F448024

General Info

Members Datasets Scaffolds Average Seq Length
457 265 455 246

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1040604|Ga0436364_1040604_52847_53683
Length 278
Sequence MIAFANPAAQRSRRIAPRSALKQAIFSPRGRPMIEQTVDVATKDGAMETFLCHPERGGPFPPVLLLMDAPGVREELRDMARRLGTVGYYVLLPNLYYRAGRDTIYGPEVLEHGSAEHARMRAVRTKMTIPPVMDDIAAMLAFLESQPRAKQGPVGAHGYCMSGPYALAAAARFPERVAAAASFYGTWLVSEAEESPHLTLGRVKGELYIACAEHDDLAPLPMVEELRRLFEAAGSPGEIELYPAVHHGFAFPQRWCYDKPAAERHWERLIALYRRRLG

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0
Rhizoplane 3.06
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1004300 3300000546 Bacteria 1583
2 JGI25153J46596_10017794 3300003215 Bacteria 2785
3 JGI25404J52841_10008922 3300003659 Bacteria 2141
4 Ga0055530_10000413 3300003791 Bacteria 38081
5 Ga0055531_10003653 3300003794 Bacteria 9700
6 Ga0065165_1000041 3300005262 Bacteria 203876
7 Ga0070658_10000819 3300005327 Bacteria 26592
8 Ga0070658_10048121 3300005327 Bacteria 3451
9 Ga0070658_10086990 3300005327 Bacteria 2571
10 Ga0070683_100078878 3300005329 Bacteria 3081
11 Ga0070680_100001453 3300005336 Bacteria 17175
12 Ga0070680_100003189 3300005336 Bacteria 12188
13 Ga0068868_100793581 3300005338 Bacteria 854
14 Ga0070660_100017854 3300005339 Bacteria 5175
15 Ga0070660_100061287 3300005339 Bacteria 2921
16 Ga0070660_100288194 3300005339 Bacteria 1344
17 Ga0070660_100313115 3300005339 Bacteria 1288
18 Ga0070689_100084422 3300005340 Bacteria 2496
19 Ga0070691_10008441 3300005341 Bacteria 4714
20 Ga0070661_100035754 3300005344 Bacteria 3609
21 Ga0070668_100409434 3300005347 Unclassified 1159
22 Ga0070675_100053163 3300005354 Bacteria 3330
23 Ga0070671_100416138 3300005355 Bacteria 1151
24 Ga0070659_100000056 3300005366 Bacteria 88478
25 Ga0070659_100000991 3300005366 Bacteria 20852
26 Ga0070714_100067316 3300005435 Bacteria 3087
27 Ga0070714_100223739 3300005435 Bacteria 1731
28 Ga0070714_100287826 3300005435 Bacteria 1528
29 Ga0070713_100053207 3300005436 Bacteria 3354
30 Ga0070713_100216365 3300005436 Unclassified 1737
31 Ga0070713_100529278 3300005436 Bacteria 1114
32 Ga0070710_10031294 3300005437 Bacteria 2871
33 Ga0070710_10168415 3300005437 Bacteria 1363
34 Ga0070701_10199153 3300005438 Bacteria 1183
35 Ga0070700_100021533 3300005441 Bacteria 3748
36 Ga0070708_100415673 3300005445 Bacteria 1268
37 Ga0070708_100619371 3300005445 Bacteria 1020
38 Ga0070681_10000334 3300005458 Bacteria 38316
39 Ga0070681_10004811 3300005458 Bacteria 12941
40 Ga0070706_100037665 3300005467 Bacteria 4466
41 Ga0070706_100132424 3300005467 Bacteria 2327
42 Ga0070707_100177667 3300005468 Bacteria 2075
43 Ga0070698_100000271 3300005471 Bacteria 52585
44 Ga0070698_100006786 3300005471 Bacteria 12409
45 Ga0070698_100305841 3300005471 Bacteria 1520
46 Ga0070699_100029298 3300005518 Bacteria 4746
47 Ga0070699_100317043 3300005518 Bacteria 1401
48 Ga0070679_100005911 3300005530 Bacteria 11370
49 Ga0070679_100031117 3300005530 Bacteria 5271
50 Ga0070679_100033006 3300005530 Bacteria 5123
51 Ga0070679_100432024 3300005530 Bacteria 1262
52 Ga0070684_100059494 3300005535 Bacteria 3340
53 Ga0070697_100164162 3300005536 Unclassified 1877
54 Ga0070697_100176064 3300005536 Bacteria 1812
55 Ga0070697_100211624 3300005536 Bacteria 1651
56 Ga0068853_100002861 3300005539 Bacteria 13091
57 Ga0068853_100560757 3300005539 Bacteria 1083
58 Ga0068853_100594245 3300005539 Bacteria 1051
59 Ga0070672_100659925 3300005543 Bacteria 914
60 Ga0070686_100166117 3300005544 Bacteria 1557
61 Ga0070696_100222026 3300005546 Bacteria 1418
62 Ga0070665_100000015 3300005548 Bacteria 462744
63 Ga0070665_100226975 3300005548 Bacteria 1867
64 Ga0070704_100395703 3300005549 Bacteria 1178
65 Ga0068855_100024352 3300005563 Bacteria 7244
66 Ga0068857_100202433 3300005577 Bacteria 1810
67 Ga0068857_100216890 3300005577 Bacteria 1747
68 Ga0068854_100367051 3300005578 Bacteria 1182
69 Ga0068856_100048646 3300005614 Bacteria 4179
70 Ga0068856_100311792 3300005614 Bacteria 1591
71 Ga0068859_100778343 3300005617 Bacteria 1045
72 Ga0068864_100390514 3300005618 Bacteria 1321
73 Ga0068861_100035617 3300005719 Bacteria 3688
74 Ga0068863_100144283 3300005841 Bacteria 2277
75 Ga0068860_100058040 3300005843 Bacteria 3679
76 Ga0081455_10000014 3300005937 Bacteria 193884
77 Ga0081455_10000562 3300005937 Bacteria 48394
78 Ga0081455_10062061 3300005937 Bacteria 3143
79 Ga0081540_1000035 3300005983 Bacteria 141244
80 Ga0081540_1006071 3300005983 Bacteria 8882
81 Ga0081540_1014691 3300005983 Bacteria 5001
82 Ga0081539_10018779 3300005985 Bacteria 4772
83 Ga0070717_10054899 3300006028 Bacteria 3286
84 Ga0070717_10097057 3300006028 Bacteria 2497
85 Ga0070717_10102645 3300006028 Bacteria 2430
86 Ga0075365_10024882 3300006038 Bacteria 3784
87 Ga0075432_10087689 3300006058 Bacteria 1136
88 Ga0070716_100670019 3300006173 Unclassified 789
89 Ga0070712_100098534 3300006175 Unclassified 2156
90 Ga0070712_100121675 3300006175 Unclassified 1964
91 Ga0070712_100136577 3300006175 Bacteria 1865
92 Ga0070712_100276826 3300006175 Unclassified 1350
93 Ga0075362_10002226 3300006177 Bacteria 6448
94 Ga0075362_10010939 3300006177 Bacteria 3561
95 Ga0075362_10135152 3300006177 Bacteria 1175
96 Ga0075362_10260200 3300006177 Bacteria 855
97 Ga0075367_10011310 3300006178 Bacteria 4716
98 Ga0075367_10024627 3300006178 Bacteria 3395
99 Ga0075367_10044061 3300006178 Bacteria 2614
100 Ga0075367_10116508 3300006178 Bacteria 1643
101 Ga0075369_10014051 3300006186 Bacteria 3192
102 Ga0075369_10155508 3300006186 Bacteria 1047
103 Ga0075366_10006657 3300006195 Bacteria 6340
104 Ga0075366_10122438 3300006195 Bacteria 1568
105 Ga0097621_100433902 3300006237 Bacteria 1181
106 Ga0075428_100055091 3300006844 Bacteria 4358
107 Ga0075428_100055094 3300006844 Bacteria 4358
108 Ga0075428_100067736 3300006844 Bacteria 3907
109 Ga0075430_100076521 3300006846 Bacteria 2805
110 Ga0075430_100090429 3300006846 Bacteria 2560
111 Ga0075430_100183699 3300006846 Bacteria 1739
112 Ga0075430_100649898 3300006846 Bacteria 870
113 Ga0075431_100004759 3300006847 Bacteria 13347
114 Ga0075431_100013649 3300006847 Bacteria 8210
115 Ga0075431_100100983 3300006847 Bacteria 2977
116 Ga0075433_10297688 3300006852 Bacteria 1429
117 Ga0075434_100002404 3300006871 Bacteria 16437
118 Ga0075434_100086239 3300006871 Bacteria 3140
119 Ga0075434_100297985 3300006871 Bacteria 1633
120 Ga0075434_100658795 3300006871 Bacteria 1065
121 Ga0075429_100043138 3300006880 Unclassified 3924
122 Ga0075429_100404500 3300006880 Bacteria 1195
