 Ga0157369_10002971 Ga0157369_100029718 299
195 3300014325 Ga0163163_10019624 Ga0163163_100196246 299
196 3300014325 Ga0163163_10034972 Ga0163163_100349725 299
197 3300014325 Ga0163163_10076982 Ga0163163_100769822 299
198 3300014325 Ga0163163_10119452 Ga0163163_101194522 299
199 3300014325 Ga0163163_10254132 Ga0163163_102541322 299
200 3300014968 Ga0157379_10032873 Ga0157379_100328733 299
201 3300014968 Ga0157379_10113097 Ga0157379_101130971 299
202 3300017792 Ga0163161_10248513 Ga0163161_102485132 299
203 3300021377 Ga0213874_10060618 Ga0213874_100606182 299
204 3300021384 Ga0213876_10000081 Ga0213876_100000818 299
205 3300025263 Ga0209565_1000395 Ga0209565_100039529 299
206 3300025273 Ga0209673_1010662 Ga0209673_10106624 299
207 3300025292 Ga0209676_1000467 Ga0209676_100046742 299
208 3300025292 Ga0209676_1000560 Ga0209676_100056039 299
209 3300025295 Ga0209564_1001381 Ga0209564_100138116 299
210 3300025295 Ga0209564_1017524 Ga0209564_10175242 299
211 3300025297 Ga0209758_1001633 Ga0209758_100163316 299
212 3300025297 Ga0209758_1005737 Ga0209758_10057375 299
213 3300025298 Ga0209050_1000461 Ga0209050_100046129 299
214 3300025298 Ga0209050_1002433 Ga0209050_100243315 299
215 3300025299 Ga0209256_1003362 Ga0209256_10033629 299
216 3300025299 Ga0209256_1005306 Ga0209256_10053065 299
217 3300025304 Ga0209257_1000246 Ga0209257_10002464 299
218 3300025304 Ga0209257_1000427 Ga0209257_100042720 299
219 3300025304 Ga0209257_1012142 Ga0209257_10121422 299
220 3300025711 Ga0207696_1030365 Ga0207696_10303652 299
221 3300025903 Ga0207680_10027022 Ga0207680_100270222 299
222 3300025909 Ga0207705_10000556 Ga0207705_1000055617 299
223 3300025912 Ga0207707_10021552 Ga0207707_100215523 299
224 3300025912 Ga0207707_10056462 Ga0207707_100564623 299
225 3300025913 Ga0207695_10001235 Ga0207695_1000123520 299
226 3300025913 Ga0207695_10002484 Ga0207695_1000248420 299
227 3300025913 Ga0207695_10012530 Ga0207695_100125305 299
228 3300025913 Ga0207695_10050413 Ga0207695_100504134 299
229 3300025913 Ga0207695_10364594 Ga0207695_103645942 299
230 3300025917 Ga0207660_10000773 Ga0207660_100007732 299
231 3300025919 Ga0207657_10000693 Ga0207657_1000069318 299
232 3300025919 Ga0207657_10031284 Ga0207657_100312842 299
233 3300025919 Ga0207657_10057625 Ga0207657_100576253 299
234 3300025919 Ga0207657_10216388 Ga0207657_102163882 299
235 3300025921 Ga0207652_10019459 Ga0207652_100194594 299
236 3300025923 Ga0207681_10297952 Ga0207681_102979522 299
237 3300025924 Ga0207694_10133088 Ga0207694_101330882 299
238 3300025925 Ga0207650_10000016 Ga0207650_10000016197 299
239 3300025931 Ga0207644_10514682 Ga0207644_105146821 299
240 3300025932 Ga0207690_10000373 Ga0207690_1000037324 299
241 3300025932 Ga0207690_10006047 Ga0207690_100060478 299
242 3300025933 Ga0207706_10062893 Ga0207706_100628933 299
243 3300025938 Ga0207704_10002498 Ga0207704_100024986 299
244 3300025941 Ga0207711_10000160 Ga0207711_1000016052 299
245 3300025941 Ga0207711_10019133 Ga0207711_100191336 299
