F448041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 457 | 256 | 424 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0328076|Ga0466963_0328076_17_985 |
| Length | 322 |
| Sequence | MRTPTVVRAAPAPLAPMPDRVTIYEVGPRDGLQNEKALLEVDQKLEFIQRLEAAGARRIETVSFVNPKRVPQMAGAEEISAALPHEAGRSRIGLVLNARGWDRCLEAKCDEANVVVCATDGFGIRNQGASAAEQTQAMQAILARRKAEGGPPITVTISVAFGCPFDGEVSEDQVIRIVRAAAEAGADEIALADTIGVADPWLVRKRVEATKTAAPGIPLRMHFHDTRNTGLANAFASVEAGVDVLDASCGGLGGCPFAPDATGNIGTEDLVYMLERAGYSTGYDLDGLIGTAKWMAGILGKPPAASVSRAGGFPVPKAQAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 11 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 15 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 16 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 17 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 18 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 19 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 20 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 21 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 22 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 23 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 24 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 25 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 26 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 27 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 28 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 29 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 30 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 31 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 32 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 150 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 151 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 152 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 153 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 154 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 210 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 222 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 225 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 226 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 227 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 229 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 230 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 231 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 232 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 233 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 234 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 235 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 236 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 237 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 239 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 240 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 242 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 243 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 244 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 245 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 246 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 247 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 248 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 249 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 250 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 253 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 254 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.34 |
| Metatranscriptomes | 0.44 |
| Isolates | 7.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.26 |
| Nodule | 0.22 |
| Rhizoplane | 3.5 |
| Rhizosphere | 65.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10024978 | 3300003215 | Bacteria | 2144 |
| 2 | JGI25153J46596_10045067 | 3300003215 | Bacteria | 1319 |
| 3 | rootH1_10081374 | 3300003316 | Bacteria | 1996 |
| 4 | Ga0006562J51391_1084114 | 3300003578 | Bacteria | 3520 |
| 5 | Ga0006562J51391_1084116 | 3300003578 | Bacteria | 2090 |
| 6 | Ga0055524_1006227 | 3300003775 | Bacteria | 5206 |
| 7 | Ga0055536_1001011 | 3300003781 | Bacteria | 17865 |
| 8 | Ga0055536_1001362 | 3300003781 | Bacteria | 14857 |
| 9 | Ga0055536_1002645 | 3300003781 | Bacteria | 9958 |
| 10 | Ga0055536_1002964 | 3300003781 | Bacteria | 9309 |
| 11 | Ga0055536_1015837 | 3300003781 | Bacteria | 2556 |
| 12 | Ga0055528_1003679 | 3300003790 | Bacteria | 7606 |
| 13 | Ga0055530_10001080 | 3300003791 | Bacteria | 21471 |
| 14 | Ga0055530_10003058 | 3300003791 | Bacteria | 9958 |
| 15 | Ga0055531_10002770 | 3300003794 | Bacteria | 11506 |
| 16 | Ga0065165_1000264 | 3300005262 | Bacteria | 90435 |
| 17 | Ga0065165_1001205 | 3300005262 | Bacteria | 29843 |
| 18 | Ga0070670_100000013 | 3300005331 | Bacteria | 250768 |
| 19 | Ga0070670_100009610 | 3300005331 | Bacteria | 8254 |
| 20 | Ga0070680_100023814 | 3300005336 | Bacteria | 4887 |
| 21 | Ga0070680_100228410 | 3300005336 | Bacteria | 1571 |
| 22 | Ga0070660_100246796 | 3300005339 | Bacteria | 1455 |
| 23 | Ga0070661_100360119 | 3300005344 | Bacteria | 1143 |
| 24 | Ga0070668_100000042 | 3300005347 | Bacteria | 78694 |
| 25 | Ga0070668_100000707 | 3300005347 | Bacteria | 22821 |
| 26 | Ga0070668_100005345 | 3300005347 | Bacteria | 9534 |
| 27 | Ga0070668_100007523 | 3300005347 | Bacteria | 8089 |
| 28 | Ga0070668_100009879 | 3300005347 | Bacteria | 7068 |
| 29 | Ga0070671_100084419 | 3300005355 | Bacteria | 2656 |
| 30 | Ga0070659_100000428 | 3300005366 | Bacteria | 31806 |
| 31 | Ga0070659_100001301 | 3300005366 | Bacteria | 18120 |
| 32 | Ga0070659_100067459 | 3300005366 | Bacteria | 2837 |
| 33 | Ga0070667_100000168 | 3300005367 | Bacteria | 81935 |
| 34 | Ga0070667_100001255 | 3300005367 | Bacteria | 23018 |
| 35 | Ga0070667_100003824 | 3300005367 | Bacteria | 12796 |
| 36 | Ga0070663_100038077 | 3300005455 | Bacteria | 3352 |
| 37 | Ga0070678_100195914 | 3300005456 | Bacteria | 1664 |
| 38 | Ga0070662_100057789 | 3300005457 | Bacteria | 2820 |
| 39 | Ga0070681_10011298 | 3300005458 | Bacteria | 8834 |
| 40 | Ga0070681_10117505 | 3300005458 | Bacteria | 2596 |
| 41 | Ga0070681_10192454 | 3300005458 | Bacteria | 1959 |
| 42 | Ga0070679_100000858 | 3300005530 | Bacteria | 26439 |
| 43 | Ga0070679_100013292 | 3300005530 | Bacteria | 7881 |
| 44 | Ga0068853_100033140 | 3300005539 | Bacteria | 4381 |
| 45 | Ga0068853_100048684 | 3300005539 | Bacteria | 3642 |
| 46 | Ga0068853_100121869 | 3300005539 | Bacteria | 2327 |
| 47 | Ga0068853_100194710 | 3300005539 | Bacteria | 1843 |
| 48 | Ga0070693_100192798 | 3300005547 | Bacteria | 1319 |
| 49 | Ga0070665_100000363 | 3300005548 | Bacteria | 67699 |
| 50 | Ga0070665_100000593 | 3300005548 | Bacteria | 50386 |
| 51 | Ga0070665_100035716 | 3300005548 | Bacteria | 4999 |
| 52 | Ga0070665_100709724 | 3300005548 | Bacteria | 1019 |
| 53 | Ga0068855_100009421 | 3300005563 | Bacteria | 11794 |
| 54 | Ga0068855_100029587 | 3300005563 | Bacteria | 6547 |
| 55 | Ga0068855_100038442 | 3300005563 | Bacteria | 5686 |
| 56 | Ga0068855_100152342 | 3300005563 | Bacteria | 2629 |
| 57 | Ga0068857_100288394 | 3300005577 | Bacteria | 1511 |
| 58 | Ga0068856_100373172 | 3300005614 | Bacteria | 1445 |
| 59 | Ga0068856_100443989 | 3300005614 | Bacteria | 1318 |
| 60 | Ga0068864_100000135 | 3300005618 | Bacteria | 71759 |
| 61 | Ga0068864_100004585 | 3300005618 | Bacteria | 11336 |
| 62 | Ga0068861_100417565 | 3300005719 | Bacteria | 1195 |
| 63 | Ga0068863_100000735 | 3300005841 | Bacteria | 32827 |
| 64 | Ga0068863_100003449 | 3300005841 | Bacteria | 15593 |
| 65 | Ga0068863_100302201 | 3300005841 | Bacteria | 1552 |
| 66 | Ga0068863_100539567 | 3300005841 | Bacteria | 1151 |
| 67 | Ga0068858_100000020 | 3300005842 | Bacteria | 175896 |
| 68 | Ga0068858_100006409 | 3300005842 | Bacteria | 11462 |
| 69 | Ga0068858_100155985 | 3300005842 | Bacteria | 2148 |
| 70 | Ga0068860_100000133 | 3300005843 | Bacteria | 120382 |
| 71 | Ga0068860_100000382 | 3300005843 | Bacteria | 58081 |