123 Ga0097620_100778363 3300006931 Bacteria 1045
124 Ga0099794_10030471 3300007265 Bacteria 2520
125 Ga0105240_10004565 3300009093 Bacteria 21001
126 Ga0105240_10383978 3300009093 Bacteria 1585
127 Ga0111539_10054508 3300009094 Bacteria 4758
128 Ga0111539_10077258 3300009094 Bacteria 3919
129 Ga0111539_10208948 3300009094 Bacteria 2274
130 Ga0111539_10277642 3300009094 Bacteria 1950
131 Ga0105245_10616421 3300009098 Bacteria 1113
132 Ga0114129_10008235 3300009147 Bacteria 14864
133 Ga0114129_10082669 3300009147 Bacteria 4462
134 Ga0114129_10144803 3300009147 Unclassified 3255
135 Ga0114129_10203270 3300009147 Unclassified 2682
136 Ga0114129_11008117 3300009147 Bacteria 1048
137 Ga0105242_10462277 3300009176 Bacteria 1199
138 Ga0105248_11256892 3300009177 Bacteria 837
139 Ga0105238_10037228 3300009551 Bacteria 4947
140 Ga0105238_10376245 3300009551 Bacteria 1411
141 Ga0105249_10559484 3300009553 Bacteria 1195
142 Ga0099796_10047661 3300010159 Bacteria 1475
143 Ga0099796_10098179 3300010159 Unclassified 1098
144 Ga0099796_10109531 3300010159 Bacteria 1049
145 Ga0105239_10108549 3300010375 Bacteria 3075
146 Ga0105239_10435484 3300010375 Bacteria 1486
147 Ga0105246_10354403 3300011119 Bacteria 1203
148 Ga0157370_10121124 3300013104 Bacteria 2442
149 Ga0157370_10151649 3300013104 Bacteria 2157
150 Ga0157370_10312168 3300013104 Bacteria 1451
151 Ga0157369_10408661 3300013105 Bacteria 1408
152 Ga0157369_10510915 3300013105 Bacteria 1243
153 Ga0157378_10433660 3300013297 Bacteria 1301
154 Ga0163162_10195088 3300013306 Bacteria 2153
155 Ga0157372_10056431 3300013307 Bacteria 4388
156 Ga0157372_10141503 3300013307 Bacteria 2772
157 Ga0157375_10467662 3300013308 Bacteria 1426
158 Ga0163163_10011881 3300014325 Bacteria 7919
159 Ga0163163_10651309 3300014325 Bacteria 1117
160 Ga0157380_10306089 3300014326 Bacteria 1466
161 Ga0182008_10048347 3300014497 Bacteria 2112
162 Ga0157379_10139187 3300014968 Bacteria 2188
163 Ga0213876_10099392 3300021384 Bacteria 1542
164 Ga0213876_10137361 3300021384 Bacteria 1300
165 Ga0213875_10000007 3300021388 Bacteria 562717
166 Ga0213875_10000480 3300021388 Bacteria 34004
167 Ga0213875_10004720 3300021388 Bacteria 7419
168 Ga0213871_10001206 3300021441 Bacteria 4179
169 Ga0209758_1000541 3300025297 Bacteria 59943
170 Ga0209050_1000034 3300025298 Bacteria 433906
171 Ga0207426_1010890 3300025302 Bacteria 3499
172 Ga0207426_1015066 3300025302 Bacteria 2816
173 Ga0209257_1000052 3300025304 Bacteria 430947
174 Ga0207692_10045964 3300025898 Bacteria 2187
175 Ga0207692_10264477 3300025898 Bacteria 1035
176 Ga0207680_10166655 3300025903 Bacteria 1481
177 Ga0207647_10122116 3300025904 Bacteria 1535
178 Ga0207685_10249882 3300025905 Bacteria 857
179 Ga0207699_10110498 3300025906 Bacteria 1761
180 Ga0207705_10000362 3300025909 Bacteria 41196
181 Ga0207684_10060909 3300025910 Bacteria 3205
182 Ga0207684_10133525 3300025910 Bacteria 2131
183 Ga0207684_10138987 3300025910 Bacteria 2087
184 Ga0207684_10252119 3300025910 Bacteria 1523
185 Ga0207654_10209974 3300025911 Bacteria 1286
186 Ga0207707_10039573 3300025912 Bacteria 4120
187 Ga0207707_10091781 3300025912 Bacteria 2654
188 Ga0207707_10149642 3300025912 Bacteria 2041
189 Ga0207707_10481189 3300025912 Bacteria 1060
190 Ga0207695_10133228 3300025913 Bacteria 2441
191 Ga0207695_10237209 3300025913 Bacteria 1726
192 Ga0207695_10281178 3300025913 Bacteria 1558
193 Ga0207671_10274728 3300025914 Bacteria 1328
194 Ga0207693_10067704 3300025915 Unclassified 2796
195 Ga0207693_10076106 3300025915 Bacteria 2628
196 Ga0207693_10094240 3300025915 Unclassified 2347
197 Ga0207693_10113734 3300025915 Bacteria 2123
198 Ga0207693_10191339 3300025915 Bacteria 1610
199 Ga0207660_10004283 3300025917 Bacteria 9305
200 Ga0207660_10202982 3300025917 Bacteria 1549
201 Ga0207657_10000906 3300025919 Bacteria 31293
202 Ga0207657_10006424 3300025919 Bacteria 12192
203 Ga0207657_10139514 3300025919 Bacteria 1981
204 Ga0207652_10001016 3300025921 Bacteria 25826
205 Ga0207652_10045804 3300025921 Bacteria 3729
206 Ga0207652_10084118 3300025921 Bacteria 2787
207 Ga0207652_10172168 3300025921 Bacteria 1943
208 Ga0207646_10342508 3300025922 Bacteria 1351
209 Ga0207694_10008354 3300025924 Bacteria 7825
210 Ga0207694_10121132 3300025924 Bacteria 2089
211 Ga0207659_10012688 3300025926 Bacteria 5375
212 Ga0207700_10004193 3300025928 Bacteria 8461
213 Ga0207700_10060495 3300025928 Bacteria 2869
214 Ga0207700_10091035 3300025928 Bacteria 2409
215 Ga0207700_10180799 3300025928 Unclassified 1766
216 Ga0207700_10746615 3300025928 Bacteria 874
217 Ga0207664_10023723 3300025929 Bacteria 4601
218 Ga0207664_10149484 3300025929 Bacteria 1983
219 Ga0207664_10164273 3300025929 Bacteria 1896
220 Ga0207644_10385925 3300025931 Bacteria 1143
221 Ga0207690_10000568 3300025932 Bacteria 24144
222 Ga0207690_10010975 3300025932 Bacteria 5402
223 Ga0207670_10025769 3300025936 Bacteria 3696
224 Ga0207670_10253043 3300025936 Bacteria 1362
225 Ga0207704_10306696 3300025938 Bacteria 1218
226 Ga0207665_10336412 3300025939 Bacteria 1136
227 Ga0207679_10442661 3300025945 Bacteria 1151
228 Ga0207667_10006735 3300025949 Bacteria 13874
229 Ga0207667_10129372 3300025949 Bacteria 2600
230 Ga0207667_10213893 3300025949 Bacteria 1976
231 Ga0207667_10226616 3300025949 Bacteria 1914
232 Ga0207651_10561670 3300025960 Bacteria 994
233 Ga0207668_10242116 3300025972 Bacteria 1460
234 Ga0207640_10308209 3300025981 Bacteria 1255
235 Ga0207639_10011330 3300026041 Bacteria 6189
236 Ga0207639_10281036 3300026041 Bacteria 1464
237 Ga0207708_10022249 3300026075 Bacteria 4786
238 Ga0207708_10142362 3300026075 Bacteria 1882
239 Ga0207702_10224643 3300026078 Bacteria 1751
240 Ga0207702_10381512 3300026078 Bacteria 1355
241 Ga0207676_10176451 3300026095 Bacteria 1867
242 Ga0207674_10149524 3300026116 Bacteria 2293
243 Ga0207675_100052107 3300026118 Bacteria 3819
244 Ga0207698_10225156 3300026142 Bacteria 1698
245 Ga0209971_1003333 3300027682 Bacteria 3815
246 Ga0265356_1000386 3300028017 Bacteria 7997
247 Ga0268266_10000005 3300028379 Bacteria 1448194
248 Ga0268266_10039872 3300028379 Bacteria 4002
249 Ga0268266_10154478 3300028379 Bacteria 2071
250 Ga0268264_10025183 3300028381 Bacteria 4861
251 Ga0268264_10399521 3300028381 Bacteria 1320
252 Ga0265334_10017782 3300028573 Bacteria 2933
253 Ga0307517_10001422 3300028786 Bacteria 40266
254 Ga0265338_10102823 3300028800 Unclassified 2322
255 Ga0265332_10122567 3300031238 Bacteria 1092
256 Ga0265325_10028832 3300031241 Bacteria 2988