246 3300025941 Ga0207711_10025271 Ga0207711_100252714 299
247 3300025941 Ga0207711_10069290 Ga0207711_100692902 299
248 3300025945 Ga0207679_10116834 Ga0207679_101168342 299
249 3300025949 Ga0207667_10006652 Ga0207667_100066523 299
250 3300025949 Ga0207667_10045108 Ga0207667_100451082 299
251 3300025949 Ga0207667_10122271 Ga0207667_101222712 299
252 3300025949 Ga0207667_10238422 Ga0207667_102384222 299
253 3300025961 Ga0207712_10000641 Ga0207712_1000064121 299
254 3300025961 Ga0207712_10231955 Ga0207712_102319552 299
255 3300025972 Ga0207668_10000002 Ga0207668_10000002101 299
256 3300025972 Ga0207668_10000401 Ga0207668_1000040115 299
257 3300025972 Ga0207668_10001930 Ga0207668_1000193015 299
258 3300025972 Ga0207668_10022346 Ga0207668_100223462 299
259 3300025972 Ga0207668_10246916 Ga0207668_102469162 299
260 3300025986 Ga0207658_10000399 Ga0207658_1000039917 299
261 3300025986 Ga0207658_10003349 Ga0207658_1000334912 299
262 3300025986 Ga0207658_10009133 Ga0207658_100091333 299
263 3300026035 Ga0207703_10000082 Ga0207703_1000008229 299
264 3300026035 Ga0207703_10018799 Ga0207703_100187994 299
265 3300026035 Ga0207703_10104196 Ga0207703_101041962 299
266 3300026041 Ga0207639_10031860 Ga0207639_100318602 299
267 3300026041 Ga0207639_10146673 Ga0207639_101466731 299
268 3300026078 Ga0207702_10069163 Ga0207702_100691633 299
269 3300026078 Ga0207702_10105626 Ga0207702_101056262 299
270 3300026088 Ga0207641_10000007 Ga0207641_1000000774 299
271 3300026088 Ga0207641_10001614 Ga0207641_1000161417 299
272 3300026088 Ga0207641_10034834 Ga0207641_100348343 299
273 3300026088 Ga0207641_10499341 Ga0207641_104993412 299
274 3300026095 Ga0207676_10000191 Ga0207676_100001918 299
275 3300026095 Ga0207676_10000618 Ga0207676_1000061812 299
276 3300026095 Ga0207676_10004212 Ga0207676_100042124 299
277 3300026095 Ga0207676_10114800 Ga0207676_101148003 299
278 3300026118 Ga0207675_100156846 Ga0207675_1001568463 299
279 3300026118 Ga0207675_100453083 Ga0207675_1004530831 299
280 3300027378 Ga0209981_1000327 Ga0209981_10003273 299
281 3300028379 Ga0268266_10000003 Ga0268266_10000003808 299
282 3300028379 Ga0268266_10026031 Ga0268266_100260313 299
283 3300028379 Ga0268266_10163474 Ga0268266_101634742 299
284 3300028380 Ga0268265_10000836 Ga0268265_1000083622 299
285 3300028380 Ga0268265_10007741 Ga0268265_100077412 299
286 3300028380 Ga0268265_10043600 Ga0268265_100436003 299
287 3300028380 Ga0268265_10049357 Ga0268265_100493573 299
288 3300028380 Ga0268265_10065960 Ga0268265_100659602 299
289 3300028381 Ga0268264_10000008 Ga0268264_10000008303 299
290 3300028381 Ga0268264_10000207 Ga0268264_10000207117 299
291 3300028381 Ga0268264_10010210 Ga0268264_100102103 299
292 3300028786 Ga0307517_10019757 Ga0307517_100197571 299
293 3300028786 Ga0307517_10053033 Ga0307517_100530332 299
294 3300028794 Ga0307515_10016020 Ga0307515_1001602016 299
295 3300028800 Ga0265338_10009658 Ga0265338_100096586 299
296 3300028800 Ga0265338_10066774 Ga0265338_100667742 299
297 3300028800 Ga0265338_10247495 Ga0265338_102474952 299