| 72 | Ga0068860_100022661 | 3300005843 | Bacteria | 6071 |
| 73 | Ga0068862_100000463 | 3300005844 | Bacteria | 43942 |
| 74 | Ga0068862_100017278 | 3300005844 | Bacteria | 6005 |
| 75 | Ga0068862_100017936 | 3300005844 | Bacteria | 5895 |
| 76 | Ga0075366_10017266 | 3300006195 | Bacteria | 4152 |
| 77 | Ga0075370_10059242 | 3300006353 | Bacteria | 2179 |
| 78 | Ga0068865_100001019 | 3300006881 | Bacteria | 16107 |
| 79 | Ga0079104_1012955 | 3300006946 | Bacteria | 2593 |
| 80 | Ga0105250_10008707 | 3300009092 | Bacteria | 4298 |
| 81 | Ga0105240_10014687 | 3300009093 | Bacteria | 10685 |
| 82 | Ga0105240_10015807 | 3300009093 | Bacteria | 10241 |
| 83 | Ga0105240_10071922 | 3300009093 | Bacteria | 4276 |
| 84 | Ga0105240_10393733 | 3300009093 | Bacteria | 1562 |
| 85 | Ga0105247_10108210 | 3300009101 | Bacteria | 1786 |
| 86 | Ga0105248_10000305 | 3300009177 | Bacteria | 58472 |
| 87 | Ga0105248_10007895 | 3300009177 | Bacteria | 11694 |
| 88 | Ga0105248_10044159 | 3300009177 | Bacteria | 4998 |
| 89 | Ga0105248_10115539 | 3300009177 | Bacteria | 3027 |
| 90 | Ga0105248_10249898 | 3300009177 | Bacteria | 1996 |
| 91 | Ga0105248_10376092 | 3300009177 | Bacteria | 1599 |
| 92 | Ga0105238_10010208 | 3300009551 | Bacteria | 9415 |
| 93 | Ga0105238_10062344 | 3300009551 | Bacteria | 3729 |
| 94 | Ga0105238_10071800 | 3300009551 | Bacteria | 3459 |
| 95 | Ga0105238_10107471 | 3300009551 | Bacteria | 2771 |
| 96 | Ga0105238_10390454 | 3300009551 | Bacteria | 1384 |
| 97 | Ga0105249_10000610 | 3300009553 | Bacteria | 32602 |
| 98 | Ga0105249_10158178 | 3300009553 | Bacteria | 2187 |
| 99 | Ga0157373_10010029 | 3300013100 | Bacteria | 6981 |
| 100 | Ga0157373_10011866 | 3300013100 | Bacteria | 6402 |
| 101 | Ga0157371_10268736 | 3300013102 | Bacteria | 1230 |
| 102 | Ga0157370_10013802 | 3300013104 | Bacteria | 8298 |
| 103 | Ga0157370_10305478 | 3300013104 | Bacteria | 1468 |
| 104 | Ga0157369_10002971 | 3300013105 | Bacteria | 20293 |
| 105 | Ga0163163_10019624 | 3300014325 | Bacteria | 6349 |
| 106 | Ga0163163_10034972 | 3300014325 | Bacteria | 4871 |
| 107 | Ga0163163_10076982 | 3300014325 | Bacteria | 3332 |
| 108 | Ga0163163_10119452 | 3300014325 | Bacteria | 2669 |
| 109 | Ga0163163_10254132 | 3300014325 | Bacteria | 1808 |
| 110 | Ga0157379_10032873 | 3300014968 | Bacteria | 4625 |
| 111 | Ga0157379_10113097 | 3300014968 | Bacteria | 2440 |
| 112 | Ga0163161_10248513 | 3300017792 | Bacteria | 1386 |
| 113 | Ga0213872_10048638 | 3300021361 | Bacteria | 1927 |
| 114 | Ga0213874_10060618 | 3300021377 | Bacteria | 1184 |
| 115 | Ga0213876_10000081 | 3300021384 | Bacteria | 108997 |
| 116 | Ga0209026_1010478 | 3300025250 | Bacteria | 1727 |
| 117 | Ga0209565_1000395 | 3300025263 | Bacteria | 36792 |
| 118 | Ga0209673_1010662 | 3300025273 | Bacteria | 3853 |
| 119 | Ga0209676_1000213 | 3300025292 | Bacteria | 128039 |
| 120 | Ga0209676_1000467 | 3300025292 | Bacteria | 67659 |
| 121 | Ga0209676_1000560 | 3300025292 | Bacteria | 56233 |
| 122 | Ga0209676_1005154 | 3300025292 | Bacteria | 6949 |
| 123 | Ga0209564_1001381 | 3300025295 | Bacteria | 25325 |
| 124 | Ga0209564_1017524 | 3300025295 | Bacteria | 2786 |
| 125 | Ga0209564_1024212 | 3300025295 | Bacteria | 2080 |
| 126 | Ga0209758_1001633 | 3300025297 | Bacteria | 25481 |
| 127 | Ga0209758_1002447 | 3300025297 | Bacteria | 18951 |
| 128 | Ga0209758_1005737 | 3300025297 | Bacteria | 9350 |
| 129 | Ga0209050_1000461 | 3300025298 | Bacteria | 72912 |
| 130 | Ga0209050_1001753 | 3300025298 | Bacteria | 21523 |
| 131 | Ga0209050_1002433 | 3300025298 | Bacteria | 15998 |
| 132 | Ga0209050_1003548 | 3300025298 | Bacteria | 11365 |
| 133 | Ga0209256_1003362 | 3300025299 | Bacteria | 11323 |
| 134 | Ga0209256_1005306 | 3300025299 | Bacteria | 7502 |
| 135 | Ga0209257_1000125 | 3300025304 | Bacteria | 218126 |
| 136 | Ga0209257_1000246 | 3300025304 | Bacteria | 125942 |
| 137 | Ga0209257_1000427 | 3300025304 | Bacteria | 81007 |
| 138 | Ga0209257_1000757 | 3300025304 | Bacteria | 48772 |
| 139 | Ga0209257_1002416 | 3300025304 | Bacteria | 18671 |
| 140 | Ga0209257_1012142 | 3300025304 | Bacteria | 4030 |
| 141 | Ga0207696_1030365 | 3300025711 | Bacteria | 1643 |
| 142 | Ga0207680_10027022 | 3300025903 | Bacteria | 3189 |
| 143 | Ga0207705_10000556 | 3300025909 | Bacteria | 31398 |
| 144 | Ga0207707_10021552 | 3300025912 | Bacteria | 5633 |
| 145 | Ga0207707_10056462 | 3300025912 | Bacteria | 3416 |
| 146 | Ga0207695_10001235 | 3300025913 | Bacteria | 43771 |
| 147 | Ga0207695_10002484 | 3300025913 | Bacteria | 27149 |
| 148 | Ga0207695_10012530 | 3300025913 | Bacteria | 10169 |
| 149 | Ga0207695_10050413 | 3300025913 | Bacteria | 4380 |
| 150 | Ga0207695_10364594 | 3300025913 | Bacteria | 1331 |
| 151 | Ga0207660_10000773 | 3300025917 | Bacteria | 21298 |
| 152 | Ga0207657_10000693 | 3300025919 | Bacteria | 35842 |
| 153 | Ga0207657_10031284 | 3300025919 | Bacteria | 4824 |
| 154 | Ga0207657_10057625 | 3300025919 | Bacteria | 3347 |
| 155 | Ga0207657_10216388 | 3300025919 | Bacteria | 1536 |
| 156 | Ga0207652_10019459 | 3300025921 | Bacteria | 5584 |
| 157 | Ga0207681_10297952 | 3300025923 | Bacteria | 1275 |
| 158 | Ga0207694_10005922 | 3300025924 | Bacteria | 9376 |
| 159 | Ga0207694_10133088 | 3300025924 | Bacteria | 1994 |
| 160 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 161 | Ga0207644_10514682 | 3300025931 | Bacteria | 988 |
| 162 | Ga0207690_10000373 | 3300025932 | Bacteria | 29751 |
| 163 | Ga0207690_10006047 | 3300025932 | Bacteria | 7169 |
| 164 | Ga0207706_10062893 | 3300025933 | Bacteria | 3268 |
| 165 | Ga0207704_10002498 | 3300025938 | Bacteria | 8290 |
| 166 | Ga0207711_10000160 | 3300025941 | Bacteria | 72317 |
| 167 | Ga0207711_10019133 | 3300025941 | Bacteria | 5699 |
| 168 | Ga0207711_10025271 | 3300025941 | Bacteria | 4983 |
| 169 | Ga0207711_10069290 | 3300025941 | Bacteria | 3057 |
| 170 | Ga0207679_10116834 | 3300025945 | Bacteria | 2116 |
| 171 | Ga0207667_10006652 | 3300025949 | Bacteria | 13971 |
| 172 | Ga0207667_10045108 | 3300025949 | Bacteria | 4669 |
| 173 | Ga0207667_10091845 | 3300025949 | Bacteria | 3136 |
| 174 | Ga0207667_10122271 | 3300025949 | Bacteria | 2682 |
| 175 | Ga0207667_10238422 | 3300025949 | Bacteria | 1862 |
| 176 | Ga0207667_10643135 | 3300025949 | Bacteria | 1067 |
| 177 | Ga0207712_10000641 | 3300025961 | Bacteria | 27375 |
| 178 | Ga0207712_10231955 | 3300025961 | Bacteria | 1482 |
| 179 | Ga0207668_10000002 | 3300025972 | Bacteria | 209163 |
| 180 | Ga0207668_10000401 | 3300025972 | Bacteria | 27305 |
| 181 | Ga0207668_10001930 | 3300025972 | Bacteria | 12135 |
| 182 | Ga0207668_10022346 | 3300025972 | Bacteria | 4048 |
| 183 | Ga0207668_10246916 | 3300025972 | Bacteria | 1447 |
| 184 | Ga0207658_10000399 | 3300025986 | Bacteria | 41904 |
| 185 | Ga0207658_10003349 | 3300025986 | Bacteria | 11367 |
| 186 | Ga0207658_10009133 | 3300025986 | Bacteria | 6724 |
| 187 | Ga0207703_10000082 | 3300026035 | Bacteria | 110579 |
| 188 | Ga0207703_10018799 | 3300026035 | Bacteria | 5395 |
| 189 | Ga0207703_10104196 | 3300026035 | Bacteria | 2410 |
| 190 | Ga0207639_10031860 | 3300026041 | Bacteria | 3877 |
| 191 | Ga0207639_10055804 | 3300026041 | Bacteria | 3025 |
| 192 | Ga0207639_10146673 | 3300026041 | Bacteria | 1972 |
| 193 | Ga0207639_10551417 | 3300026041 | Bacteria | 1058 |
| 194 | Ga0207702_10069163 | 3300026078 | Bacteria | 3035 |
| 195 | Ga0207702_10105626 | 3300026078 | Bacteria | 2494 |
| 196 | Ga0207641_10000007 | 3300026088 | Bacteria | 441443 |
| 197 | Ga0207641_10001614 | 3300026088 | Bacteria | 21995 |
| 198 | Ga0207641_10034834 | 3300026088 | Bacteria | 4190 |
| 199 | Ga0207641_10499341 | 3300026088 | Bacteria | 1181 |
| 200 | Ga0207676_10000191 | 3300026095 | Bacteria | 53466 |
| 201 | Ga0207676_10000618 | 3300026095 | Bacteria | 29046 |
| 202 | Ga0207676_10004212 | 3300026095 | Bacteria | 10160 |
| 203 | Ga0207676_10114800 | 3300026095 | Bacteria | 2260 |
| 204 | Ga0207675_100156846 | 3300026118 | Bacteria | 2169 |