257 Ga0265329_10087949 3300031242 Bacteria 985
258 Ga0265327_10000360 3300031251 Bacteria 86617
259 Ga0307513_10001510 3300031456 Bacteria 33405
260 Ga0307408_100084910 3300031548 Bacteria 2376
261 Ga0307514_10013409 3300031649 Bacteria 6803
262 Ga0316577_10068567 3300031733 Bacteria 1981
263 Ga0307412_10212267 3300031911 Bacteria 1478
264 Ga0307414_10104447 3300032004 Bacteria 2140
265 Ga0373950_0012305 3300034818 Bacteria 1411
266 Ga0373959_0005110 3300034820 Bacteria 2145
267 Ga0373938_0051271 3300034957 Bacteria 943
268 Ga0373938_0058187 3300034957 Unclassified 898
269 Ga0373926_0019950 3300035083 Bacteria 2313
270 Ga0373940_0043156 3300035088 Unclassified 1245
271 Ga0373944_0102681 3300035089 Bacteria 968
272 Ga0373949_0019478 3300035090 Bacteria 1546
273 Ga0373951_0025024 3300035091 Bacteria 1385
274 Ga0373952_0020955 3300035092 Bacteria 1375
275 Ga0373936_0127548 3300035113 Bacteria 1091
276 Ga0373939_0002868 3300035114 Bacteria 4052
277 Ga0373939_0008305 3300035114 Bacteria 2545
278 Ga0373941_0007109 3300035115 Bacteria 2726
279 Ga0373954_0236882 3300035118 Bacteria 898
280 Ga0373956_0020528 3300035119 Bacteria 2812
281 Ga0373960_0003948 3300035121 Bacteria 3382
282 Ga0373942_0045741 3300035207 Unclassified 1210
283 Ga0373961_0019541 3300035241 Bacteria 1781
284 Ga0373962_0034328 3300035242 Unclassified 1404
285 Ga0373924_0014012 3300035410 Bacteria 3023
286 Ga0373931_0000271 3300035691 Bacteria 21921
287 Ga0373931_0022099 3300035691 Bacteria 3198
288 Ga0373931_0062627 3300035691 Bacteria 2008
289 Ga0373931_0099214 3300035691 Bacteria 1636
290 Ga0373935_0051403 3300035692 Bacteria 2617
291 Ga0373935_0143985 3300035692 Bacteria 1612
292 Ga0373927_0227045 3300035695 Bacteria 1227
293 Ga0373927_0230167 3300035695 Bacteria 1218
294 Ga0373933_0401254 3300035724 Bacteria 894
295 Ga0373947_0019189 3300035725 Bacteria 3941
296 Ga0373947_0086793 3300035725 Bacteria 1946
297 Ga0373937_0003937 3300036401 Bacteria 12550
298 Ga0373937_0004915 3300036401 Bacteria 11364
299 Ga0373937_0045062 3300036401 Bacteria 4030
300 Ga0373937_0670309 3300036401 Bacteria 983
301 Ga0316584_0005986 3300036712 Bacteria 8216
302 Ga0373925_0012361 3300037068 Bacteria 6182
303 Ga0373925_0119971 3300037068 Bacteria 2041
304 Ga0373925_0554459 3300037068 Bacteria 945
305 Ga0395899_0025121 3300037312 Bacteria 4498
306 Ga0395899_0064061 3300037312 Bacteria 2703
307 Ga0395899_0092164 3300037312 Bacteria 2195
308 Ga0395899_0558787 3300037312 Bacteria 734
309 Ga0395900_0022094 3300037418 Bacteria 6508
310 Ga0395900_0071310 3300037418 Bacteria 3571
311 Ga0395898_0006041 3300037466 Bacteria 13000
312 Ga0395898_0154599 3300037466 Bacteria 2194
313 Ga0395905_0363997 3300037471 Unclassified 1339
314 Ga0436364_0010042 3300037853 Bacteria 102214
315 Ga0436364_0309649 3300037853 Bacteria 36034
316 Ga0436364_0575752 3300037853 Bacteria 2145
317 Ga0436364_1040604 3300037853 Bacteria 60326
318 Ga0436364_1230704 3300037853 Bacteria 5244
319 Ga0436364_1280177 3300037853 Bacteria 3565
320 Ga0395901_0018343 3300038443 Bacteria 7144
321 Ga0395901_0040905 3300038443 Bacteria 4801
322 Ga0395901_0395470 3300038443 Bacteria 1420
323 Ga0436365_0887425 3300039437 Bacteria 963
324 Ga0436365_1411420 3300039437 Bacteria 4288
325 Ga0436360_0488995 3300039438 Bacteria 881
326 Ga0436360_0945100 3300039438 Bacteria 6705
327 Ga0436361_0124257 3300039447 Bacteria 4652
328 Ga0436361_1187303 3300039447 Bacteria 3445
329 Ga0436363_0489530 3300039450 Bacteria 814
330 Ga0436363_0789910 3300039450 Unclassified 1161
331 Ga0436362_0218822 3300039453 Bacteria 1902
332 Ga0436362_1180911 3300039453 Bacteria 1255
333 Ga0439460_0047039 3300042461 Bacteria 1283
334 Ga0451577_0288603 3300042876 Bacteria 1487
335 Ga0466963_0014048 3300044694 Bacteria 4932
336 Ga0466957_0078307 3300044842 Bacteria 2055
337 Ga0466967_0309120 3300045976 Bacteria 1522
338 Ga0495629_0211238 3300046459 Bacteria 1340
339 Ga0495651_0131142 3300046462 Bacteria 1829
340 Ga0495653_0242933 3300046463 Bacteria 1199
341 Ga0495664_0011336 3300046477 Bacteria 5024
342 Ga0495584_0062405 3300046491 Bacteria 1873
343 Ga0495628_0239601 3300046516 Bacteria 1357
344 Ga0495630_0307771 3300046517 Bacteria 1211
345 Ga0495652_0146426 3300046529 Bacteria 1851
346 Ga0495586_0081589 3300046535 Bacteria 1777
347 Ga0495587_0003442 3300046536 Bacteria 10559
348 Ga0495645_0034901 3300046543 Bacteria 3667
349 Ga0495667_0102533 3300046559 Bacteria 1850
350 Ga0495667_0349883 3300046559 Bacteria 933
351 Ga0495635_0053691 3300046663 Bacteria 2776
352 Ga0495657_0031836 3300046675 Bacteria 3684
353 Ga0495599_0011527 3300046678 Bacteria 5434
354 Ga0495646_0083715 3300046680 Bacteria 1853
355 Ga0495604_0113173 3300047317 Bacteria 1975
356 Ga0495674_0200284 3300047319 Bacteria 1657
357 Ga0495674_0298200 3300047319 Bacteria 1317
358 Ga0495675_0136660 3300047444 Bacteria 1521
359 Ga0495684_0018224 3300047471 Bacteria 5412
360 Ga0495684_0355740 3300047471 Bacteria 1038
361 Ga0495602_0004234 3300048088 Bacteria 14925
362 Ga0495602_0238042 3300048088 Bacteria 1363
363 Ga0495602_0325485 3300048088 Bacteria 1117
364 Ga0496104_0007199 3300048907 Bacteria 9809
365 Ga0496105_0051611 3300048908 Bacteria 3397
366 Ga0496108_0009412 3300048911 Bacteria 7910
367 Ga0496109_0005367 3300048912 Bacteria 10715
368 Ga0496110_0075973 3300048913 Bacteria 2986
369 Ga0496110_0090788 3300048913 Bacteria 2731
370 Ga0496111_0017923 3300048914 Bacteria 4897
371 Ga0496111_0511425 3300048914 Bacteria 883
372 Ga0496112_0001903 3300048915 Bacteria 16465
373 Ga0496112_0295854 3300048915 Bacteria 1565
374 Ga0496113_0024672 3300048916 Bacteria 4277
375 Ga0496114_0328825 3300048917 Bacteria 1351
376 Ga0496115_0005219 3300048918 Bacteria 9441
377 Ga0496115_0284810 3300048918 Bacteria 1356
378 Ga0496119_0060262 3300048922 Bacteria 2273
379 Ga0496120_0055299 3300048923 Bacteria 2245
380 Ga0501034_0005006 3300049571 Bacteria 14572
381 Ga0501034_0013938 3300049571 Bacteria 8276
382 Ga0501034_0046613 3300049571 Bacteria 4379
383 Ga0501034_0104821 3300049571 Bacteria 2821
384 Ga0501034_0274275 3300049571 Bacteria 1627
385 Ga0501034_0540968 3300049571 Bacteria 1075
386 Ga0501037_0091335 3300049573 Bacteria 2202
387 Ga0501038_0554174 3300049574 Bacteria 874
388 Ga0501043_0563658 3300049579 Bacteria 845
389 Ga0501046_0202009 3300049580 Bacteria 1479
390 Ga0501047_0062670 3300049581 Bacteria 3587
391 Ga0501047_0065746 3300049581 Bacteria 3495
392 Ga0501047_0420816 3300049581 Bacteria 1167
393 Ga0501048_0101428 3300049582 Bacteria 2031
394 Ga0501068_0006030 3300049584 Bacteria 6659