298 3300031250 Ga0265331_10106196 Ga0265331_101061961 299
299 3300031251 Ga0265327_10000130 Ga0265327_1000013043 299
300 3300031251 Ga0265327_10003358 Ga0265327_1000335812 299
301 3300031456 Ga0307513_10000077 Ga0307513_1000007782 299
302 3300031456 Ga0307513_10002125 Ga0307513_1000212525 299
303 3300031456 Ga0307513_10007717 Ga0307513_1000771715 299
304 3300031456 Ga0307513_10009525 Ga0307513_100095256 299
305 3300031711 Ga0265314_10015084 Ga0265314_100150842 299
306 3300031711 Ga0265314_10118803 Ga0265314_101188032 299
307 3300031730 Ga0307516_10000001 Ga0307516_10000001273 299
308 3300031911 Ga0307412_10004253 Ga0307412_100042534 299
309 3300031995 Ga0307409_100299140 Ga0307409_1002991402 299
310 3300032004 Ga0307414_10036037 Ga0307414_100360372 299
311 3300032004 Ga0307414_10067123 Ga0307414_100671232 299
312 3300032004 Ga0307414_10341769 Ga0307414_103417692 299
313 3300032005 Ga0307411_10044622 Ga0307411_100446222 299
314 3300035113 Ga0373936_0015842 Ga0373936_0015842_980_1879 299
315 3300035170 Ga0373943_0142122 Ga0373943_0142122_117_1031 299
316 3300035171 Ga0373946_0024823 Ga0373946_0024823_125_1039 299
317 3300035695 Ga0373927_0003482 Ga0373927_0003482_3855_4769 299
318 3300037068 Ga0373925_0000257 Ga0373925_0000257_2801_3715 299
319 3300037418 Ga0395900_0012117 Ga0395900_0012117_553_1458 299
320 3300037418 Ga0395900_0371997 Ga0395900_0371997_52_972 299
321 3300037466 Ga0395898_0008282 Ga0395898_0008282_10046_10966 299
322 3300037466 Ga0395898_0265474 Ga0395898_0265474_371_1276 299
323 3300037471 Ga0395905_0005670 Ga0395905_0005670_6089_6994 299
324 3300037471 Ga0395905_0020042 Ga0395905_0020042_751_1656 299
325 3300037471 Ga0395905_0102098 Ga0395905_0102098_1572_2477 299
326 3300038443 Ga0395901_0001358 Ga0395901_0001358_6673_7593 299
327 3300039437 Ga0436365_0330659 Ga0436365_0330659_4899_5798 299
328 3300039437 Ga0436365_1275470 Ga0436365_1275470_50_967 299
329 3300039437 Ga0436365_1469960 Ga0436365_1469960_48_956 299
330 3300039450 Ga0436363_0052288 Ga0436363_0052288_69_968 299
331 3300042001 Ga0439441_007053 Ga0439441_007053_771_1673 299
332 3300044694 Ga0466963_0328076 Ga0466963_0328076_17_985 299
333 3300046453 Ga0495627_000923 Ga0495627_000923_14731_15630 299
334 3300046460 Ga0495638_0001655 Ga0495638_0001655_13706_14605 299
335 3300046460 Ga0495638_0002462 Ga0495638_0002462_7219_8118 299
336 3300046460 Ga0495638_0012523 Ga0495638_0012523_3545_4444 299
337 3300046471 Ga0495650_0000024 Ga0495650_0000024_186542_187441 299
338 3300046471 Ga0495650_0014492 Ga0495650_0014492_2363_3262 299
339 3300046471 Ga0495650_0032075 Ga0495650_0032075_1202_2110 299
340 3300046506 Ga0495583_0000003 Ga0495583_0000003_78273_79172 299
341 3300046507 Ga0495606_0009985 Ga0495606_0009985_3554_4456 299
342 3300046512 Ga0495610_0000802 Ga0495610_0000802_2811_3710 299
343 3300046512 Ga0495610_0002149 Ga0495610_0002149_1759_2661 299
344 3300046512 Ga0495610_0009764 Ga0495610_0009764_3424_4323 299
345 3300046516 Ga0495628_0177985 Ga0495628_0177985_263_1174 299