| 205 | Ga0207675_100453083 | 3300026118 | Bacteria | 1272 |
| 206 | Ga0209981_1000327 | 3300027378 | Bacteria | 6139 |
| 207 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 208 | Ga0268266_10026031 | 3300028379 | Bacteria | 4976 |
| 209 | Ga0268266_10163474 | 3300028379 | Bacteria | 2015 |
| 210 | Ga0268265_10000836 | 3300028380 | Bacteria | 28993 |
| 211 | Ga0268265_10007741 | 3300028380 | Bacteria | 7251 |
| 212 | Ga0268265_10043600 | 3300028380 | Bacteria | 3336 |
| 213 | Ga0268265_10049357 | 3300028380 | Bacteria | 3165 |
| 214 | Ga0268265_10065960 | 3300028380 | Bacteria | 2796 |
| 215 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 216 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 217 | Ga0268264_10010210 | 3300028381 | Bacteria | 7772 |
| 218 | Ga0307517_10019757 | 3300028786 | Bacteria | 8620 |
| 219 | Ga0307517_10053033 | 3300028786 | Bacteria | 4048 |
| 220 | Ga0307515_10016020 | 3300028794 | Bacteria | 13759 |
| 221 | Ga0265338_10009658 | 3300028800 | Bacteria | 11448 |
| 222 | Ga0265338_10066774 | 3300028800 | Bacteria | 3110 |
| 223 | Ga0265338_10247495 | 3300028800 | Bacteria | 1317 |
| 224 | Ga0265331_10106196 | 3300031250 | Bacteria | 1289 |
| 225 | Ga0265327_10000130 | 3300031251 | Bacteria | 165066 |
| 226 | Ga0265327_10003358 | 3300031251 | Bacteria | 15423 |
| 227 | Ga0307513_10000077 | 3300031456 | Bacteria | 134167 |
| 228 | Ga0307513_10002125 | 3300031456 | Bacteria | 27813 |
| 229 | Ga0307513_10007717 | 3300031456 | Bacteria | 13899 |
| 230 | Ga0307513_10009525 | 3300031456 | Bacteria | 12284 |
| 231 | Ga0265314_10015084 | 3300031711 | Bacteria | 6146 |
| 232 | Ga0265314_10118803 | 3300031711 | Bacteria | 1668 |
| 233 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 234 | Ga0307412_10004253 | 3300031911 | Bacteria | 7982 |
| 235 | Ga0307409_100299140 | 3300031995 | Bacteria | 1496 |
| 236 | Ga0307414_10036037 | 3300032004 | Bacteria | 3298 |
| 237 | Ga0307414_10040479 | 3300032004 | Bacteria | 3148 |
| 238 | Ga0307414_10067123 | 3300032004 | Bacteria | 2568 |
| 239 | Ga0307414_10341769 | 3300032004 | Bacteria | 1281 |
| 240 | Ga0307411_10044622 | 3300032005 | Bacteria | 2846 |
| 241 | Ga0307411_10433781 | 3300032005 | Bacteria | 1095 |
| 242 | Ga0373936_0015842 | 3300035113 | Bacteria | 2892 |
| 243 | Ga0373943_0142122 | 3300035170 | Bacteria | 1294 |
| 244 | Ga0373946_0024823 | 3300035171 | Bacteria | 2353 |
| 245 | Ga0373931_0153354 | 3300035691 | Bacteria | 1345 |
| 246 | Ga0373927_0003482 | 3300035695 | Bacteria | 11271 |
| 247 | Ga0373925_0000257 | 3300037068 | Bacteria | 55764 |
| 248 | Ga0395900_0012117 | 3300037418 | Bacteria | 8810 |
| 249 | Ga0395900_0371997 | 3300037418 | Bacteria | 1398 |
| 250 | Ga0395898_0008282 | 3300037466 | Bacteria | 10996 |
| 251 | Ga0395898_0265474 | 3300037466 | Bacteria | 1637 |
| 252 | Ga0395905_0005670 | 3300037471 | Bacteria | 12700 |
| 253 | Ga0395905_0020042 | 3300037471 | Bacteria | 6337 |
| 254 | Ga0395905_0102098 | 3300037471 | Bacteria | 2692 |
| 255 | Ga0395905_0262364 | 3300037471 | Bacteria | 1613 |
| 256 | Ga0395901_0001358 | 3300038443 | Bacteria | 25609 |
| 257 | Ga0436365_0330659 | 3300039437 | Bacteria | 9341 |
| 258 | Ga0436365_0966433 | 3300039437 | Bacteria | 3104 |
| 259 | Ga0436365_1275470 | 3300039437 | Bacteria | 1107 |
| 260 | Ga0436365_1469960 | 3300039437 | Bacteria | 1229 |
| 261 | Ga0436360_0483895 | 3300039438 | Bacteria | 1150 |
| 262 | Ga0436361_0323660 | 3300039447 | Bacteria | 9818 |
| 263 | Ga0436363_0052288 | 3300039450 | Bacteria | 2134 |
| 264 | Ga0439441_007053 | 3300042001 | Bacteria | 1799 |
| 265 | Ga0450901_005497 | 3300042533 | Bacteria | 1301 |
| 266 | Ga0466963_0328076 | 3300044694 | Bacteria | 1077 |
| 267 | Ga0466960_0322670 | 3300044901 | Bacteria | 875 |
| 268 | Ga0495627_000923 | 3300046453 | Bacteria | 20317 |
| 269 | Ga0495638_0000951 | 3300046460 | Bacteria | 29376 |
| 270 | Ga0495638_0001655 | 3300046460 | Bacteria | 19739 |
| 271 | Ga0495638_0002462 | 3300046460 | Bacteria | 15090 |
| 272 | Ga0495638_0012523 | 3300046460 | Bacteria | 5807 |
| 273 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 274 | Ga0495650_0014492 | 3300046471 | Bacteria | 4098 |
| 275 | Ga0495650_0032075 | 3300046471 | Bacteria | 2354 |
| 276 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 277 | Ga0495606_0009985 | 3300046507 | Bacteria | 7938 |
| 278 | Ga0495610_0000802 | 3300046512 | Bacteria | 29479 |
| 279 | Ga0495610_0002149 | 3300046512 | Bacteria | 16762 |
| 280 | Ga0495610_0009764 | 3300046512 | Bacteria | 6030 |
| 281 | Ga0495628_0177985 | 3300046516 | Bacteria | 1610 |
| 282 | Ga0495631_0004042 | 3300046518 | Bacteria | 7894 |
| 283 | Ga0495632_0006611 | 3300046519 | Bacteria | 7417 |
| 284 | Ga0495632_0146181 | 3300046519 | Bacteria | 1094 |
| 285 | Ga0495637_0004049 | 3300046520 | Bacteria | 7655 |
| 286 | Ga0495648_0000066 | 3300046524 | Bacteria | 140767 |
| 287 | Ga0495648_0013634 | 3300046524 | Bacteria | 5997 |
| 288 | Ga0495648_0178903 | 3300046524 | Bacteria | 1080 |
| 289 | Ga0495642_0001584 | 3300046528 | Bacteria | 9972 |
| 290 | Ga0495654_0000118 | 3300046530 | Bacteria | 88890 |
| 291 | Ga0495645_0062316 | 3300046543 | Bacteria | 2701 |
| 292 | Ga0495622_0018656 | 3300046557 | Bacteria | 3231 |
| 293 | Ga0495633_0001599 | 3300046558 | Bacteria | 17165 |
| 294 | Ga0495668_0000342 | 3300046616 | Bacteria | 61973 |
| 295 | Ga0495668_0029861 | 3300046616 | Bacteria | 3080 |
| 296 | Ga0495668_0036744 | 3300046616 | Bacteria | 2743 |
| 297 | Ga0495668_0050483 | 3300046616 | Bacteria | 2305 |
| 298 | Ga0495668_0072147 | 3300046616 | Bacteria | 1897 |
| 299 | Ga0495611_0009790 | 3300046648 | Bacteria | 4052 |
| 300 | Ga0495625_0000854 | 3300046660 | Bacteria | 41503 |
| 301 | Ga0495625_0012473 | 3300046660 | Bacteria | 6885 |
| 302 | Ga0495625_0014395 | 3300046660 | Bacteria | 6316 |
| 303 | Ga0495625_0036019 | 3300046660 | Bacteria | 3641 |
| 304 | Ga0495625_0048184 | 3300046660 | Bacteria | 3069 |
| 305 | Ga0495625_0053122 | 3300046660 | Bacteria | 2899 |
| 306 | Ga0495625_0062964 | 3300046660 | Bacteria | 2620 |
| 307 | Ga0495625_0159468 | 3300046660 | Bacteria | 1512 |
| 308 | Ga0495625_0220979 | 3300046660 | Bacteria | 1241 |
| 309 | Ga0495659_0045568 | 3300046664 | Bacteria | 1581 |
| 310 | Ga0495599_0246452 | 3300046678 | Bacteria | 1088 |
| 311 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 312 | Ga0495669_0000353 | 3300046684 | Bacteria | 23496 |
| 313 | Ga0495669_0007404 | 3300046684 | Bacteria | 4604 |
| 314 | Ga0495670_0078163 | 3300046691 | Bacteria | 1683 |
| 315 | Ga0495649_0000089 | 3300046694 | Bacteria | 79134 |
| 316 | Ga0495589_0020569 | 3300046794 | Bacteria | 3375 |
| 317 | Ga0495660_0037000 | 3300046810 | Bacteria | 2720 |
| 318 | Ga0495660_0107819 | 3300046810 | Bacteria | 1425 |
| 319 | Ga0495636_0017989 | 3300047318 | Bacteria | 2834 |
| 320 | Ga0495672_0033438 | 3300047320 | Bacteria | 3185 |
| 321 | Ga0495672_0037253 | 3300047320 | Bacteria | 2978 |
| 322 | Ga0495683_0038727 | 3300047323 | Bacteria | 2413 |
| 323 | Ga0495677_0018180 | 3300047445 | Bacteria | 2548 |
| 324 | Ga0495679_003383 | 3300047446 | Bacteria | 7688 |
| 325 | Ga0495673_0000102 | 3300047469 | Bacteria | 173343 |
| 326 | Ga0495673_0000710 | 3300047469 | Bacteria | 32297 |
| 327 | Ga0495673_0005918 | 3300047469 | Bacteria | 7295 |
| 328 | Ga0495686_0000839 | 3300047472 | Bacteria | 39457 |
| 329 | Ga0495686_0003093 | 3300047472 | Bacteria | 14707 |
| 330 | Ga0495686_0004374 | 3300047472 | Bacteria | 11655 |
| 331 | Ga0495686_0018643 | 3300047472 | Bacteria | 4651 |
| 332 | Ga0495686_0063744 | 3300047472 | Bacteria | 2283 |
| 333 | Ga0495686_0102904 | 3300047472 | Bacteria | 1721 |
| 334 | Ga0495593_0021131 | 3300047673 | Bacteria | 3639 |
| 335 | Ga0496100_0456774 | 3300048903 | Bacteria | 980 |
| 336 | Ga0496102_0020538 | 3300048905 | Bacteria | 5836 |
| 337 | Ga0496102_0157360 | 3300048905 | Bacteria | 2136 |
| 338 | Ga0496103_0031900 | 3300048906 | Bacteria | 3214 |