395 Ga0501071_0046171 3300049587 Bacteria 3129
396 Ga0501072_0184626 3300049588 Bacteria 1664
397 Ga0501083_0338953 3300049744 Bacteria 978
398 Ga0501044_0003113 3300049823 Bacteria 18797
399 Ga0501044_0056538 3300049823 Bacteria 4029
400 Ga0501044_0203158 3300049823 Bacteria 1939
401 nmdc:mga03683_130450_c1 3300050489 Bacteria 1124
402 nmdc:mga03683_3042_c1 3300050489 Bacteria 5317
403 nmdc:mga03683_33638_c1 3300050489 Bacteria 2070
404 nmdc:mga03683_527_c1 3300050489 Bacteria 5175
405 nmdc:mga03683_57814_c1 3300050489 Bacteria 1633
406 nmdc:mga03683_67280_c1 3300050489 Bacteria 1525
407 nmdc:mga00v17_433583_c1 3300050491 Bacteria 853
408 nmdc:mga00v17_76903_c1 3300050491 Bacteria 2077
409 nmdc:mga0yw44_108144_c1 3300050492 Bacteria 1779
410 nmdc:mga0yw44_392287_c1 3300050492 Bacteria 938
411 nmdc:mga0k408_6009_c1 3300050493 Bacteria 6478
412 nmdc:mga06z11_23752_c1 3300050494 Bacteria 2884
413 nmdc:mga06z11_25226_c1 3300050494 Bacteria 2815
414 nmdc:mga06z11_66330_c1 3300050494 Bacteria 1897
415 nmdc:mga07m45_1679_c1 3300050496 Bacteria 8400
416 nmdc:mga05p37_15470_c1 3300050507 Bacteria 9170
417 nmdc:mga05p37_5976_c1 3300050507 Bacteria 14325
418 nmdc:mga05p37_825846_c1 3300050507 Bacteria 1010
419 nmdc:mga09592_52160_c1 3300050508 Unclassified 3452
420 nmdc:mga0qj67_112677_c1 3300050509 Bacteria 2196
421 nmdc:mga0qj67_203894_c1 3300050509 Bacteria 1606
422 nmdc:mga0qj67_33656_c1 3300050509 Bacteria 3999
423 nmdc:mga0qj67_493042_c1 3300050509 Bacteria 985
424 nmdc:mga0qj67_586207_c1 3300050509 Bacteria 893
425 nmdc:mga06r32_18053_c1 3300050510 Bacteria 6451
426 nmdc:mga06r32_21130_c1 3300050510 Bacteria 6006
427 nmdc:mga08y16_108739_c1 3300050511 Bacteria 2887
428 nmdc:mga08y16_266393_c1 3300050511 Bacteria 1769
429 nmdc:mga08y16_279717_c1 3300050511 Bacteria 1721
430 nmdc:mga08y16_56182_c1 3300050511 Bacteria 4114
431 nmdc:mga08y16_737181_c1 3300050511 Bacteria 982
432 nmdc:mga0n895_172045_c1 3300050512 Bacteria 2198
433 nmdc:mga0n895_2115_c1 3300050512 Bacteria 15326
434 nmdc:mga0n895_474903_c1 3300050512 Bacteria 1261
435 nmdc:mga0n895_604682_c1 3300050512 Bacteria 1098
436 nmdc:mga0rr50_21522_c1 3300050513 Bacteria 4404
437 nmdc:mga0a205_212924_c1 3300050515 Bacteria 1820
438 nmdc:mga0a205_3719_c2 3300050515 Bacteria 8445
439 nmdc:mga0a205_504671_c1 3300050515 Bacteria 1066
440 nmdc:mga0sz30_5232_c1 3300050516 Bacteria 2838
441 nmdc:mga0sz30_5712_c1 3300050516 Bacteria 4137
442 Ga0495601_0023364 3300053077 Bacteria 3798
443 Ga0495595_0015409 3300053084 Bacteria 3261
444 Ga0495595_0034761 3300053084 Bacteria 2281
445 Ga0495619_0006325 3300053085 Bacteria 7512
446 Ga0495619_0030983 3300053085 Bacteria 3464
447 Ga0495619_0178118 3300053085 Bacteria 1471
448 Ga0500651_0038158 3300053093 Bacteria 3027
449 Ga0500641_0000784 3300053096 Bacteria 11491
450 Ga0500641_0011970 3300053096 Bacteria 3160
451 Ga0500562_001424 3300053108 Bacteria 5880
452 Ga0500616_0003033 3300053153 Bacteria 13228
453 Ga0501084_0374419 3300054114 Bacteria 1203
454 Ga0501082_0079794 3300060353 Bacteria 2824
455 Ga0530510_0091376 3300061734 Bacteria 2221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10121132 Ga0207694_101211321 199
2 3300037312 Ga0395899_0558787 Ga0395899_0558787_77_724 209
3 3300047319 Ga0495674_0298200 Ga0495674_0298200_651_1301 214
4 3300047471 Ga0495684_0355740 Ga0495684_0355740_252_992 225
5 3300035207 Ga0373942_0045741 Ga0373942_0045741_10_693 226
6 3300025928 Ga0207700_10060495 Ga0207700_100604952 231
7 3300037068 Ga0373925_0554459 Ga0373925_0554459_25_723 231
8 3300050489 nmdc:mga03683_130450_c1 nmdc:mga03683_130450_c1_17_718 231
9 3300035089 Ga0373944_0102681 Ga0373944_0102681_200_910 233
10 3300039453 Ga0436362_0218822 Ga0436362_0218822_406_1176 235
11 iso_pu_bacteria 2643221598 2644001231 239
12 3300031649 Ga0307514_10013409 Ga0307514_100134093 241
13 3300037471 Ga0395905_0363997 Ga0395905_0363997_194_1003 241
14 iso_pu_bacteria 2883577096 2883579327 241
15 3300028786 Ga0307517_10001422 Ga0307517_1000142237 242
16 3300031456 Ga0307513_10001510 Ga0307513_1000151033 242
17 3300003215 JGI25153J46596_10017794 JGI25153J46596_100177943 243
18 3300003791 Ga0055530_10000413 Ga0055530_1000041318 243
19 3300003794 Ga0055531_10003653 Ga0055531_100036538 243
20 3300005262 Ga0065165_1000041 Ga0065165_1000041119 243
21 3300005327 Ga0070658_10048121 Ga0070658_100481212 243
22 3300005327 Ga0070658_10086990 Ga0070658_100869902 243
23 3300005336 Ga0070680_100003189 Ga0070680_10000318911 243
24 3300005339 Ga0070660_100017854 Ga0070660_1000178546 243
25 3300005339 Ga0070660_100061287 Ga0070660_1000612872 243
26 3300005339 Ga0070660_100288194 Ga0070660_1002881941 243
27 3300005366 Ga0070659_100000056 Ga0070659_10000005669 243
28 3300005366 Ga0070659_100000991 Ga0070659_10000099119 243
29 3300005458 Ga0070681_10004811 Ga0070681_100048114 243
30 3300005530 Ga0070679_100031117 Ga0070679_1000311175 243
31 3300005539 Ga0068853_100002861 Ga0068853_1000028618 243
32 3300005539 Ga0068853_100594245 Ga0068853_1005942451 243
33 3300005548 Ga0070665_100000015 Ga0070665_100000015248 243
34 3300005563 Ga0068855_100024352 Ga0068855_1000243523 243
35 3300005577 Ga0068857_100202433 Ga0068857_1002024332 243
36 3300009551 Ga0105238_10037228 Ga0105238_100372286 243
37 3300010375 Ga0105239_10108549 Ga0105239_101085494 243
38 3300013104 Ga0157370_10121124 Ga0157370_101211242 243
39 3300013104 Ga0157370_10151649 Ga0157370_101516493 243
40 3300013307 Ga0157372_10056431 Ga0157372_100564315 243
41 3300025297 Ga0209758_1000541 Ga0209758_100054124 243
42 3300025298 Ga0209050_1000034 Ga0209050_1000034326 243
43 3300025304 Ga0209257_1000052 Ga0209257_100005284 243
44 3300025903 Ga0207680_10166655 Ga0207680_101666551 243
45 3300025909 Ga0207705_10000362 Ga0207705_1000036240 243
46 3300025911 Ga0207654_10209974 Ga0207654_102099742 243
47 3300025912 Ga0207707_10039573 Ga0207707_100395735 243
48 3300025913 Ga0207695_10133228 Ga0207695_101332282 243
49 3300025913 Ga0207695_10237209 Ga0207695_102372092 243
50 3300025917 Ga0207660_10004283 Ga0207660_100042834 243
51 3300025919 Ga0207657_10000906 Ga0207657_1000090619 243
52 3300025919 Ga0207657_10006424 Ga0207657_100064248 243
53 3300025919 Ga0207657_10139514 Ga0207657_101395142 243
54 3300025921 Ga0207652_10001016 Ga0207652_1000101619 243
55 3300025924 Ga0207694_10008354 Ga0207694_100083544 243
56 3300025932 Ga0207690_10000568 Ga0207690_100005687 243
57 3300025932 Ga0207690_10010975 Ga0207690_100109754 243
58 3300025949 Ga0207667_10006735 Ga0207667_1000673514 243