346 3300046518 Ga0495631_0004042 Ga0495631_0004042_2407_3306 299
347 3300046519 Ga0495632_0006611 Ga0495632_0006611_4853_5752 299
348 3300046519 Ga0495632_0146181 Ga0495632_0146181_80_988 299
349 3300046520 Ga0495637_0004049 Ga0495637_0004049_6575_7477 299
350 3300046524 Ga0495648_0000066 Ga0495648_0000066_68655_69554 299
351 3300046524 Ga0495648_0013634 Ga0495648_0013634_2805_3704 299
352 3300046528 Ga0495642_0001584 Ga0495642_0001584_4890_5795 299
353 3300046530 Ga0495654_0000118 Ga0495654_0000118_48054_48953 299
354 3300046543 Ga0495645_0062316 Ga0495645_0062316_613_1524 299
355 3300046557 Ga0495622_0018656 Ga0495622_0018656_932_1840 299
356 3300046558 Ga0495633_0001599 Ga0495633_0001599_6698_7612 299
357 3300046616 Ga0495668_0000342 Ga0495668_0000342_38523_39422 299
358 3300046616 Ga0495668_0036744 Ga0495668_0036744_420_1328 299
359 3300046648 Ga0495611_0009790 Ga0495611_0009790_2751_3650 299
360 3300046660 Ga0495625_0000854 Ga0495625_0000854_2822_3721 299
361 3300046660 Ga0495625_0012473 Ga0495625_0012473_2915_3817 299
362 3300046660 Ga0495625_0014395 Ga0495625_0014395_2697_3596 299
363 3300046660 Ga0495625_0048184 Ga0495625_0048184_1386_2285 299
364 3300046660 Ga0495625_0062964 Ga0495625_0062964_1144_2043 299
365 3300046660 Ga0495625_0159468 Ga0495625_0159468_467_1375 299
366 3300046664 Ga0495659_0045568 Ga0495659_0045568_13_912 299
367 3300046678 Ga0495599_0246452 Ga0495599_0246452_117_1028 299
368 3300046684 Ga0495669_0000002 Ga0495669_0000002_255927_256835 299
369 3300046684 Ga0495669_0000353 Ga0495669_0000353_15279_16184 299
370 3300046684 Ga0495669_0007404 Ga0495669_0007404_1221_2129 299
371 3300046691 Ga0495670_0078163 Ga0495670_0078163_35_934 299
372 3300046694 Ga0495649_0000089 Ga0495649_0000089_74042_74959 299
373 3300046794 Ga0495589_0020569 Ga0495589_0020569_1509_2408 299
374 3300046810 Ga0495660_0037000 Ga0495660_0037000_1420_2322 299
375 3300046810 Ga0495660_0107819 Ga0495660_0107819_393_1292 299
376 3300047318 Ga0495636_0017989 Ga0495636_0017989_1224_2129 299
377 3300047320 Ga0495672_0033438 Ga0495672_0033438_686_1588 299
378 3300047320 Ga0495672_0037253 Ga0495672_0037253_1581_2486 299
379 3300047323 Ga0495683_0038727 Ga0495683_0038727_643_1545 299
380 3300047445 Ga0495677_0018180 Ga0495677_0018180_1000_1905 299
381 3300047446 Ga0495679_003383 Ga0495679_003383_4624_5523 299
382 3300047469 Ga0495673_0000102 Ga0495673_0000102_3307_4206 299
383 3300047469 Ga0495673_0000710 Ga0495673_0000710_8292_9191 299
384 3300047469 Ga0495673_0005918 Ga0495673_0005918_3369_4277 299
385 3300047472 Ga0495686_0000839 Ga0495686_0000839_4838_5737 299
386 3300047472 Ga0495686_0003093 Ga0495686_0003093_13761_14663 299
387 3300047472 Ga0495686_0018643 Ga0495686_0018643_2900_3799 299
388 3300047472 Ga0495686_0063744 Ga0495686_0063744_750_1664 299
389 3300047472 Ga0495686_0102904 Ga0495686_0102904_355_1254 299
390 3300047673 Ga0495593_0021131 Ga0495593_0021131_26_934 299
391 3300048905 Ga0496102_0020538 Ga0496102_0020538_1491_2396 299