| 339 | Ga0496106_0028640 | 3300048909 | Bacteria | 4149 |
| 340 | Ga0496107_0000131 | 3300048910 | Bacteria | 36633 |
| 341 | Ga0496108_0017861 | 3300048911 | Bacteria | 5802 |
| 342 | Ga0496109_0024302 | 3300048912 | Bacteria | 5386 |
| 343 | Ga0496110_0125028 | 3300048913 | Bacteria | 2320 |
| 344 | Ga0496112_0052358 | 3300048915 | Bacteria | 4006 |
| 345 | Ga0496112_0114898 | 3300048915 | Bacteria | 2662 |
| 346 | Ga0496114_0257740 | 3300048917 | Bacteria | 1535 |
| 347 | Ga0496115_0002138 | 3300048918 | Bacteria | 14127 |
| 348 | Ga0496115_0002497 | 3300048918 | Bacteria | 13220 |
| 349 | Ga0496115_0011156 | 3300048918 | Bacteria | 6732 |
| 350 | Ga0496115_0268057 | 3300048918 | Bacteria | 1403 |
| 351 | Ga0496116_0021619 | 3300048919 | Bacteria | 4844 |
| 352 | Ga0496117_0018025 | 3300048920 | Bacteria | 5874 |
| 353 | Ga0496118_0015375 | 3300048921 | Bacteria | 7087 |
| 354 | Ga0496119_0023907 | 3300048922 | Bacteria | 4317 |
| 355 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 356 | Ga0496121_0006185 | 3300048924 | Bacteria | 15012 |
| 357 | Ga0496121_0184270 | 3300048924 | Bacteria | 1503 |
| 358 | Ga0496122_0004488 | 3300048925 | Bacteria | 17259 |
| 359 | Ga0496123_0003275 | 3300048926 | Bacteria | 18348 |
| 360 | Ga0496124_0012278 | 3300048927 | Bacteria | 8464 |
| 361 | Ga0496125_0002516 | 3300048928 | Bacteria | 23670 |
| 362 | Ga0496125_0043316 | 3300048928 | Bacteria | 3823 |
| 363 | Ga0496126_0001304 | 3300048929 | Bacteria | 39731 |
| 364 | Ga0495678_000558 | 3300049459 | Bacteria | 35734 |
| 365 | Ga0501033_0014073 | 3300049570 | Bacteria | 6084 |
| 366 | Ga0501043_0373914 | 3300049579 | Bacteria | 1080 |
| 367 | Ga0501047_0119071 | 3300049581 | Bacteria | 2523 |
| 368 | Ga0501047_0121608 | 3300049581 | Bacteria | 2492 |
| 369 | Ga0501047_0204388 | 3300049581 | Bacteria | 1835 |
| 370 | Ga0501048_0218427 | 3300049582 | Bacteria | 1352 |
| 371 | Ga0501072_0001474 | 3300049588 | Bacteria | 17632 |
| 372 | Ga0501073_0146081 | 3300049589 | Bacteria | 1639 |
| 373 | Ga0501080_0039302 | 3300049742 | Bacteria | 4416 |
| 374 | Ga0501083_0002355 | 3300049744 | Bacteria | 12943 |
| 375 | nmdc:mga0k408_7317_c1 | 3300050493 | Bacteria | 5897 |
| 376 | nmdc:mga07m45_189688_c1 | 3300050496 | Bacteria | 1195 |
| 377 | nmdc:mga07m45_69490_c1 | 3300050496 | Bacteria | 2002 |
| 378 | nmdc:mga0sz30_6418_c1 | 3300050516 | Bacteria | 4364 |
| 379 | Ga0500635_0000133 | 3300053080 | Bacteria | 42884 |
| 380 | Ga0500578_0000737 | 3300053086 | Bacteria | 38789 |
| 381 | Ga0500578_0130655 | 3300053086 | Bacteria | 1575 |
| 382 | Ga0500643_005318 | 3300053087 | Bacteria | 5570 |
| 383 | Ga0500644_0000084 | 3300053088 | Bacteria | 57829 |
| 384 | Ga0500644_0001419 | 3300053088 | Bacteria | 6366 |
| 385 | Ga0500646_0042612 | 3300053090 | Bacteria | 1283 |
| 386 | Ga0500651_0003759 | 3300053093 | Bacteria | 8368 |
| 387 | Ga0500651_0174963 | 3300053093 | Bacteria | 1277 |
| 388 | Ga0500555_001064 | 3300053103 | Bacteria | 9234 |
| 389 | Ga0500556_0002638 | 3300053104 | Bacteria | 5606 |
| 390 | Ga0500562_001940 | 3300053108 | Bacteria | 5184 |
| 391 | Ga0500562_002822 | 3300053108 | Bacteria | 4330 |
| 392 | Ga0500569_013570 | 3300053109 | Bacteria | 1997 |
| 393 | Ga0500594_0000221 | 3300053118 | Bacteria | 13834 |
| 394 | Ga0500595_006607 | 3300053119 | Bacteria | 4897 |
| 395 | Ga0500608_000187 | 3300053122 | Bacteria | 24884 |
| 396 | Ga0500608_001063 | 3300053122 | Bacteria | 9839 |
| 397 | Ga0500618_002255 | 3300053125 | Bacteria | 7500 |
| 398 | Ga0500642_0024324 | 3300053130 | Bacteria | 2446 |
| 399 | Ga0500642_0053055 | 3300053130 | Bacteria | 1797 |
| 400 | Ga0500655_024543 | 3300053133 | Bacteria | 1142 |
| 401 | Ga0500658_0014910 | 3300053134 | Bacteria | 2880 |
| 402 | Ga0500559_0000212 | 3300053136 | Bacteria | 46705 |
| 403 | Ga0500559_0003398 | 3300053136 | Bacteria | 7842 |
| 404 | Ga0500559_0008444 | 3300053136 | Bacteria | 4512 |
| 405 | Ga0500559_0018941 | 3300053136 | Bacteria | 2908 |
| 406 | Ga0500559_0058687 | 3300053136 | Bacteria | 1712 |
| 407 | Ga0500564_000080 | 3300053138 | Bacteria | 24788 |
| 408 | Ga0500573_0029580 | 3300053140 | Bacteria | 3157 |
| 409 | Ga0500577_0001991 | 3300053142 | Bacteria | 5236 |
| 410 | Ga0500590_004838 | 3300053148 | Bacteria | 6422 |
| 411 | Ga0500616_0066166 | 3300053153 | Bacteria | 1856 |
| 412 | Ga0500619_000501 | 3300053154 | Bacteria | 6809 |
| 413 | Ga0500622_0002814 | 3300053156 | Bacteria | 12208 |
| 414 | Ga0500622_0082362 | 3300053156 | Bacteria | 1609 |
| 415 | Ga0500622_0135390 | 3300053156 | Bacteria | 1180 |
| 416 | Ga0500624_002114 | 3300053157 | Bacteria | 2764 |
| 417 | Ga0500638_061866 | 3300053162 | Bacteria | 1798 |
| 418 | Ga0500636_0003639 | 3300053177 | Bacteria | 8694 |
| 419 | Ga0500637_0029408 | 3300053178 | Bacteria | 3047 |
| 420 | Ga0500625_057543 | 3300053729 | Bacteria | 1776 |
| 421 | Ga0500645_040824 | 3300053730 | Bacteria | 1371 |
| 422 | Ga0500596_001059 | 3300053735 | Bacteria | 5540 |
| 423 | Ga0501082_0002053 | 3300060353 | Bacteria | 17707 |
| 424 | Ga0501082_0006037 | 3300060353 | Bacteria | 10509 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042533 | Ga0450901_005497 | Ga0450901_005497_14_775 | 243 |
| 2 | 3300044901 | Ga0466960_0322670 | Ga0466960_0322670_23_814 | 256 |
| 3 | 3300048912 | Ga0496109_0024302 | Ga0496109_0024302_4572_5351 | 257 |
| 4 | 3300049589 | Ga0501073_0146081 | Ga0501073_0146081_56_961 | 264 |
| 5 | 3300060353 | Ga0501082_0006037 | Ga0501082_0006037_8907_9812 | 265 |
| 6 | 3300039438 | Ga0436360_0483895 | Ga0436360_0483895_337_1137 | 266 |
| 7 | 3300048913 | Ga0496110_0125028 | Ga0496110_0125028_551_1435 | 270 |
| 8 | 3300046524 | Ga0495648_0178903 | Ga0495648_0178903_18_917 | 271 |
| 9 | 3300046616 | Ga0495668_0050483 | Ga0495668_0050483_394_1293 | 271 |
| 10 | 3300046660 | Ga0495625_0036019 | Ga0495625_0036019_1464_2363 | 271 |
| 11 | 3300046660 | Ga0495625_0220979 | Ga0495625_0220979_239_1138 | 271 |
| 12 | 3300050496 | nmdc:mga07m45_189688_c1 | nmdc:mga07m45_189688_c1_22_921 | 271 |
| 13 | 3300053156 | Ga0500622_0082362 | Ga0500622_0082362_376_1275 | 271 |
| 14 | 3300025949 | Ga0207667_10643135 | Ga0207667_106431352 | 272 |
| 15 | 3300048917 | Ga0496114_0257740 | Ga0496114_0257740_302_1231 | 272 |
| 16 | 3300049582 | Ga0501048_0218427 | Ga0501048_0218427_359_1273 | 272 |
| 17 | 3300003781 | Ga0055536_1015837 | Ga0055536_10158373 | 273 |
| 18 | 3300006195 | Ga0075366_10017266 | Ga0075366_100172662 | 273 |
| 19 | 3300025292 | Ga0209676_1005154 | Ga0209676_10051544 | 273 |
| 20 | 3300025295 | Ga0209564_1024212 | Ga0209564_10242123 | 273 |
| 21 | 3300046660 | Ga0495625_0053122 | Ga0495625_0053122_1663_2562 | 273 |
| 22 | 3300050493 | nmdc:mga0k408_7317_c1 | nmdc:mga0k408_7317_c1_3022_3936 | 273 |
| 23 | 3300005548 | Ga0070665_100709724 | Ga0070665_1007097241 | 275 |
| 24 | 3300005547 | Ga0070693_100192798 | Ga0070693_1001927982 | 276 |
| 25 | 3300039437 | Ga0436365_0966433 | Ga0436365_0966433_1930_2832 | 277 |
| 26 | 3300053088 | Ga0500644_0001419 | Ga0500644_0001419_2360_3280 | 277 |
| 27 | 3300053093 | Ga0500651_0174963 | Ga0500651_0174963_159_1079 | 277 |
| 28 | 3300003781 | Ga0055536_1001011 | Ga0055536_100101118 | 280 |
| 29 | 3300003781 | Ga0055536_1001362 | Ga0055536_100136212 | 280 |
| 30 | 3300025292 | Ga0209676_1000213 | Ga0209676_1000213118 | 280 |
| 31 | 3300025298 | Ga0209050_1003548 | Ga0209050_100354810 | 280 |
| 32 | 3300025304 | Ga0209257_1000757 | Ga0209257_100075712 | 280 |
| 33 | 3300053156 | Ga0500622_0135390 | Ga0500622_0135390_207_1109 | 280 |
| 34 | 3300025250 | Ga0209026_1010478 | Ga0209026_10104782 | 281 |
| 35 | 3300046460 | Ga0495638_0000951 | Ga0495638_0000951_13866_14768 | 281 |
| 36 | 3300048903 | Ga0496100_0456774 | Ga0496100_0456774_43_942 | 283 |
| 37 | 3300053119 | Ga0500595_006607 | Ga0500595_006607_1225_2136 | 284 |
| 38 | 3300032004 | Ga0307414_10040479 | Ga0307414_100404792 | 287 |
| 39 | 3300053140 | Ga0500573_0029580 | Ga0500573_0029580_2048_2965 | 293 |