59 3300025949 Ga0207667_10129372 Ga0207667_101293722 243
60 3300025981 Ga0207640_10308209 Ga0207640_103082092 243
61 3300026041 Ga0207639_10011330 Ga0207639_100113305 243
62 3300026041 Ga0207639_10281036 Ga0207639_102810361 243
63 3300026116 Ga0207674_10149524 Ga0207674_101495242 243
64 3300026142 Ga0207698_10225156 Ga0207698_102251561 243
65 3300028379 Ga0268266_10000005 Ga0268266_10000005870 243
66 3300031251 Ga0265327_10000360 Ga0265327_1000036029 243
67 3300032004 Ga0307414_10104447 Ga0307414_101044473 243
68 3300042876 Ga0451577_0288603 Ga0451577_0288603_421_1155 243
69 3300046517 Ga0495630_0307771 Ga0495630_0307771_215_952 243
70 3300046543 Ga0495645_0034901 Ga0495645_0034901_2826_3563 243
71 3300048918 Ga0496115_0005219 Ga0496115_0005219_297_1034 243
72 3300049573 Ga0501037_0091335 Ga0501037_0091335_901_1638 243
73 3300049581 Ga0501047_0062670 Ga0501047_0062670_1777_2514 243
74 3300049581 Ga0501047_0420816 Ga0501047_0420816_400_1137 243
75 3300049823 Ga0501044_0003113 Ga0501044_0003113_4671_5408 243
76 3300053096 Ga0500641_0011970 Ga0500641_0011970_1908_2645 243
77 3300053108 Ga0500562_001424 Ga0500562_001424_212_949 243
78 3300003659 JGI25404J52841_10008922 JGI25404J52841_100089223 244
79 3300005329 Ga0070683_100078878 Ga0070683_1000788783 244
80 3300005338 Ga0068868_100793581 Ga0068868_1007935811 244
81 3300005344 Ga0070661_100035754 Ga0070661_1000357543 244
82 3300005347 Ga0070668_100409434 Ga0070668_1004094341 244
83 3300005354 Ga0070675_100053163 Ga0070675_1000531632 244
84 3300005355 Ga0070671_100416138 Ga0070671_1004161381 244
85 3300005436 Ga0070713_100216365 Ga0070713_1002163652 244
86 3300005438 Ga0070701_10199153 Ga0070701_101991531 244
87 3300005441 Ga0070700_100021533 Ga0070700_1000215332 244
88 3300005445 Ga0070708_100415673 Ga0070708_1004156732 244
89 3300005471 Ga0070698_100000271 Ga0070698_10000027129 244
90 3300005518 Ga0070699_100029298 Ga0070699_1000292984 244
91 3300005530 Ga0070679_100432024 Ga0070679_1004320242 244
92 3300005535 Ga0070684_100059494 Ga0070684_1000594942 244
93 3300005539 Ga0068853_100560757 Ga0068853_1005607571 244
94 3300005543 Ga0070672_100659925 Ga0070672_1006599251 244
95 3300005546 Ga0070696_100222026 Ga0070696_1002220261 244
96 3300005549 Ga0070704_100395703 Ga0070704_1003957032 244
97 3300005578 Ga0068854_100367051 Ga0068854_1003670511 244
98 3300005614 Ga0068856_100048646 Ga0068856_1000486464 244
99 3300005618 Ga0068864_100390514 Ga0068864_1003905142 244
100 3300005719 Ga0068861_100035617 Ga0068861_1000356173 244
101 3300005841 Ga0068863_100144283 Ga0068863_1001442831 244
102 3300005937 Ga0081455_10000014 Ga0081455_10000014143 244
103 3300005983 Ga0081540_1000035 Ga0081540_100003598 244
104 3300005985 Ga0081539_10018779 Ga0081539_100187793 244
105 3300006058 Ga0075432_10087689 Ga0075432_100876891 244
106 3300006237 Ga0097621_100433902 Ga0097621_1004339022 244
107 3300006844 Ga0075428_100055091 Ga0075428_1000550912 244
108 3300006844 Ga0075428_100055094 Ga0075428_1000550943 244
109 3300006844 Ga0075428_100067736 Ga0075428_1000677361 244
110 3300006846 Ga0075430_100076521 Ga0075430_1000765212 244
111 3300006846 Ga0075430_100183699 Ga0075430_1001836992 244
112 3300006847 Ga0075431_100004759 Ga0075431_1000047599 244
113 3300006852 Ga0075433_10297688 Ga0075433_102976882 244
114 3300006871 Ga0075434_100002404 Ga0075434_10000240414 244
115 3300006871 Ga0075434_100086239 Ga0075434_1000862391 244
116 3300006871 Ga0075434_100658795 Ga0075434_1006587952 244
117 3300009093 Ga0105240_10383978 Ga0105240_103839782 244
118 3300009094 Ga0111539_10054508 Ga0111539_100545082 244
119 3300009094 Ga0111539_10077258 Ga0111539_100772582 244
120 3300009094 Ga0111539_10208948 Ga0111539_102089481 244
121 3300009094 Ga0111539_10277642 Ga0111539_102776423 244
122 3300009098 Ga0105245_10616421 Ga0105245_106164212 244
123 3300009147 Ga0114129_10008235 Ga0114129_1000823510 244
124 3300009147 Ga0114129_11008117 Ga0114129_110081171 244
125 3300009177 Ga0105248_11256892 Ga0105248_112568921 244
126 3300009551 Ga0105238_10376245 Ga0105238_103762452 244
127 3300013105 Ga0157369_10408661 Ga0157369_104086612 244
128 3300013105 Ga0157369_10510915 Ga0157369_105109151 244
129 3300013297 Ga0157378_10433660 Ga0157378_104336602 244
130 3300013307 Ga0157372_10141503 Ga0157372_101415033 244
131 3300014326 Ga0157380_10306089 Ga0157380_103060891 244
132 3300014497 Ga0182008_10048347 Ga0182008_100483472 244
133 3300021441 Ga0213871_10001206 Ga0213871_100012062 244
134 3300025302 Ga0207426_1010890 Ga0207426_10108902 244
135 3300025302 Ga0207426_1015066 Ga0207426_10150662 244
136 3300025904 Ga0207647_10122116 Ga0207647_101221162 244
137 3300025910 Ga0207684_10060909 Ga0207684_100609095 244
138 3300025913 Ga0207695_10281178 Ga0207695_102811782 244
139 3300025914 Ga0207671_10274728 Ga0207671_102747281 244
140 3300025926 Ga0207659_10012688 Ga0207659_100126883 244
141 3300025928 Ga0207700_10180799 Ga0207700_101807992 244
142 3300025931 Ga0207644_10385925 Ga0207644_103859252 244
143 3300025936 Ga0207670_10253043 Ga0207670_102530432 244
144 3300025949 Ga0207667_10213893 Ga0207667_102138932 244
145 3300025960 Ga0207651_10561670 Ga0207651_105616701 244
146 3300025972 Ga0207668_10242116 Ga0207668_102421162 244
147 3300026075 Ga0207708_10022249 Ga0207708_100222493 244
148 3300026075 Ga0207708_10142362 Ga0207708_101423622 244
149 3300026078 Ga0207702_10224643 Ga0207702_102246432 244
150 3300026118 Ga0207675_100052107 Ga0207675_1000521073 244
151 3300027682 Ga0209971_1003333 Ga0209971_10033332 244
152 3300028379 Ga0268266_10039872 Ga0268266_100398723 244
153 3300031238 Ga0265332_10122567 Ga0265332_101225671 244
154 3300031242 Ga0265329_10087949 Ga0265329_100879491 244
155 3300031733 Ga0316577_10068567 Ga0316577_100685672 244
156 3300034818 Ga0373950_0012305 Ga0373950_0012305_60_797 244
157 3300034820 Ga0373959_0005110 Ga0373959_0005110_168_905 244
158 3300034957 Ga0373938_0051271 Ga0373938_0051271_56_793 244
159 3300034957 Ga0373938_0058187 Ga0373938_0058187_129_866 244
160 3300035088 Ga0373940_0043156 Ga0373940_0043156_241_978 244
161 3300035090 Ga0373949_0019478 Ga0373949_0019478_546_1283 244
162 3300035091 Ga0373951_0025024 Ga0373951_0025024_214_951 244
163 3300035092 Ga0373952_0020955 Ga0373952_0020955_187_924 244
164 3300035114 Ga0373939_0002868 Ga0373939_0002868_2627_3364 244
165 3300035114 Ga0373939_0008305 Ga0373939_0008305_102_839 244
166 3300035115 Ga0373941_0007109 Ga0373941_0007109_197_934 244
167 3300035121 Ga0373960_0003948 Ga0373960_0003948_2163_2900 244