392 3300048905 Ga0496102_0157360 Ga0496102_0157360_584_1495 299
393 3300048906 Ga0496103_0031900 Ga0496103_0031900_2112_3023 299
394 3300048909 Ga0496106_0028640 Ga0496106_0028640_636_1538 299
395 3300048910 Ga0496107_0000131 Ga0496107_0000131_26513_27415 299
396 3300048911 Ga0496108_0017861 Ga0496108_0017861_4696_5601 299
397 3300048915 Ga0496112_0052358 Ga0496112_0052358_1886_2791 299
398 3300048915 Ga0496112_0114898 Ga0496112_0114898_71_976 299
399 3300048918 Ga0496115_0002138 Ga0496115_0002138_2834_3742 299
400 3300048918 Ga0496115_0002497 Ga0496115_0002497_4650_5549 299
401 3300048918 Ga0496115_0011156 Ga0496115_0011156_1536_2438 299
402 3300048918 Ga0496115_0268057 Ga0496115_0268057_65_973 299
403 3300048919 Ga0496116_0021619 Ga0496116_0021619_1596_2513 299
404 3300048920 Ga0496117_0018025 Ga0496117_0018025_1017_1928 299
405 3300048921 Ga0496118_0015375 Ga0496118_0015375_2228_3139 299
406 3300048922 Ga0496119_0023907 Ga0496119_0023907_468_1379 299
407 3300048924 Ga0496121_0000035 Ga0496121_0000035_45117_46028 299
408 3300048924 Ga0496121_0006185 Ga0496121_0006185_55_957 299
409 3300048924 Ga0496121_0184270 Ga0496121_0184270_143_1051 299
410 3300048925 Ga0496122_0004488 Ga0496122_0004488_13913_14827 299
411 3300048926 Ga0496123_0003275 Ga0496123_0003275_6599_7513 299
412 3300048927 Ga0496124_0012278 Ga0496124_0012278_3064_3978 299
413 3300048928 Ga0496125_0002516 Ga0496125_0002516_12957_13871 299
414 3300048928 Ga0496125_0043316 Ga0496125_0043316_55_969 299
415 3300048929 Ga0496126_0001304 Ga0496126_0001304_23445_24344 299
416 3300049459 Ga0495678_000558 Ga0495678_000558_33457_34371 299
417 3300049579 Ga0501043_0373914 Ga0501043_0373914_126_1034 299
418 3300049581 Ga0501047_0119071 Ga0501047_0119071_333_1232 299
419 3300049581 Ga0501047_0121608 Ga0501047_0121608_284_1195 299
420 3300050496 nmdc:mga07m45_69490_c1 nmdc:mga07m45_69490_c1_109_1008 299
421 3300050516 nmdc:mga0sz30_6418_c1 nmdc:mga0sz30_6418_c1_3157_4071 299
422 3300053080 Ga0500635_0000133 Ga0500635_0000133_28995_29900 299
423 3300053086 Ga0500578_0000737 Ga0500578_0000737_32711_33610 299
424 3300053086 Ga0500578_0130655 Ga0500578_0130655_600_1502 299
425 3300053087 Ga0500643_005318 Ga0500643_005318_1360_2265 299
426 3300053088 Ga0500644_0000084 Ga0500644_0000084_56444_57343 299
427 3300053090 Ga0500646_0042612 Ga0500646_0042612_245_1156 299
428 3300053093 Ga0500651_0003759 Ga0500651_0003759_4229_5137 299
429 3300053103 Ga0500555_001064 Ga0500555_001064_2844_3755 299
430 3300053104 Ga0500556_0002638 Ga0500556_0002638_4640_5542 299
431 3300053108 Ga0500562_002822 Ga0500562_002822_569_1468 299
432 3300053109 Ga0500569_013570 Ga0500569_013570_590_1498 299
433 3300053118 Ga0500594_0000221 Ga0500594_0000221_8104_9018 299
434 3300053122 Ga0500608_000187 Ga0500608_000187_23973_24872 299
435 3300053122 Ga0500608_001063 Ga0500608_001063_8547_9455 299
436 3300053125 Ga0500618_002255 Ga0500618_002255_5669_6568 299
437 3300053130 Ga0500642_0053055 Ga0500642_0053055_413_1321 299
438 3300053133 Ga0500655_024543 Ga0500655_024543_178_1092 299