| 40 | 3300032005 | Ga0307411_10433781 | Ga0307411_104337812 | 294 |
| 41 | 3300049588 | Ga0501072_0001474 | Ga0501072_0001474_6064_6981 | 294 |
| 42 | 3300049742 | Ga0501080_0039302 | Ga0501080_0039302_2215_3132 | 294 |
| 43 | 3300049744 | Ga0501083_0002355 | Ga0501083_0002355_4571_5488 | 294 |
| 44 | 3300053130 | Ga0500642_0024324 | Ga0500642_0024324_1379_2272 | 294 |
| 45 | 3300060353 | Ga0501082_0002053 | Ga0501082_0002053_5913_6830 | 294 |
| 46 | iso_pu_bacteria | 2643221614 | 2644087047 | 294 |
| 47 | iso_pu_bacteria | 2643221661 | 2644342001 | 294 |
| 48 | iso_pu_bacteria | 2643221666 | 2644368288 | 294 |
| 49 | iso_pu_bacteria | 2510917020 | 2511121125 | 295 |
| 50 | iso_pu_bacteria | 2582581279 | 2585148034 | 295 |
| 51 | iso_pu_bacteria | 2582581280 | 2585153931 | 295 |
| 52 | iso_pu_bacteria | 2582581293 | 2585194924 | 295 |
| 53 | iso_pu_bacteria | 2585428106 | 2587915351 | 295 |
| 54 | iso_pu_bacteria | 2643221545 | 2643747279 | 295 |
| 55 | iso_pu_bacteria | 2643221574 | 2643882524 | 295 |
| 56 | iso_pu_bacteria | 2643221583 | 2643924529 | 295 |
| 57 | iso_pu_bacteria | 2643221584 | 2643929935 | 295 |
| 58 | iso_pu_bacteria | 2643221598 | 2643998926 | 295 |
| 59 | iso_pu_bacteria | 2643221640 | 2644223906 | 295 |
| 60 | iso_pu_bacteria | 2643221642 | 2644232892 | 295 |
| 61 | iso_pu_bacteria | 2643221663 | 2644353476 | 295 |
| 62 | iso_pu_bacteria | 2643221691 | 2644507523 | 295 |
| 63 | iso_pu_bacteria | 2643221699 | 2644549523 | 295 |
| 64 | iso_pu_bacteria | 2643221699 | 2644550574 | 295 |
| 65 | iso_pu_bacteria | 2791355048 | 2792458856 | 295 |
| 66 | iso_pu_bacteria | 2818991435 | 2819540451 | 295 |
| 67 | iso_pu_bacteria | 2818991454 | 2819649433 | 295 |
| 68 | iso_pu_bacteria | 2843744320 | 2843745791 | 295 |
| 69 | iso_pu_bacteria | 2849560528 | 2849562296 | 295 |
| 70 | iso_pu_bacteria | 2849573788 | 2849577217 | 295 |
| 71 | iso_pu_bacteria | 2851153111 | 2851153203 | 295 |
| 72 | iso_pu_bacteria | 2857504554 | 2857508048 | 295 |
| 73 | iso_pu_bacteria | 2884960567 | 2884963139 | 295 |
| 74 | iso_pu_bacteria | 2898329390 | 2898330400 | 295 |
| 75 | iso_pu_bacteria | 2928531327 | 2928534797 | 295 |
| 76 | iso_pu_bacteria | 2928972540 | 2928973460 | 295 |
| 77 | iso_pu_bacteria | 2941485952 | 2941486141 | 295 |
| 78 | iso_pu_bacteria | 2977240413 | 2977240561 | 295 |
| 79 | 3300003215 | JGI25153J46596_10045067 | JGI25153J46596_100450671 | 298 |
| 80 | 3300003791 | Ga0055530_10001080 | Ga0055530_1000108021 | 298 |
| 81 | 3300005262 | Ga0065165_1000264 | Ga0065165_10002646 | 298 |
| 82 | 3300005563 | Ga0068855_100038442 | Ga0068855_1000384423 | 298 |
| 83 | 3300009093 | Ga0105240_10014687 | Ga0105240_100146872 | 298 |
| 84 | 3300009551 | Ga0105238_10010208 | Ga0105238_100102082 | 298 |
| 85 | 3300013100 | Ga0157373_10010029 | Ga0157373_100100296 | 298 |
| 86 | 3300021361 | Ga0213872_10048638 | Ga0213872_100486383 | 298 |
| 87 | 3300025297 | Ga0209758_1002447 | Ga0209758_100244712 | 298 |
| 88 | 3300025298 | Ga0209050_1001753 | Ga0209050_10017534 | 298 |
| 89 | 3300025304 | Ga0209257_1000125 | Ga0209257_100012521 | 298 |
| 90 | 3300025304 | Ga0209257_1002416 | Ga0209257_10024163 | 298 |
| 91 | 3300025924 | Ga0207694_10005922 | Ga0207694_100059222 | 298 |
| 92 | 3300025949 | Ga0207667_10091845 | Ga0207667_100918452 | 298 |
| 93 | 3300026041 | Ga0207639_10055804 | Ga0207639_100558042 | 298 |
| 94 | 3300026041 | Ga0207639_10551417 | Ga0207639_105514171 | 298 |
| 95 | 3300035691 | Ga0373931_0153354 | Ga0373931_0153354_296_1195 | 298 |
| 96 | 3300037471 | Ga0395905_0262364 | Ga0395905_0262364_622_1542 | 298 |
| 97 | 3300039447 | Ga0436361_0323660 | Ga0436361_0323660_3396_4292 | 298 |
| 98 | 3300046616 | Ga0495668_0029861 | Ga0495668_0029861_736_1653 | 298 |
| 99 | 3300046616 | Ga0495668_0072147 | Ga0495668_0072147_476_1378 | 298 |
| 100 | 3300047472 | Ga0495686_0004374 | Ga0495686_0004374_8196_9107 | 298 |
| 101 | 3300049570 | Ga0501033_0014073 | Ga0501033_0014073_32_940 | 298 |
| 102 | 3300049581 | Ga0501047_0204388 | Ga0501047_0204388_48_944 | 298 |
| 103 | 3300053108 | Ga0500562_001940 | Ga0500562_001940_3574_4470 | 298 |
| 104 | 3300003215 | JGI25153J46596_10024978 | JGI25153J46596_100249782 | 299 |
| 105 | 3300003316 | rootH1_10081374 | rootH1_100813742 | 299 |
| 106 | 3300003578 | Ga0006562J51391_1084114 | Ga0006562J51391_10841143 | 299 |
| 107 | 3300003578 | Ga0006562J51391_1084116 | Ga0006562J51391_10841161 | 299 |
| 108 | 3300003775 | Ga0055524_1006227 | Ga0055524_10062274 | 299 |
| 109 | 3300003781 | Ga0055536_1002645 | Ga0055536_10026456 | 299 |
| 110 | 3300003781 | Ga0055536_1002964 | Ga0055536_10029644 | 299 |
| 111 | 3300003790 | Ga0055528_1003679 | Ga0055528_10036799 | 299 |
| 112 | 3300003791 | Ga0055530_10003058 | Ga0055530_100030585 | 299 |
| 113 | 3300003794 | Ga0055531_10002770 | Ga0055531_100027706 | 299 |
| 114 | 3300005262 | Ga0065165_1001205 | Ga0065165_100120521 | 299 |
| 115 | 3300005331 | Ga0070670_100000013 | Ga0070670_10000001310 | 299 |
| 116 | 3300005331 | Ga0070670_100009610 | Ga0070670_10000961011 | 299 |
| 117 | 3300005336 | Ga0070680_100023814 | Ga0070680_1000238145 | 299 |
| 118 | 3300005336 | Ga0070680_100228410 | Ga0070680_1002284102 | 299 |
| 119 | 3300005339 | Ga0070660_100246796 | Ga0070660_1002467962 | 299 |
| 120 | 3300005344 | Ga0070661_100360119 | Ga0070661_1003601192 | 299 |
| 121 | 3300005347 | Ga0070668_100000042 | Ga0070668_10000004266 | 299 |
| 122 | 3300005347 | Ga0070668_100000707 | Ga0070668_10000070714 | 299 |
| 123 | 3300005347 | Ga0070668_100005345 | Ga0070668_10000534510 | 299 |
| 124 | 3300005347 | Ga0070668_100007523 | Ga0070668_1000075232 | 299 |
| 125 | 3300005347 | Ga0070668_100009879 | Ga0070668_1000098799 | 299 |
| 126 | 3300005355 | Ga0070671_100084419 | Ga0070671_1000844193 | 299 |
| 127 | 3300005366 | Ga0070659_100000428 | Ga0070659_10000042826 | 299 |
| 128 | 3300005366 | Ga0070659_100001301 | Ga0070659_1000013016 | 299 |
| 129 | 3300005366 | Ga0070659_100067459 | Ga0070659_1000674592 | 299 |
| 130 | 3300005367 | Ga0070667_100000168 | Ga0070667_10000016824 | 299 |
| 131 | 3300005367 | Ga0070667_100001255 | Ga0070667_1000012553 | 299 |
| 132 | 3300005367 | Ga0070667_100003824 | Ga0070667_10000382412 | 299 |
| 133 | 3300005455 | Ga0070663_100038077 | Ga0070663_1000380772 | 299 |
| 134 | 3300005456 | Ga0070678_100195914 | Ga0070678_1001959142 | 299 |
| 135 | 3300005457 | Ga0070662_100057789 | Ga0070662_1000577892 | 299 |
| 136 | 3300005458 | Ga0070681_10011298 | Ga0070681_100112988 | 299 |
| 137 | 3300005458 | Ga0070681_10117505 | Ga0070681_101175052 | 299 |
| 138 | 3300005458 | Ga0070681_10192454 | Ga0070681_101924541 | 299 |
| 139 | 3300005530 | Ga0070679_100000858 | Ga0070679_1000008589 | 299 |
| 140 | 3300005530 | Ga0070679_100013292 | Ga0070679_1000132924 | 299 |
| 141 | 3300005539 | Ga0068853_100033140 | Ga0068853_1000331402 | 299 |
| 142 | 3300005539 | Ga0068853_100048684 | Ga0068853_1000486842 | 299 |
| 143 | 3300005539 | Ga0068853_100121869 | Ga0068853_1001218692 | 299 |
| 144 | 3300005539 | Ga0068853_100194710 | Ga0068853_1001947102 | 299 |
| 145 | 3300005548 | Ga0070665_100000363 | Ga0070665_10000036348 | 299 |
| 146 | 3300005548 | Ga0070665_100000593 | Ga0070665_10000059331 | 299 |
| 147 | 3300005548 | Ga0070665_100035716 | Ga0070665_1000357163 | 299 |
| 148 | 3300005563 | Ga0068855_100009421 | Ga0068855_1000094218 | 299 |
| 149 | 3300005563 | Ga0068855_100029587 | Ga0068855_1000295873 | 299 |
| 150 | 3300005563 | Ga0068855_100152342 | Ga0068855_1001523422 | 299 |
| 151 | 3300005577 | Ga0068857_100288394 | Ga0068857_1002883942 | 299 |
| 152 | 3300005614 | Ga0068856_100373172 | Ga0068856_1003731722 | 299 |
| 153 | 3300005614 | Ga0068856_100443989 | Ga0068856_1004439892 | 299 |
| 154 | 3300005618 | Ga0068864_100000135 | Ga0068864_10000013540 | 299 |
| 155 | 3300005618 | Ga0068864_100004585 | Ga0068864_1000045857 | 299 |
| 156 | 3300005719 | Ga0068861_100417565 | Ga0068861_1004175651 | 299 |
| 157 | 3300005841 | Ga0068863_100000735 | Ga0068863_10000073519 | 299 |