168 3300035241 Ga0373961_0019541 Ga0373961_0019541_579_1316 244
169 3300035242 Ga0373962_0034328 Ga0373962_0034328_546_1283 244
170 3300035691 Ga0373931_0000271 Ga0373931_0000271_4221_4958 244
171 3300035691 Ga0373931_0022099 Ga0373931_0022099_1438_2175 244
172 3300035695 Ga0373927_0230167 Ga0373927_0230167_34_771 244
173 3300036401 Ga0373937_0670309 Ga0373937_0670309_216_968 244
174 3300036712 Ga0316584_0005986 Ga0316584_0005986_1993_2730 244
175 3300037312 Ga0395899_0025121 Ga0395899_0025121_119_856 244
176 3300037418 Ga0395900_0022094 Ga0395900_0022094_53_790 244
177 3300037418 Ga0395900_0071310 Ga0395900_0071310_246_983 244
178 3300037466 Ga0395898_0006041 Ga0395898_0006041_5778_6515 244
179 3300038443 Ga0395901_0018343 Ga0395901_0018343_1051_1788 244
180 3300038443 Ga0395901_0040905 Ga0395901_0040905_560_1297 244
181 3300039438 Ga0436360_0945100 Ga0436360_0945100_2253_2990 244
182 3300039447 Ga0436361_1187303 Ga0436361_1187303_1642_2379 244
183 3300044694 Ga0466963_0014048 Ga0466963_0014048_2735_3472 244
184 3300044842 Ga0466957_0078307 Ga0466957_0078307_876_1613 244
185 3300046491 Ga0495584_0062405 Ga0495584_0062405_1084_1821 244
186 3300048913 Ga0496110_0075973 Ga0496110_0075973_975_1712 244
187 3300048914 Ga0496111_0511425 Ga0496111_0511425_30_767 244
188 3300048915 Ga0496112_0295854 Ga0496112_0295854_607_1344 244
189 3300048917 Ga0496114_0328825 Ga0496114_0328825_405_1142 244
190 3300049571 Ga0501034_0005006 Ga0501034_0005006_2456_3193 244
191 3300049571 Ga0501034_0013938 Ga0501034_0013938_1717_2454 244
192 3300049571 Ga0501034_0046613 Ga0501034_0046613_1389_2126 244
193 3300049571 Ga0501034_0104821 Ga0501034_0104821_345_1097 244
194 3300049584 Ga0501068_0006030 Ga0501068_0006030_5860_6597 244
195 3300049744 Ga0501083_0338953 Ga0501083_0338953_62_799 244
196 3300049823 Ga0501044_0056538 Ga0501044_0056538_904_1641 244
197 3300050507 nmdc:mga05p37_5976_c1 nmdc:mga05p37_5976_c1_7681_8418 244
198 3300050507 nmdc:mga05p37_825846_c1 nmdc:mga05p37_825846_c1_244_981 244
199 3300050509 nmdc:mga0qj67_112677_c1 nmdc:mga0qj67_112677_c1_637_1374 244
200 3300050509 nmdc:mga0qj67_493042_c1 nmdc:mga0qj67_493042_c1_104_841 244
201 3300050510 nmdc:mga06r32_21130_c1 nmdc:mga06r32_21130_c1_5022_5759 244
202 3300050511 nmdc:mga08y16_108739_c1 nmdc:mga08y16_108739_c1_1430_2167 244
203 3300050511 nmdc:mga08y16_266393_c1 nmdc:mga08y16_266393_c1_217_954 244
204 3300050511 nmdc:mga08y16_56182_c1 nmdc:mga08y16_56182_c1_2296_3033 244
205 3300050512 nmdc:mga0n895_172045_c1 nmdc:mga0n895_172045_c1_1242_1979 244
206 3300050512 nmdc:mga0n895_2115_c1 nmdc:mga0n895_2115_c1_5347_6084 244
207 3300050512 nmdc:mga0n895_604682_c1 nmdc:mga0n895_604682_c1_248_985 244
208 3300050513 nmdc:mga0rr50_21522_c1 nmdc:mga0rr50_21522_c1_68_805 244
209 3300050515 nmdc:mga0a205_3719_c2 nmdc:mga0a205_3719_c2_725_1462 244
210 3300050515 nmdc:mga0a205_504671_c1 nmdc:mga0a205_504671_c1_205_942 244
211 3300000546 LJNas_1004300 LJNas_10043002 245
212 3300005327 Ga0070658_10000819 Ga0070658_100008194 245
213 3300005336 Ga0070680_100001453 Ga0070680_1000014534 245
214 3300005339 Ga0070660_100313115 Ga0070660_1003131151 245
215 3300005340 Ga0070689_100084422 Ga0070689_1000844222 245
216 3300005341 Ga0070691_10008441 Ga0070691_100084412 245
217 3300005435 Ga0070714_100067316 Ga0070714_1000673164 245
218 3300005435 Ga0070714_100223739 Ga0070714_1002237392 245
219 3300005435 Ga0070714_100287826 Ga0070714_1002878262 245
220 3300005436 Ga0070713_100053207 Ga0070713_1000532073 245
221 3300005436 Ga0070713_100529278 Ga0070713_1005292782 245
222 3300005437 Ga0070710_10031294 Ga0070710_100312943 245
223 3300005437 Ga0070710_10168415 Ga0070710_101684153 245
224 3300005445 Ga0070708_100619371 Ga0070708_1006193711 245
225 3300005458 Ga0070681_10000334 Ga0070681_1000033422 245
226 3300005467 Ga0070706_100037665 Ga0070706_1000376653 245
227 3300005467 Ga0070706_100132424 Ga0070706_1001324242 245
228 3300005468 Ga0070707_100177667 Ga0070707_1001776671 245
229 3300005471 Ga0070698_100006786 Ga0070698_1000067867 245
230 3300005471 Ga0070698_100305841 Ga0070698_1003058412 245
231 3300005518 Ga0070699_100317043 Ga0070699_1003170432 245
232 3300005530 Ga0070679_100005911 Ga0070679_1000059115 245
233 3300005530 Ga0070679_100033006 Ga0070679_1000330063 245
234 3300005536 Ga0070697_100164162 Ga0070697_1001641623 245
235 3300005536 Ga0070697_100176064 Ga0070697_1001760644 245
236 3300005536 Ga0070697_100211624 Ga0070697_1002116241 245
237 3300005544 Ga0070686_100166117 Ga0070686_1001661172 245
238 3300005548 Ga0070665_100226975 Ga0070665_1002269751 245
239 3300005577 Ga0068857_100216890 Ga0068857_1002168901 245
240 3300005614 Ga0068856_100311792 Ga0068856_1003117922 245
241 3300005617 Ga0068859_100778343 Ga0068859_1007783432 245
242 3300005843 Ga0068860_100058040 Ga0068860_1000580402 245
243 3300005937 Ga0081455_10000562 Ga0081455_1000056215 245
244 3300005937 Ga0081455_10062061 Ga0081455_100620612 245
245 3300005983 Ga0081540_1006071 Ga0081540_10060713 245
246 3300005983 Ga0081540_1014691 Ga0081540_10146913 245
247 3300006028 Ga0070717_10054899 Ga0070717_100548994 245
248 3300006028 Ga0070717_10097057 Ga0070717_100970572 245
249 3300006028 Ga0070717_10102645 Ga0070717_101026452 245
250 3300006038 Ga0075365_10024882 Ga0075365_100248823 245
251 3300006173 Ga0070716_100670019 Ga0070716_1006700191 245
252 3300006175 Ga0070712_100098534 Ga0070712_1000985343 245
253 3300006175 Ga0070712_100121675 Ga0070712_1001216751 245
254 3300006175 Ga0070712_100136577 Ga0070712_1001365772 245
255 3300006175 Ga0070712_100276826 Ga0070712_1002768262 245
256 3300006177 Ga0075362_10002226 Ga0075362_100022267 245
257 3300006177 Ga0075362_10010939 Ga0075362_100109393 245
258 3300006177 Ga0075362_10135152 Ga0075362_101351522 245
259 3300006177 Ga0075362_10260200 Ga0075362_102602001 245
260 3300006178 Ga0075367_10011310 Ga0075367_100113103 245
261 3300006178 Ga0075367_10024627 Ga0075367_100246274 245
262 3300006178 Ga0075367_10044061 Ga0075367_100440612 245
263 3300006178 Ga0075367_10116508 Ga0075367_101165082 245
264 3300006186 Ga0075369_10014051 Ga0075369_100140513 245
265 3300006186 Ga0075369_10155508 Ga0075369_101555081 245
266 3300006195 Ga0075366_10006657 Ga0075366_100066576 245
267 3300006195 Ga0075366_10122438 Ga0075366_101224382 245
268 3300006846 Ga0075430_100090429 Ga0075430_1000904293 245
269 3300006846 Ga0075430_100649898 Ga0075430_1006498981 245
270 3300006847 Ga0075431_100013649 Ga0075431_1000136493 245