439 3300053134 Ga0500658_0014910 Ga0500658_0014910_328_1230 299
440 3300053136 Ga0500559_0000212 Ga0500559_0000212_22087_22986 299
441 3300053136 Ga0500559_0003398 Ga0500559_0003398_4055_4954 299
442 3300053136 Ga0500559_0008444 Ga0500559_0008444_1524_2432 299
443 3300053136 Ga0500559_0018941 Ga0500559_0018941_1815_2714 299
444 3300053136 Ga0500559_0058687 Ga0500559_0058687_651_1556 299
445 3300053138 Ga0500564_000080 Ga0500564_000080_490_1389 299
446 3300053142 Ga0500577_0001991 Ga0500577_0001991_3185_4084 299
447 3300053148 Ga0500590_004838 Ga0500590_004838_5400_6308 299
448 3300053153 Ga0500616_0066166 Ga0500616_0066166_530_1429 299
449 3300053154 Ga0500619_000501 Ga0500619_000501_670_1578 299
450 3300053156 Ga0500622_0002814 Ga0500622_0002814_5188_6087 299
451 3300053157 Ga0500624_002114 Ga0500624_002114_1624_2529 299
452 3300053162 Ga0500638_061866 Ga0500638_061866_467_1372 299
453 3300053177 Ga0500636_0003639 Ga0500636_0003639_3315_4220 299
454 3300053178 Ga0500637_0029408 Ga0500637_0029408_620_1525 299
455 3300053729 Ga0500625_057543 Ga0500625_057543_333_1241 299
456 3300053730 Ga0500645_040824 Ga0500645_040824_12_914 299
457 3300053735 Ga0500596_001059 Ga0500596_001059_1289_2197 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

20

295

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mp5-assembly2.cif.gz_C crystal structure of human lyase r41m in complex with hmg-coa 0.9538 1 296
1ydo-assembly1.cif.gz_A crystal structure of the bacillis subtilis hmg-coa lyase, northeast structural genomics target sr181. 0.9535 3 290
3mp3-assembly2.cif.gz_D crystal structure of human lyase in complex with inhibitor hg-coa 0.9534 1 294
2cw6-assembly1.cif.gz_A crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9528 1 294
3mp4-assembly3.cif.gz_F crystal structure of human lyase r41m mutant 0.9522 1 294
ID Description Score Start End Superfamily
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9559 3 294 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9458 3 290 3.20.20.70
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.928 3 294 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9114 3 290 3.20.20.70
af_Q4DIQ4_8_322_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9015 1 284 3.20.20.70
ID Description Score Start End GO Terms
AF-D5VHR3-F1-model_v4 Pyruvate carboxyltransferase 0.9951 1 299 GO:0004419
GO:0006552
GO:0016740
GO:0046872
GO:0046951
AF-A0A7C1APX4-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9851 5 233 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A2E4CTX6-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9814 5 294 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A074MT89-F1-model_v4 3-hydroxy-3-methylglutaryl-CoA lyase 0.9789 1 295 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A7Y3C014-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9784 1 255 GO:0004419
GO:0006552
GO:0046872
GO:0046951

Feature Viewer

pLDDT pTM Quality
94.19 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map