| 158 | 3300005841 | Ga0068863_100003449 | Ga0068863_10000344914 | 299 |
| 159 | 3300005841 | Ga0068863_100302201 | Ga0068863_1003022012 | 299 |
| 160 | 3300005841 | Ga0068863_100539567 | Ga0068863_1005395671 | 299 |
| 161 | 3300005842 | Ga0068858_100000020 | Ga0068858_10000002089 | 299 |
| 162 | 3300005842 | Ga0068858_100006409 | Ga0068858_1000064096 | 299 |
| 163 | 3300005842 | Ga0068858_100155985 | Ga0068858_1001559852 | 299 |
| 164 | 3300005843 | Ga0068860_100000133 | Ga0068860_10000013353 | 299 |
| 165 | 3300005843 | Ga0068860_100000382 | Ga0068860_10000038246 | 299 |
| 166 | 3300005843 | Ga0068860_100022661 | Ga0068860_1000226612 | 299 |
| 167 | 3300005844 | Ga0068862_100000463 | Ga0068862_10000046336 | 299 |
| 168 | 3300005844 | Ga0068862_100017278 | Ga0068862_1000172786 | 299 |
| 169 | 3300005844 | Ga0068862_100017936 | Ga0068862_1000179365 | 299 |
| 170 | 3300006353 | Ga0075370_10059242 | Ga0075370_100592422 | 299 |
| 171 | 3300006881 | Ga0068865_100001019 | Ga0068865_1000010199 | 299 |
| 172 | 3300006946 | Ga0079104_1012955 | Ga0079104_10129553 | 299 |
| 173 | 3300009092 | Ga0105250_10008707 | Ga0105250_100087072 | 299 |
| 174 | 3300009093 | Ga0105240_10015807 | Ga0105240_100158075 | 299 |
| 175 | 3300009093 | Ga0105240_10071922 | Ga0105240_100719222 | 299 |
| 176 | 3300009093 | Ga0105240_10393733 | Ga0105240_103937332 | 299 |
| 177 | 3300009101 | Ga0105247_10108210 | Ga0105247_101082102 | 299 |
| 178 | 3300009177 | Ga0105248_10000305 | Ga0105248_1000030524 | 299 |
| 179 | 3300009177 | Ga0105248_10007895 | Ga0105248_100078958 | 299 |
| 180 | 3300009177 | Ga0105248_10044159 | Ga0105248_100441592 | 299 |
| 181 | 3300009177 | Ga0105248_10115539 | Ga0105248_101155393 | 299 |
| 182 | 3300009177 | Ga0105248_10249898 | Ga0105248_102498981 | 299 |
| 183 | 3300009177 | Ga0105248_10376092 | Ga0105248_103760922 | 299 |
| 184 | 3300009551 | Ga0105238_10062344 | Ga0105238_100623442 | 299 |
| 185 | 3300009551 | Ga0105238_10071800 | Ga0105238_100718003 | 299 |
| 186 | 3300009551 | Ga0105238_10107471 | Ga0105238_101074712 | 299 |
| 187 | 3300009551 | Ga0105238_10390454 | Ga0105238_103904542 | 299 |
| 188 | 3300009553 | Ga0105249_10000610 | Ga0105249_1000061026 | 299 |
| 189 | 3300009553 | Ga0105249_10158178 | Ga0105249_101581782 | 299 |
| 190 | 3300013100 | Ga0157373_10011866 | Ga0157373_100118664 | 299 |
| 191 | 3300013102 | Ga0157371_10268736 | Ga0157371_102687362 | 299 |
| 192 | 3300013104 | Ga0157370_10013802 | Ga0157370_100138029 | 299 |
| 193 | 3300013104 | Ga0157370_10305478 | Ga0157370_103054782 | 299 |
| 194 | 3300013105 | Ga0157369_10002971 | Ga0157369_100029718 | 299 |
| 195 | 3300014325 | Ga0163163_10019624 | Ga0163163_100196246 | 299 |
| 196 | 3300014325 | Ga0163163_10034972 | Ga0163163_100349725 | 299 |
| 197 | 3300014325 | Ga0163163_10076982 | Ga0163163_100769822 | 299 |
| 198 | 3300014325 | Ga0163163_10119452 | Ga0163163_101194522 | 299 |
| 199 | 3300014325 | Ga0163163_10254132 | Ga0163163_102541322 | 299 |
| 200 | 3300014968 | Ga0157379_10032873 | Ga0157379_100328733 | 299 |
| 201 | 3300014968 | Ga0157379_10113097 | Ga0157379_101130971 | 299 |
| 202 | 3300017792 | Ga0163161_10248513 | Ga0163161_102485132 | 299 |
| 203 | 3300021377 | Ga0213874_10060618 | Ga0213874_100606182 | 299 |
| 204 | 3300021384 | Ga0213876_10000081 | Ga0213876_100000818 | 299 |
| 205 | 3300025263 | Ga0209565_1000395 | Ga0209565_100039529 | 299 |
| 206 | 3300025273 | Ga0209673_1010662 | Ga0209673_10106624 | 299 |
| 207 | 3300025292 | Ga0209676_1000467 | Ga0209676_100046742 | 299 |
| 208 | 3300025292 | Ga0209676_1000560 | Ga0209676_100056039 | 299 |
| 209 | 3300025295 | Ga0209564_1001381 | Ga0209564_100138116 | 299 |
| 210 | 3300025295 | Ga0209564_1017524 | Ga0209564_10175242 | 299 |
| 211 | 3300025297 | Ga0209758_1001633 | Ga0209758_100163316 | 299 |
| 212 | 3300025297 | Ga0209758_1005737 | Ga0209758_10057375 | 299 |
| 213 | 3300025298 | Ga0209050_1000461 | Ga0209050_100046129 | 299 |
| 214 | 3300025298 | Ga0209050_1002433 | Ga0209050_100243315 | 299 |
| 215 | 3300025299 | Ga0209256_1003362 | Ga0209256_10033629 | 299 |
| 216 | 3300025299 | Ga0209256_1005306 | Ga0209256_10053065 | 299 |
| 217 | 3300025304 | Ga0209257_1000246 | Ga0209257_10002464 | 299 |
| 218 | 3300025304 | Ga0209257_1000427 | Ga0209257_100042720 | 299 |
| 219 | 3300025304 | Ga0209257_1012142 | Ga0209257_10121422 | 299 |
| 220 | 3300025711 | Ga0207696_1030365 | Ga0207696_10303652 | 299 |
| 221 | 3300025903 | Ga0207680_10027022 | Ga0207680_100270222 | 299 |
| 222 | 3300025909 | Ga0207705_10000556 | Ga0207705_1000055617 | 299 |
| 223 | 3300025912 | Ga0207707_10021552 | Ga0207707_100215523 | 299 |
| 224 | 3300025912 | Ga0207707_10056462 | Ga0207707_100564623 | 299 |
| 225 | 3300025913 | Ga0207695_10001235 | Ga0207695_1000123520 | 299 |
| 226 | 3300025913 | Ga0207695_10002484 | Ga0207695_1000248420 | 299 |
| 227 | 3300025913 | Ga0207695_10012530 | Ga0207695_100125305 | 299 |
| 228 | 3300025913 | Ga0207695_10050413 | Ga0207695_100504134 | 299 |
| 229 | 3300025913 | Ga0207695_10364594 | Ga0207695_103645942 | 299 |
| 230 | 3300025917 | Ga0207660_10000773 | Ga0207660_100007732 | 299 |
| 231 | 3300025919 | Ga0207657_10000693 | Ga0207657_1000069318 | 299 |
| 232 | 3300025919 | Ga0207657_10031284 | Ga0207657_100312842 | 299 |
| 233 | 3300025919 | Ga0207657_10057625 | Ga0207657_100576253 | 299 |
| 234 | 3300025919 | Ga0207657_10216388 | Ga0207657_102163882 | 299 |
| 235 | 3300025921 | Ga0207652_10019459 | Ga0207652_100194594 | 299 |
| 236 | 3300025923 | Ga0207681_10297952 | Ga0207681_102979522 | 299 |
| 237 | 3300025924 | Ga0207694_10133088 | Ga0207694_101330882 | 299 |
| 238 | 3300025925 | Ga0207650_10000016 | Ga0207650_10000016197 | 299 |
| 239 | 3300025931 | Ga0207644_10514682 | Ga0207644_105146821 | 299 |
| 240 | 3300025932 | Ga0207690_10000373 | Ga0207690_1000037324 | 299 |
| 241 | 3300025932 | Ga0207690_10006047 | Ga0207690_100060478 | 299 |
| 242 | 3300025933 | Ga0207706_10062893 | Ga0207706_100628933 | 299 |
| 243 | 3300025938 | Ga0207704_10002498 | Ga0207704_100024986 | 299 |
| 244 | 3300025941 | Ga0207711_10000160 | Ga0207711_1000016052 | 299 |
| 245 | 3300025941 | Ga0207711_10019133 | Ga0207711_100191336 | 299 |
| 246 | 3300025941 | Ga0207711_10025271 | Ga0207711_100252714 | 299 |
| 247 | 3300025941 | Ga0207711_10069290 | Ga0207711_100692902 | 299 |
| 248 | 3300025945 | Ga0207679_10116834 | Ga0207679_101168342 | 299 |
| 249 | 3300025949 | Ga0207667_10006652 | Ga0207667_100066523 | 299 |
| 250 | 3300025949 | Ga0207667_10045108 | Ga0207667_100451082 | 299 |
| 251 | 3300025949 | Ga0207667_10122271 | Ga0207667_101222712 | 299 |
| 252 | 3300025949 | Ga0207667_10238422 | Ga0207667_102384222 | 299 |
| 253 | 3300025961 | Ga0207712_10000641 | Ga0207712_1000064121 | 299 |
| 254 | 3300025961 | Ga0207712_10231955 | Ga0207712_102319552 | 299 |
| 255 | 3300025972 | Ga0207668_10000002 | Ga0207668_10000002101 | 299 |
| 256 | 3300025972 | Ga0207668_10000401 | Ga0207668_1000040115 | 299 |
| 257 | 3300025972 | Ga0207668_10001930 | Ga0207668_1000193015 | 299 |
| 258 | 3300025972 | Ga0207668_10022346 | Ga0207668_100223462 | 299 |
| 259 | 3300025972 | Ga0207668_10246916 | Ga0207668_102469162 | 299 |
| 260 | 3300025986 | Ga0207658_10000399 | Ga0207658_1000039917 | 299 |
| 261 | 3300025986 | Ga0207658_10003349 | Ga0207658_1000334912 | 299 |
| 262 | 3300025986 | Ga0207658_10009133 | Ga0207658_100091333 | 299 |
| 263 | 3300026035 | Ga0207703_10000082 | Ga0207703_1000008229 | 299 |
| 264 | 3300026035 | Ga0207703_10018799 | Ga0207703_100187994 | 299 |
| 265 | 3300026035 | Ga0207703_10104196 | Ga0207703_101041962 | 299 |
| 266 | 3300026041 | Ga0207639_10031860 | Ga0207639_100318602 | 299 |
| 267 | 3300026041 | Ga0207639_10146673 | Ga0207639_101466731 | 299 |
| 268 | 3300026078 | Ga0207702_10069163 | Ga0207702_100691633 | 299 |
| 269 | 3300026078 | Ga0207702_10105626 | Ga0207702_101056262 | 299 |
| 270 | 3300026088 | Ga0207641_10000007 | Ga0207641_1000000774 | 299 |