271 3300006847 Ga0075431_100100983 Ga0075431_1001009832 245
272 3300006871 Ga0075434_100297985 Ga0075434_1002979852 245
273 3300006880 Ga0075429_100043138 Ga0075429_1000431383 245
274 3300006880 Ga0075429_100404500 Ga0075429_1004045002 245
275 3300006931 Ga0097620_100778363 Ga0097620_1007783632 245
276 3300007265 Ga0099794_10030471 Ga0099794_100304711 245
277 3300009093 Ga0105240_10004565 Ga0105240_100045655 245
278 3300009147 Ga0114129_10082669 Ga0114129_100826695 245
279 3300009147 Ga0114129_10144803 Ga0114129_101448034 245
280 3300009147 Ga0114129_10203270 Ga0114129_102032703 245
281 3300009176 Ga0105242_10462277 Ga0105242_104622771 245
282 3300009553 Ga0105249_10559484 Ga0105249_105594841 245
283 3300010159 Ga0099796_10047661 Ga0099796_100476612 245
284 3300010159 Ga0099796_10098179 Ga0099796_100981791 245
285 3300010159 Ga0099796_10109531 Ga0099796_101095311 245
286 3300010375 Ga0105239_10435484 Ga0105239_104354842 245
287 3300011119 Ga0105246_10354403 Ga0105246_103544032 245
288 3300013104 Ga0157370_10312168 Ga0157370_103121682 245
289 3300013306 Ga0163162_10195088 Ga0163162_101950882 245
290 3300013308 Ga0157375_10467662 Ga0157375_104676622 245
291 3300014325 Ga0163163_10011881 Ga0163163_100118816 245
292 3300014325 Ga0163163_10651309 Ga0163163_106513092 245
293 3300014968 Ga0157379_10139187 Ga0157379_101391873 245
294 3300021384 Ga0213876_10099392 Ga0213876_100993922 245
295 3300021384 Ga0213876_10137361 Ga0213876_101373612 245
296 3300021388 Ga0213875_10000007 Ga0213875_10000007163 245
297 3300021388 Ga0213875_10000480 Ga0213875_1000048014 245
298 3300021388 Ga0213875_10004720 Ga0213875_100047207 245
299 3300025898 Ga0207692_10045964 Ga0207692_100459642 245
300 3300025898 Ga0207692_10264477 Ga0207692_102644771 245
301 3300025905 Ga0207685_10249882 Ga0207685_102498821 245
302 3300025906 Ga0207699_10110498 Ga0207699_101104981 245
303 3300025910 Ga0207684_10133525 Ga0207684_101335252 245
304 3300025910 Ga0207684_10138987 Ga0207684_101389872 245
305 3300025910 Ga0207684_10252119 Ga0207684_102521192 245
306 3300025912 Ga0207707_10091781 Ga0207707_100917812 245
307 3300025912 Ga0207707_10149642 Ga0207707_101496422 245
308 3300025912 Ga0207707_10481189 Ga0207707_104811891 245
309 3300025915 Ga0207693_10067704 Ga0207693_100677041 245
310 3300025915 Ga0207693_10076106 Ga0207693_100761063 245
311 3300025915 Ga0207693_10094240 Ga0207693_100942402 245
312 3300025915 Ga0207693_10113734 Ga0207693_101137343 245
313 3300025915 Ga0207693_10191339 Ga0207693_101913391 245
314 3300025917 Ga0207660_10202982 Ga0207660_102029822 245
315 3300025921 Ga0207652_10045804 Ga0207652_100458044 245
316 3300025921 Ga0207652_10084118 Ga0207652_100841182 245
317 3300025921 Ga0207652_10172168 Ga0207652_101721682 245
318 3300025922 Ga0207646_10342508 Ga0207646_103425081 245
319 3300025928 Ga0207700_10004193 Ga0207700_100041936 245
320 3300025928 Ga0207700_10091035 Ga0207700_100910352 245
321 3300025928 Ga0207700_10746615 Ga0207700_107466151 245
322 3300025929 Ga0207664_10023723 Ga0207664_100237234 245
323 3300025929 Ga0207664_10149484 Ga0207664_101494842 245
324 3300025929 Ga0207664_10164273 Ga0207664_101642732 245
325 3300025936 Ga0207670_10025769 Ga0207670_100257695 245
326 3300025938 Ga0207704_10306696 Ga0207704_103066962 245
327 3300025939 Ga0207665_10336412 Ga0207665_103364121 245
328 3300025945 Ga0207679_10442661 Ga0207679_104426612 245
329 3300025949 Ga0207667_10226616 Ga0207667_102266162 245
330 3300026078 Ga0207702_10381512 Ga0207702_103815122 245
331 3300026095 Ga0207676_10176451 Ga0207676_101764512 245
332 3300028017 Ga0265356_1000386 Ga0265356_10003863 245
333 3300028379 Ga0268266_10154478 Ga0268266_101544782 245
334 3300028381 Ga0268264_10025183 Ga0268264_100251832 245
335 3300028381 Ga0268264_10399521 Ga0268264_103995211 245
336 3300028573 Ga0265334_10017782 Ga0265334_100177822 245
337 3300028800 Ga0265338_10102823 Ga0265338_101028233 245
338 3300031241 Ga0265325_10028832 Ga0265325_100288322 245
339 3300031548 Ga0307408_100084910 Ga0307408_1000849102 245
340 3300031911 Ga0307412_10212267 Ga0307412_102122672 245
341 3300035083 Ga0373926_0019950 Ga0373926_0019950_535_1275 245
342 3300035113 Ga0373936_0127548 Ga0373936_0127548_20_760 245
343 3300035118 Ga0373954_0236882 Ga0373954_0236882_144_884 245
344 3300035119 Ga0373956_0020528 Ga0373956_0020528_1535_2275 245
345 3300035410 Ga0373924_0014012 Ga0373924_0014012_267_1007 245
346 3300035691 Ga0373931_0062627 Ga0373931_0062627_67_807 245
347 3300035691 Ga0373931_0099214 Ga0373931_0099214_71_811 245
348 3300035692 Ga0373935_0051403 Ga0373935_0051403_867_1607 245
349 3300035692 Ga0373935_0143985 Ga0373935_0143985_277_1017 245
350 3300035695 Ga0373927_0227045 Ga0373927_0227045_220_960 245
351 3300035724 Ga0373933_0401254 Ga0373933_0401254_117_857 245
352 3300035725 Ga0373947_0019189 Ga0373947_0019189_255_995 245
353 3300035725 Ga0373947_0086793 Ga0373947_0086793_53_793 245
354 3300036401 Ga0373937_0003937 Ga0373937_0003937_3430_4170 245
355 3300036401 Ga0373937_0004915 Ga0373937_0004915_408_1148 245
356 3300036401 Ga0373937_0045062 Ga0373937_0045062_2658_3398 245
357 3300037068 Ga0373925_0012361 Ga0373925_0012361_1599_2339 245
358 3300037068 Ga0373925_0119971 Ga0373925_0119971_1016_1756 245
359 3300037312 Ga0395899_0064061 Ga0395899_0064061_1015_1755 245
360 3300037312 Ga0395899_0092164 Ga0395899_0092164_122_862 245
361 3300037466 Ga0395898_0154599 Ga0395898_0154599_551_1291 245
362 3300037853 Ga0436364_0010042 Ga0436364_0010042_10487_11227 245
363 3300037853 Ga0436364_0309649 Ga0436364_0309649_19894_20634 245
364 3300037853 Ga0436364_0575752 Ga0436364_0575752_1234_1974 245
365 3300037853 Ga0436364_1040604 Ga0436364_1040604_52847_53683 245
366 3300037853 Ga0436364_1230704 Ga0436364_1230704_1925_2665 245
367 3300037853 Ga0436364_1280177 Ga0436364_1280177_2561_3301 245
368 3300038443 Ga0395901_0395470 Ga0395901_0395470_608_1348 245
369 3300039437 Ga0436365_0887425 Ga0436365_0887425_54_794 245
370 3300039437 Ga0436365_1411420 Ga0436365_1411420_279_1019 245
371 3300039438 Ga0436360_0488995 Ga0436360_0488995_36_776 245
372 3300039447 Ga0436361_0124257 Ga0436361_0124257_1415_2155 245
373 3300039450 Ga0436363_0489530 Ga0436363_0489530_25_765 245
374 3300039450 Ga0436363_0789910 Ga0436363_0789910_257_997 245
375 3300039453 Ga0436362_1180911 Ga0436362_1180911_474_1214 245
376 3300042461 Ga0439460_0047039 Ga0439460_0047039_139_885 245
377 3300045976 Ga0466967_0309120 Ga0466967_0309120_210_950 245
378 3300046459 Ga0495629_0211238 Ga0495629_0211238_74_814 245
379 3300046462 Ga0495651_0131142 Ga0495651_0131142_889_1629 245
380 3300046463 Ga0495653_0242933 Ga0495653_0242933_146_886 245
381 3300046477 Ga0495664_0011336 Ga0495664_0011336_3739_4479 245
382 3300046516 Ga0495628_0239601 Ga0495628_0239601_511_1251 245
383 3300046529 Ga0495652_0146426 Ga0495652_0146426_576_1316 245
384 3300046535 Ga0495586_0081589 Ga0495586_0081589_959_1699 245
385 3300046536 Ga0495587_0003442 Ga0495587_0003442_2466_3206 245
386 3300046559 Ga0495667_0102533 Ga0495667_0102533_463_1203 245
387 3300046559 Ga0495667_0349883 Ga0495667_0349883_39_779 245
388 3300046663 Ga0495635_0053691 Ga0495635_0053691_299_1039 245
389 3300046675 Ga0495657_0031836 Ga0495657_0031836_1863_2603 245
390 3300046678 Ga0495599_0011527 Ga0495599_0011527_1450_2190 245
391 3300046680 Ga0495646_0083715 Ga0495646_0083715_545_1285 245
392 3300047317 Ga0495604_0113173 Ga0495604_0113173_683_1423 245
393 3300047319 Ga0495674_0200284 Ga0495674_0200284_836_1576 245
394 3300047444 Ga0495675_0136660 Ga0495675_0136660_184_924 245
395 3300047471 Ga0495684_0018224 Ga0495684_0018224_346_1086 245
396 3300048088 Ga0495602_0004234 Ga0495602_0004234_13465_14205 245
397 3300048088 Ga0495602_0238042 Ga0495602_0238042_217_957 245
398 3300048088 Ga0495602_0325485 Ga0495602_0325485_27_767 245
399 3300048907 Ga0496104_0007199 Ga0496104_0007199_358_1116 245
400 3300048908 Ga0496105_0051611 Ga0496105_0051611_1028_1786 245
401 3300048911 Ga0496108_0009412 Ga0496108_0009412_5669_6427 245
402 3300048912 Ga0496109_0005367 Ga0496109_0005367_8699_9457 245
403 3300048913 Ga0496110_0090788 Ga0496110_0090788_1217_1975 245
404 3300048914 Ga0496111_0017923 Ga0496111_0017923_1221_1979 245
405 3300048915 Ga0496112_0001903 Ga0496112_0001903_10805_11563 245
406 3300048916 Ga0496113_0024672 Ga0496113_0024672_2492_3250 245
407 3300048918 Ga0496115_0284810 Ga0496115_0284810_32_790 245
408 3300048922 Ga0496119_0060262 Ga0496119_0060262_320_1063 245
409 3300048923 Ga0496120_0055299 Ga0496120_0055299_24_767 245
410 3300049571 Ga0501034_0274275 Ga0501034_0274275_576_1316 245
411 3300049571 Ga0501034_0540968 Ga0501034_0540968_202_939 245
412 3300049574 Ga0501038_0554174 Ga0501038_0554174_66_806 245
413 3300049579 Ga0501043_0563658 Ga0501043_0563658_89_835 245
414 3300049580 Ga0501046_0202009 Ga0501046_0202009_430_1170 245
415 3300049581 Ga0501047_0065746 Ga0501047_0065746_446_1186 245
416 3300049582 Ga0501048_0101428 Ga0501048_0101428_67_813 245
417 3300049587 Ga0501071_0046171 Ga0501071_0046171_1811_2557 245
418 3300049588 Ga0501072_0184626 Ga0501072_0184626_140_886 245
419 3300049823 Ga0501044_0203158 Ga0501044_0203158_916_1656 245
420 3300050489 nmdc:mga03683_3042_c1 nmdc:mga03683_3042_c1_2791_3558 245
421 3300050489 nmdc:mga03683_33638_c1 nmdc:mga03683_33638_c1_592_1332 245
422 3300050489 nmdc:mga03683_527_c1 nmdc:mga03683_527_c1_1693_2433 245
423 3300050489 nmdc:mga03683_57814_c1 nmdc:mga03683_57814_c1_185_925 245
424 3300050489 nmdc:mga03683_67280_c1 nmdc:mga03683_67280_c1_760_1500 245
425 3300050491 nmdc:mga00v17_433583_c1 nmdc:mga00v17_433583_c1_89_829 245
426 3300050491 nmdc:mga00v17_76903_c1 nmdc:mga00v17_76903_c1_1142_1942 245
427 3300050492 nmdc:mga0yw44_108144_c1 nmdc:mga0yw44_108144_c1_197_937 245
428 3300050492 nmdc:mga0yw44_392287_c1 nmdc:mga0yw44_392287_c1_121_861 245
429 3300050493 nmdc:mga0k408_6009_c1 nmdc:mga0k408_6009_c1_1867_2667 245
430 3300050494 nmdc:mga06z11_23752_c1 nmdc:mga06z11_23752_c1_1723_2463 245
431 3300050494 nmdc:mga06z11_25226_c1 nmdc:mga06z11_25226_c1_233_973 245
432 3300050494 nmdc:mga06z11_66330_c1 nmdc:mga06z11_66330_c1_94_834 245
433 3300050496 nmdc:mga07m45_1679_c1 nmdc:mga07m45_1679_c1_676_1416 245
434 3300050507 nmdc:mga05p37_15470_c1 nmdc:mga05p37_15470_c1_7872_8618 245
435 3300050508 nmdc:mga09592_52160_c1 nmdc:mga09592_52160_c1_29_775 245
436 3300050509 nmdc:mga0qj67_203894_c1 nmdc:mga0qj67_203894_c1_395_1138 245
437 3300050509 nmdc:mga0qj67_33656_c1 nmdc:mga0qj67_33656_c1_1762_2508 245
438 3300050509 nmdc:mga0qj67_586207_c1 nmdc:mga0qj67_586207_c1_103_849 245
439 3300050510 nmdc:mga06r32_18053_c1 nmdc:mga06r32_18053_c1_4193_4939 245
440 3300050511 nmdc:mga08y16_279717_c1 nmdc:mga08y16_279717_c1_361_1101 245
441 3300050511 nmdc:mga08y16_737181_c1 nmdc:mga08y16_737181_c1_143_883 245
442 3300050512 nmdc:mga0n895_474903_c1 nmdc:mga0n895_474903_c1_150_890 245
443 3300050515 nmdc:mga0a205_212924_c1 nmdc:mga0a205_212924_c1_636_1382 245
444 3300050516 nmdc:mga0sz30_5232_c1 nmdc:mga0sz30_5232_c1_1708_2448 245
445 3300050516 nmdc:mga0sz30_5712_c1 nmdc:mga0sz30_5712_c1_2693_3433 245
446 3300053077 Ga0495601_0023364 Ga0495601_0023364_1415_2155 245
447 3300053084 Ga0495595_0015409 Ga0495595_0015409_1749_2489 245
448 3300053084 Ga0495595_0034761 Ga0495595_0034761_1227_1967 245
449 3300053085 Ga0495619_0006325 Ga0495619_0006325_3003_3743 245
450 3300053085 Ga0495619_0030983 Ga0495619_0030983_2318_3058 245
451 3300053085 Ga0495619_0178118 Ga0495619_0178118_276_1016 245
452 3300053093 Ga0500651_0038158 Ga0500651_0038158_2207_2947 245
453 3300053096 Ga0500641_0000784 Ga0500641_0000784_2339_3079 245
454 3300053153 Ga0500616_0003033 Ga0500616_0003033_6479_7246 245
455 3300054114 Ga0501084_0374419 Ga0501084_0374419_86_832 245
456 3300060353 Ga0501082_0079794 Ga0501082_0079794_1224_1970 245
457 3300061734 Ga0530510_0091376 Ga0530510_0091376_584_1330 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

47

277

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.8962 1 242
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8939 1 242
1zix-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a 0.8938 1 245
4u2f-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution 0.8935 1 242
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.8933 1 242
ID Description Score Start End Superfamily
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.927 1 244 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9198 1 244 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9005 1 241 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8969 1 241 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8933 1 242 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0R3DNB0-F1-model_v4 deleted 0.9725 1 245
AF-A0A2E0N7Z6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9684 100 244 GO:0016787
AF-A0A0R3DNB0-F1-model_v4 deleted 0.9646 1 245
AF-A0A2D8YYX0-F1-model_v4 Hydrolase 0.9621 2 245 GO:0016787
AF-A0A2E5PLA0-F1-model_v4 Hydrolase 0.962 1 244 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map