| 271 | 3300026088 | Ga0207641_10001614 | Ga0207641_1000161417 | 299 |
| 272 | 3300026088 | Ga0207641_10034834 | Ga0207641_100348343 | 299 |
| 273 | 3300026088 | Ga0207641_10499341 | Ga0207641_104993412 | 299 |
| 274 | 3300026095 | Ga0207676_10000191 | Ga0207676_100001918 | 299 |
| 275 | 3300026095 | Ga0207676_10000618 | Ga0207676_1000061812 | 299 |
| 276 | 3300026095 | Ga0207676_10004212 | Ga0207676_100042124 | 299 |
| 277 | 3300026095 | Ga0207676_10114800 | Ga0207676_101148003 | 299 |
| 278 | 3300026118 | Ga0207675_100156846 | Ga0207675_1001568463 | 299 |
| 279 | 3300026118 | Ga0207675_100453083 | Ga0207675_1004530831 | 299 |
| 280 | 3300027378 | Ga0209981_1000327 | Ga0209981_10003273 | 299 |
| 281 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003808 | 299 |
| 282 | 3300028379 | Ga0268266_10026031 | Ga0268266_100260313 | 299 |
| 283 | 3300028379 | Ga0268266_10163474 | Ga0268266_101634742 | 299 |
| 284 | 3300028380 | Ga0268265_10000836 | Ga0268265_1000083622 | 299 |
| 285 | 3300028380 | Ga0268265_10007741 | Ga0268265_100077412 | 299 |
| 286 | 3300028380 | Ga0268265_10043600 | Ga0268265_100436003 | 299 |
| 287 | 3300028380 | Ga0268265_10049357 | Ga0268265_100493573 | 299 |
| 288 | 3300028380 | Ga0268265_10065960 | Ga0268265_100659602 | 299 |
| 289 | 3300028381 | Ga0268264_10000008 | Ga0268264_10000008303 | 299 |
| 290 | 3300028381 | Ga0268264_10000207 | Ga0268264_10000207117 | 299 |
| 291 | 3300028381 | Ga0268264_10010210 | Ga0268264_100102103 | 299 |
| 292 | 3300028786 | Ga0307517_10019757 | Ga0307517_100197571 | 299 |
| 293 | 3300028786 | Ga0307517_10053033 | Ga0307517_100530332 | 299 |
| 294 | 3300028794 | Ga0307515_10016020 | Ga0307515_1001602016 | 299 |
| 295 | 3300028800 | Ga0265338_10009658 | Ga0265338_100096586 | 299 |
| 296 | 3300028800 | Ga0265338_10066774 | Ga0265338_100667742 | 299 |
| 297 | 3300028800 | Ga0265338_10247495 | Ga0265338_102474952 | 299 |
| 298 | 3300031250 | Ga0265331_10106196 | Ga0265331_101061961 | 299 |
| 299 | 3300031251 | Ga0265327_10000130 | Ga0265327_1000013043 | 299 |
| 300 | 3300031251 | Ga0265327_10003358 | Ga0265327_1000335812 | 299 |
| 301 | 3300031456 | Ga0307513_10000077 | Ga0307513_1000007782 | 299 |
| 302 | 3300031456 | Ga0307513_10002125 | Ga0307513_1000212525 | 299 |
| 303 | 3300031456 | Ga0307513_10007717 | Ga0307513_1000771715 | 299 |
| 304 | 3300031456 | Ga0307513_10009525 | Ga0307513_100095256 | 299 |
| 305 | 3300031711 | Ga0265314_10015084 | Ga0265314_100150842 | 299 |
| 306 | 3300031711 | Ga0265314_10118803 | Ga0265314_101188032 | 299 |
| 307 | 3300031730 | Ga0307516_10000001 | Ga0307516_10000001273 | 299 |
| 308 | 3300031911 | Ga0307412_10004253 | Ga0307412_100042534 | 299 |
| 309 | 3300031995 | Ga0307409_100299140 | Ga0307409_1002991402 | 299 |
| 310 | 3300032004 | Ga0307414_10036037 | Ga0307414_100360372 | 299 |
| 311 | 3300032004 | Ga0307414_10067123 | Ga0307414_100671232 | 299 |
| 312 | 3300032004 | Ga0307414_10341769 | Ga0307414_103417692 | 299 |
| 313 | 3300032005 | Ga0307411_10044622 | Ga0307411_100446222 | 299 |
| 314 | 3300035113 | Ga0373936_0015842 | Ga0373936_0015842_980_1879 | 299 |
| 315 | 3300035170 | Ga0373943_0142122 | Ga0373943_0142122_117_1031 | 299 |
| 316 | 3300035171 | Ga0373946_0024823 | Ga0373946_0024823_125_1039 | 299 |
| 317 | 3300035695 | Ga0373927_0003482 | Ga0373927_0003482_3855_4769 | 299 |
| 318 | 3300037068 | Ga0373925_0000257 | Ga0373925_0000257_2801_3715 | 299 |
| 319 | 3300037418 | Ga0395900_0012117 | Ga0395900_0012117_553_1458 | 299 |
| 320 | 3300037418 | Ga0395900_0371997 | Ga0395900_0371997_52_972 | 299 |
| 321 | 3300037466 | Ga0395898_0008282 | Ga0395898_0008282_10046_10966 | 299 |
| 322 | 3300037466 | Ga0395898_0265474 | Ga0395898_0265474_371_1276 | 299 |
| 323 | 3300037471 | Ga0395905_0005670 | Ga0395905_0005670_6089_6994 | 299 |
| 324 | 3300037471 | Ga0395905_0020042 | Ga0395905_0020042_751_1656 | 299 |
| 325 | 3300037471 | Ga0395905_0102098 | Ga0395905_0102098_1572_2477 | 299 |
| 326 | 3300038443 | Ga0395901_0001358 | Ga0395901_0001358_6673_7593 | 299 |
| 327 | 3300039437 | Ga0436365_0330659 | Ga0436365_0330659_4899_5798 | 299 |
| 328 | 3300039437 | Ga0436365_1275470 | Ga0436365_1275470_50_967 | 299 |
| 329 | 3300039437 | Ga0436365_1469960 | Ga0436365_1469960_48_956 | 299 |
| 330 | 3300039450 | Ga0436363_0052288 | Ga0436363_0052288_69_968 | 299 |
| 331 | 3300042001 | Ga0439441_007053 | Ga0439441_007053_771_1673 | 299 |
| 332 | 3300044694 | Ga0466963_0328076 | Ga0466963_0328076_17_985 | 299 |
| 333 | 3300046453 | Ga0495627_000923 | Ga0495627_000923_14731_15630 | 299 |
| 334 | 3300046460 | Ga0495638_0001655 | Ga0495638_0001655_13706_14605 | 299 |
| 335 | 3300046460 | Ga0495638_0002462 | Ga0495638_0002462_7219_8118 | 299 |
| 336 | 3300046460 | Ga0495638_0012523 | Ga0495638_0012523_3545_4444 | 299 |
| 337 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_186542_187441 | 299 |
| 338 | 3300046471 | Ga0495650_0014492 | Ga0495650_0014492_2363_3262 | 299 |
| 339 | 3300046471 | Ga0495650_0032075 | Ga0495650_0032075_1202_2110 | 299 |
| 340 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_78273_79172 | 299 |
| 341 | 3300046507 | Ga0495606_0009985 | Ga0495606_0009985_3554_4456 | 299 |
| 342 | 3300046512 | Ga0495610_0000802 | Ga0495610_0000802_2811_3710 | 299 |
| 343 | 3300046512 | Ga0495610_0002149 | Ga0495610_0002149_1759_2661 | 299 |
| 344 | 3300046512 | Ga0495610_0009764 | Ga0495610_0009764_3424_4323 | 299 |
| 345 | 3300046516 | Ga0495628_0177985 | Ga0495628_0177985_263_1174 | 299 |
| 346 | 3300046518 | Ga0495631_0004042 | Ga0495631_0004042_2407_3306 | 299 |
| 347 | 3300046519 | Ga0495632_0006611 | Ga0495632_0006611_4853_5752 | 299 |
| 348 | 3300046519 | Ga0495632_0146181 | Ga0495632_0146181_80_988 | 299 |
| 349 | 3300046520 | Ga0495637_0004049 | Ga0495637_0004049_6575_7477 | 299 |
| 350 | 3300046524 | Ga0495648_0000066 | Ga0495648_0000066_68655_69554 | 299 |
| 351 | 3300046524 | Ga0495648_0013634 | Ga0495648_0013634_2805_3704 | 299 |
| 352 | 3300046528 | Ga0495642_0001584 | Ga0495642_0001584_4890_5795 | 299 |
| 353 | 3300046530 | Ga0495654_0000118 | Ga0495654_0000118_48054_48953 | 299 |
| 354 | 3300046543 | Ga0495645_0062316 | Ga0495645_0062316_613_1524 | 299 |
| 355 | 3300046557 | Ga0495622_0018656 | Ga0495622_0018656_932_1840 | 299 |
| 356 | 3300046558 | Ga0495633_0001599 | Ga0495633_0001599_6698_7612 | 299 |
| 357 | 3300046616 | Ga0495668_0000342 | Ga0495668_0000342_38523_39422 | 299 |
| 358 | 3300046616 | Ga0495668_0036744 | Ga0495668_0036744_420_1328 | 299 |
| 359 | 3300046648 | Ga0495611_0009790 | Ga0495611_0009790_2751_3650 | 299 |
| 360 | 3300046660 | Ga0495625_0000854 | Ga0495625_0000854_2822_3721 | 299 |
| 361 | 3300046660 | Ga0495625_0012473 | Ga0495625_0012473_2915_3817 | 299 |
| 362 | 3300046660 | Ga0495625_0014395 | Ga0495625_0014395_2697_3596 | 299 |
| 363 | 3300046660 | Ga0495625_0048184 | Ga0495625_0048184_1386_2285 | 299 |
| 364 | 3300046660 | Ga0495625_0062964 | Ga0495625_0062964_1144_2043 | 299 |
| 365 | 3300046660 | Ga0495625_0159468 | Ga0495625_0159468_467_1375 | 299 |
| 366 | 3300046664 | Ga0495659_0045568 | Ga0495659_0045568_13_912 | 299 |
| 367 | 3300046678 | Ga0495599_0246452 | Ga0495599_0246452_117_1028 | 299 |
| 368 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_255927_256835 | 299 |
| 369 | 3300046684 | Ga0495669_0000353 | Ga0495669_0000353_15279_16184 | 299 |
| 370 | 3300046684 | Ga0495669_0007404 | Ga0495669_0007404_1221_2129 | 299 |
| 371 | 3300046691 | Ga0495670_0078163 | Ga0495670_0078163_35_934 | 299 |
| 372 | 3300046694 | Ga0495649_0000089 | Ga0495649_0000089_74042_74959 | 299 |
| 373 | 3300046794 | Ga0495589_0020569 | Ga0495589_0020569_1509_2408 | 299 |
| 374 | 3300046810 | Ga0495660_0037000 | Ga0495660_0037000_1420_2322 | 299 |
| 375 | 3300046810 | Ga0495660_0107819 | Ga0495660_0107819_393_1292 | 299 |
| 376 | 3300047318 | Ga0495636_0017989 | Ga0495636_0017989_1224_2129 | 299 |
| 377 | 3300047320 | Ga0495672_0033438 | Ga0495672_0033438_686_1588 | 299 |
| 378 | 3300047320 | Ga0495672_0037253 | Ga0495672_0037253_1581_2486 | 299 |
| 379 | 3300047323 | Ga0495683_0038727 | Ga0495683_0038727_643_1545 | 299 |
| 380 | 3300047445 | Ga0495677_0018180 | Ga0495677_0018180_1000_1905 | 299 |
| 381 | 3300047446 | Ga0495679_003383 | Ga0495679_003383_4624_5523 | 299 |
| 382 | 3300047469 | Ga0495673_0000102 | Ga0495673_0000102_3307_4206 | 299 |
| 383 | 3300047469 | Ga0495673_0000710 | Ga0495673_0000710_8292_9191 | 299 |
| 384 | 3300047469 | Ga0495673_0005918 | Ga0495673_0005918_3369_4277 | 299 |
| 385 | 3300047472 | Ga0495686_0000839 | Ga0495686_0000839_4838_5737 | 299 |
| 386 | 3300047472 | Ga0495686_0003093 | Ga0495686_0003093_13761_14663 | 299 |
| 387 | 3300047472 | Ga0495686_0018643 | Ga0495686_0018643_2900_3799 | 299 |
| 388 | 3300047472 | Ga0495686_0063744 | Ga0495686_0063744_750_1664 | 299 |
| 389 | 3300047472 | Ga0495686_0102904 | Ga0495686_0102904_355_1254 | 299 |
| 390 | 3300047673 | Ga0495593_0021131 | Ga0495593_0021131_26_934 | 299 |
| 391 | 3300048905 | Ga0496102_0020538 | Ga0496102_0020538_1491_2396 | 299 |
| 392 | 3300048905 | Ga0496102_0157360 | Ga0496102_0157360_584_1495 | 299 |
| 393 | 3300048906 | Ga0496103_0031900 | Ga0496103_0031900_2112_3023 | 299 |
| 394 | 3300048909 | Ga0496106_0028640 | Ga0496106_0028640_636_1538 | 299 |
| 395 | 3300048910 | Ga0496107_0000131 | Ga0496107_0000131_26513_27415 | 299 |
| 396 | 3300048911 | Ga0496108_0017861 | Ga0496108_0017861_4696_5601 | 299 |
| 397 | 3300048915 | Ga0496112_0052358 | Ga0496112_0052358_1886_2791 | 299 |
| 398 | 3300048915 | Ga0496112_0114898 | Ga0496112_0114898_71_976 | 299 |
| 399 | 3300048918 | Ga0496115_0002138 | Ga0496115_0002138_2834_3742 | 299 |
| 400 | 3300048918 | Ga0496115_0002497 | Ga0496115_0002497_4650_5549 | 299 |
| 401 | 3300048918 | Ga0496115_0011156 | Ga0496115_0011156_1536_2438 | 299 |
| 402 | 3300048918 | Ga0496115_0268057 | Ga0496115_0268057_65_973 | 299 |
| 403 | 3300048919 | Ga0496116_0021619 | Ga0496116_0021619_1596_2513 | 299 |
| 404 | 3300048920 | Ga0496117_0018025 | Ga0496117_0018025_1017_1928 | 299 |
| 405 | 3300048921 | Ga0496118_0015375 | Ga0496118_0015375_2228_3139 | 299 |
| 406 | 3300048922 | Ga0496119_0023907 | Ga0496119_0023907_468_1379 | 299 |
| 407 | 3300048924 | Ga0496121_0000035 | Ga0496121_0000035_45117_46028 | 299 |
| 408 | 3300048924 | Ga0496121_0006185 | Ga0496121_0006185_55_957 | 299 |
| 409 | 3300048924 | Ga0496121_0184270 | Ga0496121_0184270_143_1051 | 299 |
| 410 | 3300048925 | Ga0496122_0004488 | Ga0496122_0004488_13913_14827 | 299 |
| 411 | 3300048926 | Ga0496123_0003275 | Ga0496123_0003275_6599_7513 | 299 |
| 412 | 3300048927 | Ga0496124_0012278 | Ga0496124_0012278_3064_3978 | 299 |
| 413 | 3300048928 | Ga0496125_0002516 | Ga0496125_0002516_12957_13871 | 299 |
| 414 | 3300048928 | Ga0496125_0043316 | Ga0496125_0043316_55_969 | 299 |
| 415 | 3300048929 | Ga0496126_0001304 | Ga0496126_0001304_23445_24344 | 299 |
| 416 | 3300049459 | Ga0495678_000558 | Ga0495678_000558_33457_34371 | 299 |
| 417 | 3300049579 | Ga0501043_0373914 | Ga0501043_0373914_126_1034 | 299 |
| 418 | 3300049581 | Ga0501047_0119071 | Ga0501047_0119071_333_1232 | 299 |
| 419 | 3300049581 | Ga0501047_0121608 | Ga0501047_0121608_284_1195 | 299 |
| 420 | 3300050496 | nmdc:mga07m45_69490_c1 | nmdc:mga07m45_69490_c1_109_1008 | 299 |
| 421 | 3300050516 | nmdc:mga0sz30_6418_c1 | nmdc:mga0sz30_6418_c1_3157_4071 | 299 |
| 422 | 3300053080 | Ga0500635_0000133 | Ga0500635_0000133_28995_29900 | 299 |
| 423 | 3300053086 | Ga0500578_0000737 | Ga0500578_0000737_32711_33610 | 299 |
| 424 | 3300053086 | Ga0500578_0130655 | Ga0500578_0130655_600_1502 | 299 |
| 425 | 3300053087 | Ga0500643_005318 | Ga0500643_005318_1360_2265 | 299 |
| 426 | 3300053088 | Ga0500644_0000084 | Ga0500644_0000084_56444_57343 | 299 |
| 427 | 3300053090 | Ga0500646_0042612 | Ga0500646_0042612_245_1156 | 299 |
| 428 | 3300053093 | Ga0500651_0003759 | Ga0500651_0003759_4229_5137 | 299 |
| 429 | 3300053103 | Ga0500555_001064 | Ga0500555_001064_2844_3755 | 299 |
| 430 | 3300053104 | Ga0500556_0002638 | Ga0500556_0002638_4640_5542 | 299 |
| 431 | 3300053108 | Ga0500562_002822 | Ga0500562_002822_569_1468 | 299 |
| 432 | 3300053109 | Ga0500569_013570 | Ga0500569_013570_590_1498 | 299 |
| 433 | 3300053118 | Ga0500594_0000221 | Ga0500594_0000221_8104_9018 | 299 |
| 434 | 3300053122 | Ga0500608_000187 | Ga0500608_000187_23973_24872 | 299 |
| 435 | 3300053122 | Ga0500608_001063 | Ga0500608_001063_8547_9455 | 299 |
| 436 | 3300053125 | Ga0500618_002255 | Ga0500618_002255_5669_6568 | 299 |
| 437 | 3300053130 | Ga0500642_0053055 | Ga0500642_0053055_413_1321 | 299 |
| 438 | 3300053133 | Ga0500655_024543 | Ga0500655_024543_178_1092 | 299 |
| 439 | 3300053134 | Ga0500658_0014910 | Ga0500658_0014910_328_1230 | 299 |
| 440 | 3300053136 | Ga0500559_0000212 | Ga0500559_0000212_22087_22986 | 299 |
| 441 | 3300053136 | Ga0500559_0003398 | Ga0500559_0003398_4055_4954 | 299 |
| 442 | 3300053136 | Ga0500559_0008444 | Ga0500559_0008444_1524_2432 | 299 |
| 443 | 3300053136 | Ga0500559_0018941 | Ga0500559_0018941_1815_2714 | 299 |
| 444 | 3300053136 | Ga0500559_0058687 | Ga0500559_0058687_651_1556 | 299 |
| 445 | 3300053138 | Ga0500564_000080 | Ga0500564_000080_490_1389 | 299 |
| 446 | 3300053142 | Ga0500577_0001991 | Ga0500577_0001991_3185_4084 | 299 |
| 447 | 3300053148 | Ga0500590_004838 | Ga0500590_004838_5400_6308 | 299 |
| 448 | 3300053153 | Ga0500616_0066166 | Ga0500616_0066166_530_1429 | 299 |
| 449 | 3300053154 | Ga0500619_000501 | Ga0500619_000501_670_1578 | 299 |
| 450 | 3300053156 | Ga0500622_0002814 | Ga0500622_0002814_5188_6087 | 299 |
| 451 | 3300053157 | Ga0500624_002114 | Ga0500624_002114_1624_2529 | 299 |
| 452 | 3300053162 | Ga0500638_061866 | Ga0500638_061866_467_1372 | 299 |
| 453 | 3300053177 | Ga0500636_0003639 | Ga0500636_0003639_3315_4220 | 299 |
| 454 | 3300053178 | Ga0500637_0029408 | Ga0500637_0029408_620_1525 | 299 |
| 455 | 3300053729 | Ga0500625_057543 | Ga0500625_057543_333_1241 | 299 |
| 456 | 3300053730 | Ga0500645_040824 | Ga0500645_040824_12_914 | 299 |
| 457 | 3300053735 | Ga0500596_001059 | Ga0500596_001059_1289_2197 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mp5-assembly2.cif.gz_C | crystal structure of human lyase r41m in complex with hmg-coa | 0.9538 | 1 | 296 |
| 1ydo-assembly1.cif.gz_A | crystal structure of the bacillis subtilis hmg-coa lyase, northeast structural genomics target sr181. | 0.9535 | 3 | 290 |
| 3mp3-assembly2.cif.gz_D | crystal structure of human lyase in complex with inhibitor hg-coa | 0.9534 | 1 | 294 |
| 2cw6-assembly1.cif.gz_A | crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria | 0.9528 | 1 | 294 |
| 3mp4-assembly3.cif.gz_F | crystal structure of human lyase r41m mutant | 0.9522 | 1 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JNR8_151_451_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9559 | 3 | 294 | 3.20.20.70 |
| 1ydoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9458 | 3 | 290 | 3.20.20.70 |
| af_Q0JNR8_151_451_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.928 | 3 | 294 | 3.20.20.70 |
| 1ydoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9114 | 3 | 290 | 3.20.20.70 |
| af_Q4DIQ4_8_322_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9015 | 1 | 284 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D5VHR3-F1-model_v4 | Pyruvate carboxyltransferase | 0.9951 | 1 | 299 |
GO:0004419
GO:0006552 GO:0016740 GO:0046872 GO:0046951 |
| AF-A0A7C1APX4-F1-model_v4 | Hydroxymethylglutaryl-CoA lyase | 0.9851 | 5 | 233 |
GO:0004419
GO:0006552 GO:0046872 GO:0046951 |
| AF-A0A2E4CTX6-F1-model_v4 | Hydroxymethylglutaryl-CoA lyase | 0.9814 | 5 | 294 |
GO:0004419
GO:0006552 GO:0046872 GO:0046951 |
| AF-A0A074MT89-F1-model_v4 | 3-hydroxy-3-methylglutaryl-CoA lyase | 0.9789 | 1 | 295 |
GO:0004419
GO:0006552 GO:0046872 GO:0046951 |
| AF-A0A7Y3C014-F1-model_v4 | Hydroxymethylglutaryl-CoA lyase | 0.9784 | 1 | 255 |
GO:0004419
GO:0006552 GO:0046872 GO:0046951 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar